Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q28559 (ACACA_SHEEP) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Acetyl-CoA carboxylase 1

Short name=ACC1
EC=6.4.1.2
Alternative name(s):
ACC-alpha

Including the following 1 domains:

  1. Biotin carboxylase
    EC=6.3.4.14
Gene names
Name:ACACA
Synonyms:ACAC
OrganismOvis aries (Sheep) [Reference proteome]
Taxonomic identifier9940 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeCaprinaeOvis

Protein attributes

Sequence length2346 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.

Catalytic activity

ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA.

ATP + biotin-[carboxyl-carrier-protein] + CO2 = ADP + phosphate + carboxy-biotin-[carboxyl-carrier-protein].

Cofactor

Biotin By similarity.

Binds 2 manganese ions per subunit By similarity.

Enzyme regulation

By phosphorylation By similarity. Activity is increased by oligomerization. Citrate and MID1IP1 promote oligomerization By similarity.

Pathway

Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1.

Subunit structure

Monomer, homodimer, and homotetramer. Can form filamentous polymers. Interacts in its inactive phosphorylated form with the BRCT domains of BRCA1 which prevents ACACA dephosphorylation and inhibits lipid synthesis. Interacts with MID1IP1; interaction with MID1IP1 promotes oligomerization and increases its activity By similarity.

Subcellular location

Cytoplasm.

Tissue specificity

Isoform 2 is expressed at high levels in mammary gland. Ref.2

Induction

Isoform 2 is induced in mammary gland during lactation. Ref.2

Post-translational modification

Phosphorylation on Ser-1263 is required for interaction with BRCA1 By similarity.

Sequence similarities

Contains 1 ATP-grasp domain.

Contains 1 biotin carboxylation domain.

Contains 1 biotinyl-binding domain.

Contains 1 carboxyltransferase domain.

Alternative products

This entry describes 3 isoforms produced by alternative promoter usage. [Align] [Select]
Isoform 1 (identifier: Q28559-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q28559-2)

Also known as: E5A;

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: MGEPSSLAKP...SLQDGLALHM → MEGSAEESKEMRYYMLQ
Isoform 3 (identifier: Q28559-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWWSTLMSILRASSFWKWISAQTIRIIRALRARFEGTM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 23462346Acetyl-CoA carboxylase 1
PRO_0000146766

Regions

Domain117 – 618502Biotin carboxylation
Domain275 – 466192ATP-grasp
Domain752 – 81867Biotinyl-binding
Domain1698 – 2194497Carboxyltransferase
Nucleotide binding315 – 3206ATP Potential

Sites

Active site4411 By similarity
Metal binding4241Manganese 1 By similarity
Metal binding4371Manganese 1 By similarity
Metal binding4371Manganese 2 By similarity
Metal binding4391Manganese 2 By similarity
Binding site18231Coenzyme A By similarity
Binding site21271Coenzyme A By similarity
Binding site21291Coenzyme A By similarity

Amino acid modifications

Modified residue11N-acetylmethionine By similarity
Modified residue51Phosphoserine By similarity
Modified residue231Phosphoserine By similarity
Modified residue251Phosphoserine By similarity
Modified residue291Phosphoserine By similarity
Modified residue531Phosphoserine By similarity
Modified residue781Phosphoserine By similarity
Modified residue801Phosphoserine; by AMPK By similarity
Modified residue7861N6-biotinyllysine By similarity
Modified residue12011Phosphoserine By similarity
Modified residue12161Phosphoserine By similarity
Modified residue12631Phosphoserine By similarity
Modified residue13341N6-acetyllysine By similarity

Natural variations

Alternative sequence1 – 7575MGEPS…LALHM → MEGSAEESKEMRYYMLQ in isoform 2.
VSP_026102
Alternative sequence11M → MWWSTLMSILRASSFWKWIS AQTIRIIRALRARFEGTM in isoform 3.
VSP_026103

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: BCA010ADF6CD24EF

FASTA2,346265,251
        10         20         30         40         50         60 
MGEPSSLAKP LELNQHSRFI IGSVSEDNSE DEISNLVKLD LLEEKEGSLS PASVSSDTLS 

        70         80         90        100        110        120 
DLGISSLQDG LALHMRSSMS GLHLVKQGRD RKKIDSQRDF TVASPAEFVT RFGGNKVIEK 

       130        140        150        160        170        180 
VLIANNGIAA VKCMRSIRRW SYEMFRNERA IRFVVMVTPE DLKANAEYIK MADHYVPVPG 

       190        200        210        220        230        240 
GPNNNNYANV ELILDIARRI PVQAVWAGWG HASENPKLPE LLLKNGIAFM GPPSQAMWAL 

       250        260        270        280        290        300 
GDKIASSIVA QTAGIPTLPW SGSGLCVDWH ENDFSKRILN VPQELYEKGY VKDVDDGLKA 

       310        320        330        340        350        360 
AEEVGYPVMI KASEGGGGKG IRKVNNADDF PNLFRQVQAE VPGSPIFVMR LAKQSRHLEV 

       370        380        390        400        410        420 
QILADQYGNA ISLFGRDCSV QRRHQKIIEE APAAIATPAV FEHMEQCAVK LARMVGYVSA 

       430        440        450        460        470        480 
GTVEYLYSQD GSFYFLELNP RLQVEHPCTE MVADVNLPAA QLQIAMGIPL YRIKDIRMMY 

       490        500        510        520        530        540 
GVSPWGDAPI DFENSAHVPC PRGHVIAARI TSENPDEGFK PSSGTVQELN FRSNKNVWGY 

       550        560        570        580        590        600 
FSVAAAGGLH EFADSQFGHC FSWGENREEA ISNMVVALKE LSIRGDFRTT VEYLIKLLET 

       610        620        630        640        650        660 
ESFQLNRIDT GWLDRLIAEK VQAERPDTML GVVCGALHVA DVSLRNSISN FLHSLERGQV 

       670        680        690        700        710        720 
LSAHTLLNTV DVELIYEGEK IVLKVTRQSP NSYVVIMNGS CVEVDVHRLS DGGLLLSYDG 

       730        740        750        760        770        780 
SSYTTYMKEE VDRYRITIGN KTCVFEKEND PSVLRSPSAG KLIQYIVEDG GHVFAGQCYA 

       790        800        810        820        830        840 
EIEVMKMVMT LTAAESGCIH YVKRPGAALD PGCVIAKMQL DNPSKVQQAE LHTGSLPRIQ 

       850        860        870        880        890        900 
STALRGEKLH RVFHYVLDNL VNVMNGYCLP DPFFSSRVKD WVEGLMKTLR DPSLPLLELQ 

       910        920        930        940        950        960 
DIMTSVSGRI PPNVEKSIKK EMAQYASNIT SVLCQFPSQQ IANILDSHAA TLNRKSEREV 

       970        980        990       1000       1010       1020 
FFMNTQSIVQ LVQRYRSGIR GHMKAVVMDL LRQYLRVETQ FQNGHYDKCV FALREENKSD 

      1030       1040       1050       1060       1070       1080 
MNTVLNYIFS HAQVTKKNLL VTMLIDQLCG RDPTLTDELL NILTELTQLS KTTNAKVALR 

      1090       1100       1110       1120       1130       1140 
ARQVLIASHL PSYELRHNQV ESIFLSAIDM YGHQFCIENL QKLILSETSI FDVLPNFFYH 

      1150       1160       1170       1180       1190       1200 
SNQVVRMAAL EVYVRRAYIA YELNSVQHRQ LKDNTCVVEF QFMLPTSHPN RGNIPTLNRM 

      1210       1220       1230       1240       1250       1260 
SFSSNLNHYG MTHVASVSDV LLDNAFTPPC QRMGGMVSFR TFEDFVRIFD EVMGCFCDSP 

      1270       1280       1290       1300       1310       1320 
PQSPTFPEAG HTSLYDEDKV PRDEPIHILN VAIKTDCDIE DDSLAAMFRE FTQQNKATLV 

      1330       1340       1350       1360       1370       1380 
EHGIRRLTFL VAQKDFRKQV NYEVDQRFHR EFPKFFTFRA RDKFEEDRIY RHLEPALAFQ 

      1390       1400       1410       1420       1430       1440 
LELNRMRNFD LTAIPCANHK MHLYLGAAKV EVGTEVTDYR FFVRAIIRHS DLVTKEASFE 

      1450       1460       1470       1480       1490       1500 
YLQNEGERLL LEAMDELEVA FNNTNVRTDC NHIFLNFVPT VIMDPSKIEE SVRSMVMRYG 

      1510       1520       1530       1540       1550       1560 
SRLWKLRVLQ AELKINIRLT PTGKAIPIRL FLTNESGYYL DISLYKEVTD SRTAQIMFQA 

      1570       1580       1590       1600       1610       1620 
YGDKQGPLHG MLINTPYVTK DLLQSKRFQA QSLGTTYIYD IPEMFRQSLI KLWESMSSQA 

      1630       1640       1650       1660       1670       1680 
FLPPPPLPSD ILTYTELVLD DQGQLVHMNR LPGGNEIGMV AWKMTLKSPE YPDGRDIIVI 

      1690       1700       1710       1720       1730       1740 
GNDITYRIGS FGPQEDLLFL RASELARAEG IPRIYVAANS GARIGLAEEI RHMFHVAWVD 

      1750       1760       1770       1780       1790       1800 
PEDPYKGYKY LYLTPQDYKR VSALNSVHCE HVEDEGESRY KITDIIGKEE GLGAENLRGS 

      1810       1820       1830       1840       1850       1860 
GMIAGESSLA YDEIITISLV TCRAIGIGAY LVRLGQRTIQ VENSHLILTG AGALNKVLGR 

      1870       1880       1890       1900       1910       1920 
EVYTSNNQLG GIQIMHNNGV THSTVCDDFE GVFTVLHWLS YMPKSVYSSV PLLNSKDPID 

      1930       1940       1950       1960       1970       1980 
RVIEFVPTKA PYDPRWMLAG RPHPTQKGQW LSGFFDYGSF SEIMQPWAQT VVVGRARLGG 

      1990       2000       2010       2020       2030       2040 
IPVGVVAVET RTVELSIPAD PANLDSEAKI IQQAGQVWFP DSAFKTYQAI KDFNREGLPL 

      2050       2060       2070       2080       2090       2100 
MVFANWRGFS GGMKDMYDQV LKFGAYIVDG LRECSQPVMV YIPPQAELRG GSWVVIDPTI 

      2110       2120       2130       2140       2150       2160 
NPRHMEMYAD RESRGSVLEP EGTVEIKFRR KDLVKTMRRV DPVYIHLAER LGTPELSARE 

      2170       2180       2190       2200       2210       2220 
RKELESKLKE REEFLLPIYH QVAVQFADLH DTPGRMQEKG VINDILDWKT SRTFFYWRLR 

      2230       2240       2250       2260       2270       2280 
RLLLEDLVKK KIHNANPELT DGQIQAMLRR WFVEVEGTVK AYVWDNNKDL VEWLEKQLTE 

      2290       2300       2310       2320       2330       2340 
EDGVRSVIEE NIKYISRDYV LKQIRSLVQA NPEVAMDSIV HMTQHISPTQ RAEVVRILST 


MDSPST 

« Hide

Isoform 2 (E5A) [UniParc].

Checksum: 0B66EF366FC81E7E
Show »

FASTA2,288259,351
Isoform 3 [UniParc].

Checksum: C697CD9E0D5243C9
Show »

FASTA2,383269,705

References

[1]"Cloning and characterisation of multiple acetyl-CoA carboxylase transcripts in ovine adipose tissue."
Barber M.C., Travers M.T.
Gene 154:271-275(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: Finn-Dorset.
Tissue: Adipose tissue.
[2]"Elucidation of a promoter activity that directs the expression of acetyl-CoA carboxylase alpha with an alternative N-terminus in a tissue-restricted fashion."
Barber M.C., Travers M.T.
Biochem. J. 333:17-25(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-144 (ISOFORM 2), TISSUE SPECIFICITY, INDUCTION BY LACTATION.
Strain: Finn-Dorset.
Tissue: Mammary gland.
[3]"Asymmetric expression of transcripts derived from the shared promoter between the divergently oriented ACACA and TADA2L genes."
Travers M.T., Cambot M., Kennedy H.T., Lenoir G.M., Barber M.C., Joulin V.
Genomics 85:71-84(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-93 (ISOFORM 3).
Tissue: Brain.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X80045 mRNA. Translation: CAA56352.1.
AJ001056 mRNA. Translation: CAA04506.1.
AJ564445 mRNA. Translation: CAD92090.1.
RefSeqNP_001009256.1. NM_001009256.1. [Q28559-1]
UniGeneOar.994.

3D structure databases

ProteinModelPortalQ28559.
SMRQ28559. Positions 97-616, 742-834, 1574-2308.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PRIDEQ28559.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID443186.

Organism-specific databases

CTD31.

Phylogenomic databases

HOVERGENHBG005371.

Enzyme and pathway databases

UniPathwayUPA00655; UER00711.

Family and domain databases

Gene3D3.30.1490.20. 1 hit.
3.30.470.20. 1 hit.
3.40.50.20. 1 hit.
3.90.226.10. 3 hits.
InterProIPR013537. AcCoA_COase_cen.
IPR011761. ATP-grasp.
IPR013815. ATP_grasp_subdomain_1.
IPR013816. ATP_grasp_subdomain_2.
IPR001882. Biotin_BS.
IPR011764. Biotin_carboxylation_dom.
IPR005482. Biotin_COase_C.
IPR000089. Biotin_lipoyl.
IPR005481. CarbamoylP_synth_lsu_N.
IPR000022. Carboxyl_trans.
IPR005479. CbamoylP_synth_lsu-like_ATP-bd.
IPR029045. ClpP/crotonase-like_dom.
IPR011763. COA_CT_C.
IPR011762. COA_CT_N.
IPR016185. PreATP-grasp_dom.
IPR011054. Rudment_hybrid_motif.
IPR011053. Single_hybrid_motif.
[Graphical view]
PfamPF08326. ACC_central. 1 hit.
PF02785. Biotin_carb_C. 1 hit.
PF00364. Biotin_lipoyl. 1 hit.
PF01039. Carboxyl_trans. 1 hit.
PF00289. CPSase_L_chain. 1 hit.
PF02786. CPSase_L_D2. 1 hit.
[Graphical view]
SMARTSM00878. Biotin_carb_C. 1 hit.
[Graphical view]
SUPFAMSSF51230. SSF51230. 1 hit.
SSF51246. SSF51246. 1 hit.
SSF52096. SSF52096. 2 hits.
SSF52440. SSF52440. 1 hit.
PROSITEPS50975. ATP_GRASP. 1 hit.
PS50979. BC. 1 hit.
PS00188. BIOTIN. 1 hit.
PS50968. BIOTINYL_LIPOYL. 1 hit.
PS50989. COA_CT_CTER. 1 hit.
PS50980. COA_CT_NTER. 1 hit.
PS00866. CPSASE_1. 1 hit.
PS00867. CPSASE_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameACACA_SHEEP
AccessionPrimary (citable) accession number: Q28559
Secondary accession number(s): O62847, Q6KEV5
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways