SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q28559

- ACACA_SHEEP

UniProt

Q28559 - ACACA_SHEEP

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Acetyl-CoA carboxylase 1

Gene
ACACA, ACAC
Organism
Ovis aries (Sheep)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.

Catalytic activityi

ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA.
ATP + biotin-[carboxyl-carrier-protein] + CO2 = ADP + phosphate + carboxy-biotin-[carboxyl-carrier-protein].

Cofactori

Biotin By similarity.
Binds 2 manganese ions per subunit By similarity.

Enzyme regulationi

By phosphorylation By similarity. Activity is increased by oligomerization. Citrate and MID1IP1 promote oligomerization By similarity.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi424 – 4241Manganese 1 By similarity
Metal bindingi437 – 4371Manganese 1 By similarity
Metal bindingi437 – 4371Manganese 2 By similarity
Metal bindingi439 – 4391Manganese 2 By similarity
Active sitei441 – 4411 By similarity
Binding sitei1823 – 18231Coenzyme A By similarity
Binding sitei2127 – 21271Coenzyme A By similarity
Binding sitei2129 – 21291Coenzyme A By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi315 – 3206ATP Reviewed prediction

GO - Molecular functioni

  1. acetyl-CoA carboxylase activity Source: UniProtKB
  2. ATP binding Source: UniProtKB-KW
  3. biotin carboxylase activity Source: UniProtKB-EC
  4. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. acetyl-CoA metabolic process Source: UniProtKB
  2. fatty acid biosynthetic process Source: UniProtKB
  3. malonyl-CoA biosynthetic process Source: UniProtKB-UniPathway
  4. protein homotetramerization Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism

Keywords - Ligandi

ATP-binding, Biotin, Manganese, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

UniPathwayiUPA00655; UER00711.

Names & Taxonomyi

Protein namesi
Recommended name:
Acetyl-CoA carboxylase 1 (EC:6.4.1.2)
Short name:
ACC1
Alternative name(s):
ACC-alpha
Including the following 1 domains:
Biotin carboxylase (EC:6.3.4.14)
Gene namesi
Name:ACACA
Synonyms:ACAC
OrganismiOvis aries (Sheep)
Taxonomic identifieri9940 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeCaprinaeOvis
ProteomesiUP000002356: Unplaced

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 23462346Acetyl-CoA carboxylase 1PRO_0000146766Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine By similarity
Modified residuei5 – 51Phosphoserine By similarity
Modified residuei23 – 231Phosphoserine By similarity
Modified residuei25 – 251Phosphoserine By similarity
Modified residuei29 – 291Phosphoserine By similarity
Modified residuei53 – 531Phosphoserine By similarity
Modified residuei78 – 781Phosphoserine By similarity
Modified residuei80 – 801Phosphoserine; by AMPK By similarity
Modified residuei786 – 7861N6-biotinyllysine By similarity
Modified residuei1201 – 12011Phosphoserine By similarity
Modified residuei1216 – 12161Phosphoserine By similarity
Modified residuei1263 – 12631Phosphoserine By similarity
Modified residuei1334 – 13341N6-acetyllysine By similarity

Post-translational modificationi

Phosphorylation on Ser-1263 is required for interaction with BRCA1 By similarity.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PRIDEiQ28559.

Expressioni

Tissue specificityi

Isoform 2 is expressed at high levels in mammary gland.1 Publication

Inductioni

Isoform 2 is induced in mammary gland during lactation.1 Publication

Interactioni

Subunit structurei

Monomer, homodimer, and homotetramer. Can form filamentous polymers. Interacts in its inactive phosphorylated form with the BRCT domains of BRCA1 which prevents ACACA dephosphorylation and inhibits lipid synthesis. Interacts with MID1IP1; interaction with MID1IP1 promotes oligomerization and increases its activity By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ28559.
SMRiQ28559. Positions 97-616, 742-834, 1574-2308.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini117 – 618502Biotin carboxylationAdd
BLAST
Domaini275 – 466192ATP-graspAdd
BLAST
Domaini752 – 81867Biotinyl-bindingAdd
BLAST
Domaini1698 – 2194497CarboxyltransferaseAdd
BLAST

Sequence similaritiesi

Contains 1 ATP-grasp domain.

Phylogenomic databases

HOVERGENiHBG005371.

Family and domain databases

Gene3Di3.30.1490.20. 1 hit.
3.30.470.20. 1 hit.
3.40.50.20. 1 hit.
3.90.226.10. 3 hits.
InterProiIPR013537. AcCoA_COase_cen.
IPR011761. ATP-grasp.
IPR013815. ATP_grasp_subdomain_1.
IPR013816. ATP_grasp_subdomain_2.
IPR001882. Biotin_BS.
IPR011764. Biotin_carboxylation_dom.
IPR005482. Biotin_COase_C.
IPR000089. Biotin_lipoyl.
IPR005481. CarbamoylP_synth_lsu_N.
IPR000022. Carboxyl_trans.
IPR005479. CbamoylP_synth_lsu-like_ATP-bd.
IPR029045. ClpP/crotonase-like_dom.
IPR011763. COA_CT_C.
IPR011762. COA_CT_N.
IPR016185. PreATP-grasp_dom.
IPR011054. Rudment_hybrid_motif.
IPR011053. Single_hybrid_motif.
[Graphical view]
PfamiPF08326. ACC_central. 1 hit.
PF02785. Biotin_carb_C. 1 hit.
PF00364. Biotin_lipoyl. 1 hit.
PF01039. Carboxyl_trans. 1 hit.
PF00289. CPSase_L_chain. 1 hit.
PF02786. CPSase_L_D2. 1 hit.
[Graphical view]
SMARTiSM00878. Biotin_carb_C. 1 hit.
[Graphical view]
SUPFAMiSSF51230. SSF51230. 1 hit.
SSF51246. SSF51246. 1 hit.
SSF52096. SSF52096. 2 hits.
SSF52440. SSF52440. 1 hit.
PROSITEiPS50975. ATP_GRASP. 1 hit.
PS50979. BC. 1 hit.
PS00188. BIOTIN. 1 hit.
PS50968. BIOTINYL_LIPOYL. 1 hit.
PS50989. COA_CT_CTER. 1 hit.
PS50980. COA_CT_NTER. 1 hit.
PS00866. CPSASE_1. 1 hit.
PS00867. CPSASE_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative promoter usage. Align

Isoform 1 (identifier: Q28559-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGEPSSLAKP LELNQHSRFI IGSVSEDNSE DEISNLVKLD LLEEKEGSLS     50
PASVSSDTLS DLGISSLQDG LALHMRSSMS GLHLVKQGRD RKKIDSQRDF 100
TVASPAEFVT RFGGNKVIEK VLIANNGIAA VKCMRSIRRW SYEMFRNERA 150
IRFVVMVTPE DLKANAEYIK MADHYVPVPG GPNNNNYANV ELILDIARRI 200
PVQAVWAGWG HASENPKLPE LLLKNGIAFM GPPSQAMWAL GDKIASSIVA 250
QTAGIPTLPW SGSGLCVDWH ENDFSKRILN VPQELYEKGY VKDVDDGLKA 300
AEEVGYPVMI KASEGGGGKG IRKVNNADDF PNLFRQVQAE VPGSPIFVMR 350
LAKQSRHLEV QILADQYGNA ISLFGRDCSV QRRHQKIIEE APAAIATPAV 400
FEHMEQCAVK LARMVGYVSA GTVEYLYSQD GSFYFLELNP RLQVEHPCTE 450
MVADVNLPAA QLQIAMGIPL YRIKDIRMMY GVSPWGDAPI DFENSAHVPC 500
PRGHVIAARI TSENPDEGFK PSSGTVQELN FRSNKNVWGY FSVAAAGGLH 550
EFADSQFGHC FSWGENREEA ISNMVVALKE LSIRGDFRTT VEYLIKLLET 600
ESFQLNRIDT GWLDRLIAEK VQAERPDTML GVVCGALHVA DVSLRNSISN 650
FLHSLERGQV LSAHTLLNTV DVELIYEGEK IVLKVTRQSP NSYVVIMNGS 700
CVEVDVHRLS DGGLLLSYDG SSYTTYMKEE VDRYRITIGN KTCVFEKEND 750
PSVLRSPSAG KLIQYIVEDG GHVFAGQCYA EIEVMKMVMT LTAAESGCIH 800
YVKRPGAALD PGCVIAKMQL DNPSKVQQAE LHTGSLPRIQ STALRGEKLH 850
RVFHYVLDNL VNVMNGYCLP DPFFSSRVKD WVEGLMKTLR DPSLPLLELQ 900
DIMTSVSGRI PPNVEKSIKK EMAQYASNIT SVLCQFPSQQ IANILDSHAA 950
TLNRKSEREV FFMNTQSIVQ LVQRYRSGIR GHMKAVVMDL LRQYLRVETQ 1000
FQNGHYDKCV FALREENKSD MNTVLNYIFS HAQVTKKNLL VTMLIDQLCG 1050
RDPTLTDELL NILTELTQLS KTTNAKVALR ARQVLIASHL PSYELRHNQV 1100
ESIFLSAIDM YGHQFCIENL QKLILSETSI FDVLPNFFYH SNQVVRMAAL 1150
EVYVRRAYIA YELNSVQHRQ LKDNTCVVEF QFMLPTSHPN RGNIPTLNRM 1200
SFSSNLNHYG MTHVASVSDV LLDNAFTPPC QRMGGMVSFR TFEDFVRIFD 1250
EVMGCFCDSP PQSPTFPEAG HTSLYDEDKV PRDEPIHILN VAIKTDCDIE 1300
DDSLAAMFRE FTQQNKATLV EHGIRRLTFL VAQKDFRKQV NYEVDQRFHR 1350
EFPKFFTFRA RDKFEEDRIY RHLEPALAFQ LELNRMRNFD LTAIPCANHK 1400
MHLYLGAAKV EVGTEVTDYR FFVRAIIRHS DLVTKEASFE YLQNEGERLL 1450
LEAMDELEVA FNNTNVRTDC NHIFLNFVPT VIMDPSKIEE SVRSMVMRYG 1500
SRLWKLRVLQ AELKINIRLT PTGKAIPIRL FLTNESGYYL DISLYKEVTD 1550
SRTAQIMFQA YGDKQGPLHG MLINTPYVTK DLLQSKRFQA QSLGTTYIYD 1600
IPEMFRQSLI KLWESMSSQA FLPPPPLPSD ILTYTELVLD DQGQLVHMNR 1650
LPGGNEIGMV AWKMTLKSPE YPDGRDIIVI GNDITYRIGS FGPQEDLLFL 1700
RASELARAEG IPRIYVAANS GARIGLAEEI RHMFHVAWVD PEDPYKGYKY 1750
LYLTPQDYKR VSALNSVHCE HVEDEGESRY KITDIIGKEE GLGAENLRGS 1800
GMIAGESSLA YDEIITISLV TCRAIGIGAY LVRLGQRTIQ VENSHLILTG 1850
AGALNKVLGR EVYTSNNQLG GIQIMHNNGV THSTVCDDFE GVFTVLHWLS 1900
YMPKSVYSSV PLLNSKDPID RVIEFVPTKA PYDPRWMLAG RPHPTQKGQW 1950
LSGFFDYGSF SEIMQPWAQT VVVGRARLGG IPVGVVAVET RTVELSIPAD 2000
PANLDSEAKI IQQAGQVWFP DSAFKTYQAI KDFNREGLPL MVFANWRGFS 2050
GGMKDMYDQV LKFGAYIVDG LRECSQPVMV YIPPQAELRG GSWVVIDPTI 2100
NPRHMEMYAD RESRGSVLEP EGTVEIKFRR KDLVKTMRRV DPVYIHLAER 2150
LGTPELSARE RKELESKLKE REEFLLPIYH QVAVQFADLH DTPGRMQEKG 2200
VINDILDWKT SRTFFYWRLR RLLLEDLVKK KIHNANPELT DGQIQAMLRR 2250
WFVEVEGTVK AYVWDNNKDL VEWLEKQLTE EDGVRSVIEE NIKYISRDYV 2300
LKQIRSLVQA NPEVAMDSIV HMTQHISPTQ RAEVVRILST MDSPST 2346
Length:2,346
Mass (Da):265,251
Last modified:November 1, 1996 - v1
Checksum:iBCA010ADF6CD24EF
GO
Isoform 2 (identifier: Q28559-2) [UniParc]FASTAAdd to Basket

Also known as: E5A

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: MGEPSSLAKP...SLQDGLALHM → MEGSAEESKEMRYYMLQ

Show »
Length:2,288
Mass (Da):259,351
Checksum:i0B66EF366FC81E7E
GO
Isoform 3 (identifier: Q28559-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWWSTLMSILRASSFWKWISAQTIRIIRALRARFEGTM

Show »
Length:2,383
Mass (Da):269,705
Checksum:iC697CD9E0D5243C9
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7575MGEPS…LALHM → MEGSAEESKEMRYYMLQ in isoform 2. VSP_026102Add
BLAST
Alternative sequencei1 – 11M → MWWSTLMSILRASSFWKWIS AQTIRIIRALRARFEGTM in isoform 3. VSP_026103

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X80045 mRNA. Translation: CAA56352.1.
AJ001056 mRNA. Translation: CAA04506.1.
AJ564445 mRNA. Translation: CAD92090.1.
RefSeqiNP_001009256.1. NM_001009256.1. [Q28559-1]
UniGeneiOar.994.

Genome annotation databases

GeneIDi443186.

Keywords - Coding sequence diversityi

Alternative promoter usage

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X80045 mRNA. Translation: CAA56352.1 .
AJ001056 mRNA. Translation: CAA04506.1 .
AJ564445 mRNA. Translation: CAD92090.1 .
RefSeqi NP_001009256.1. NM_001009256.1. [Q28559-1 ]
UniGenei Oar.994.

3D structure databases

ProteinModelPortali Q28559.
SMRi Q28559. Positions 97-616, 742-834, 1574-2308.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PRIDEi Q28559.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 443186.

Organism-specific databases

CTDi 31.

Phylogenomic databases

HOVERGENi HBG005371.

Enzyme and pathway databases

UniPathwayi UPA00655 ; UER00711 .

Family and domain databases

Gene3Di 3.30.1490.20. 1 hit.
3.30.470.20. 1 hit.
3.40.50.20. 1 hit.
3.90.226.10. 3 hits.
InterProi IPR013537. AcCoA_COase_cen.
IPR011761. ATP-grasp.
IPR013815. ATP_grasp_subdomain_1.
IPR013816. ATP_grasp_subdomain_2.
IPR001882. Biotin_BS.
IPR011764. Biotin_carboxylation_dom.
IPR005482. Biotin_COase_C.
IPR000089. Biotin_lipoyl.
IPR005481. CarbamoylP_synth_lsu_N.
IPR000022. Carboxyl_trans.
IPR005479. CbamoylP_synth_lsu-like_ATP-bd.
IPR029045. ClpP/crotonase-like_dom.
IPR011763. COA_CT_C.
IPR011762. COA_CT_N.
IPR016185. PreATP-grasp_dom.
IPR011054. Rudment_hybrid_motif.
IPR011053. Single_hybrid_motif.
[Graphical view ]
Pfami PF08326. ACC_central. 1 hit.
PF02785. Biotin_carb_C. 1 hit.
PF00364. Biotin_lipoyl. 1 hit.
PF01039. Carboxyl_trans. 1 hit.
PF00289. CPSase_L_chain. 1 hit.
PF02786. CPSase_L_D2. 1 hit.
[Graphical view ]
SMARTi SM00878. Biotin_carb_C. 1 hit.
[Graphical view ]
SUPFAMi SSF51230. SSF51230. 1 hit.
SSF51246. SSF51246. 1 hit.
SSF52096. SSF52096. 2 hits.
SSF52440. SSF52440. 1 hit.
PROSITEi PS50975. ATP_GRASP. 1 hit.
PS50979. BC. 1 hit.
PS00188. BIOTIN. 1 hit.
PS50968. BIOTINYL_LIPOYL. 1 hit.
PS50989. COA_CT_CTER. 1 hit.
PS50980. COA_CT_NTER. 1 hit.
PS00866. CPSASE_1. 1 hit.
PS00867. CPSASE_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Cloning and characterisation of multiple acetyl-CoA carboxylase transcripts in ovine adipose tissue."
    Barber M.C., Travers M.T.
    Gene 154:271-275(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Finn-Dorset.
    Tissue: Adipose tissue.
  2. "Elucidation of a promoter activity that directs the expression of acetyl-CoA carboxylase alpha with an alternative N-terminus in a tissue-restricted fashion."
    Barber M.C., Travers M.T.
    Biochem. J. 333:17-25(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-144 (ISOFORM 2), TISSUE SPECIFICITY, INDUCTION BY LACTATION.
    Strain: Finn-Dorset.
    Tissue: Mammary gland.
  3. "Asymmetric expression of transcripts derived from the shared promoter between the divergently oriented ACACA and TADA2L genes."
    Travers M.T., Cambot M., Kennedy H.T., Lenoir G.M., Barber M.C., Joulin V.
    Genomics 85:71-84(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-93 (ISOFORM 3).
    Tissue: Brain.

Entry informationi

Entry nameiACACA_SHEEP
AccessioniPrimary (citable) accession number: Q28559
Secondary accession number(s): O62847, Q6KEV5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Allosteric enzyme, Complete proteome, Multifunctional enzyme, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi