Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Enolase

Gene

enol-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

2-phospho-D-glycerate = phosphoenolpyruvate + H2O.

Cofactori

Mg2+By similarityNote: Mg2+ is required for catalysis and for stabilizing the dimer.By similarity

Pathwayi: glycolysis

This protein is involved in step 4 of the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate.
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Glyceraldehyde-3-phosphate dehydrogenase 2 (gpd-2), Glyceraldehyde-3-phosphate dehydrogenase 4 (gpd-4), Glyceraldehyde-3-phosphate dehydrogenase 3 (gpd-3), Glyceraldehyde-3-phosphate dehydrogenase 1 (gpd-1)
  2. Probable phosphoglycerate kinase (pgk-1)
  3. 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (ipgm-1)
  4. Enolase (enol-1)
  5. Pyruvate kinase (pyk-1), Pyruvate kinase (pyk-1), Pyruvate kinase (pyk-2), Pyruvate kinase (pyk-2), Pyruvate kinase (pyk-1), Pyruvate kinase (pyk-2), Pyruvate kinase (pyk-1), Pyruvate kinase (pyk-1)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei158 – 1581SubstrateBy similarity
Binding sitei167 – 1671SubstrateBy similarity
Active sitei210 – 2101Proton donorBy similarity
Metal bindingi245 – 2451MagnesiumBy similarity
Metal bindingi294 – 2941MagnesiumBy similarity
Binding sitei294 – 2941SubstrateBy similarity
Metal bindingi319 – 3191MagnesiumBy similarity
Binding sitei319 – 3191SubstrateBy similarity
Active sitei344 – 3441Proton acceptorBy similarity
Binding sitei395 – 3951SubstrateBy similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Lyase

Keywords - Biological processi

Glycolysis

Keywords - Ligandi

Magnesium, Metal-binding

Enzyme and pathway databases

ReactomeiR-CEL-70171. Glycolysis.
R-CEL-70263. Gluconeogenesis.
UniPathwayiUPA00109; UER00187.

Names & Taxonomyi

Protein namesi
Recommended name:
Enolase (EC:4.2.1.11)
Alternative name(s):
2-phospho-D-glycerate hydro-lyase
2-phosphoglycerate dehydratase
Gene namesi
Name:enol-1
ORF Names:T21B10.2
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome II

Organism-specific databases

WormBaseiT21B10.2a; CE03684; WBGene00011884; enol-1.
T21B10.2b; CE32730; WBGene00011884; enol-1.
T21B10.2c; CE36954; WBGene00011884; enol-1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemoved
Chaini2 – 434433EnolasePRO_0000134079Add
BLAST

Proteomic databases

EPDiQ27527.
PaxDbiQ27527.
PRIDEiQ27527.

2D gel databases

World-2DPAGE0020:Q27527.

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

IntActiQ27527. 1 interaction.
STRINGi6239.T21B10.2c.2.

Structurei

3D structure databases

ProteinModelPortaliQ27527.
SMRiQ27527. Positions 3-432.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni371 – 3744Substrate bindingBy similarity

Sequence similaritiesi

Belongs to the enolase family.Curated

Phylogenomic databases

eggNOGiKOG2670. Eukaryota.
COG0148. LUCA.
GeneTreeiENSGT00840000130007.
HOGENOMiHOG000072174.
InParanoidiQ27527.
KOiK01689.
OMAiEAYAGNQ.
PhylomeDBiQ27527.

Family and domain databases

Gene3Di3.20.20.120. 1 hit.
3.30.390.10. 1 hit.
HAMAPiMF_00318. Enolase.
InterProiIPR000941. Enolase.
IPR020810. Enolase_C.
IPR029065. Enolase_C-like.
IPR020809. Enolase_CS.
IPR020811. Enolase_N.
IPR029017. Enolase_N-like.
[Graphical view]
PANTHERiPTHR11902. PTHR11902. 1 hit.
PfamiPF00113. Enolase_C. 1 hit.
PF03952. Enolase_N. 1 hit.
[Graphical view]
PIRSFiPIRSF001400. Enolase. 1 hit.
PRINTSiPR00148. ENOLASE.
SMARTiSM01192. Enolase_C. 1 hit.
SM01193. Enolase_N. 1 hit.
[Graphical view]
SUPFAMiSSF51604. SSF51604. 1 hit.
SSF54826. SSF54826. 1 hit.
TIGRFAMsiTIGR01060. eno. 1 hit.
PROSITEiPS00164. ENOLASE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a (identifier: Q27527-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPITKIHARQ IYDSRGNPTV EVDLFTEKGV FRAAVPSGAS TGVHEALELR
60 70 80 90 100
DGDKAVHLGK GVLKAVSNIN EKIAPALIAK GFDVTAQKDI DDFMMALDGS
110 120 130 140 150
ENKGNLGANA ILGVSLAVAK AGAVHKGLPL YKYIAELAGT GKVVLPVPAF
160 170 180 190 200
NVINGGSHAG NKLAMQEFMI LPVGASSFAE AMRMGSEVYH HLKAEIKKRY
210 220 230 240 250
GLDATAVGDE GGFAPNIQDN KEGLDLLNTA IDKAGYTGKI SIGMDVAASE
260 270 280 290 300
FFKDGKYDLD FKNPASDSSK WLSGEQLTEL YQSFIKEYPV VSIEDAFDQD
310 320 330 340 350
DWDNWGKFHG ATSIQLVGDD LTVTNPKRIQ TAIDKKSCNC LLLKVNQIGS
360 370 380 390 400
VTESIEAAKL SRANGWGVMV SHRSGETEDT FIADLVVGLA TGQIKTGAPC
410 420 430
RSERLAKYNQ LLRIEEELGA DAVYAGHNFR NPQV
Length:434
Mass (Da):46,617
Last modified:January 23, 2007 - v3
Checksum:iDB45F18B26799F68
GO
Isoform b (identifier: Q27527-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     143-239: Missing.

Note: No experimental confirmation available.
Show »
Length:337
Mass (Da):36,359
Checksum:iA5EDA8FC206E356C
GO
Isoform c (identifier: Q27527-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MP → MFVPFTSAAHSLTSLIRGGGQPSKSNLSGQRMP

Note: No experimental confirmation available.
Show »
Length:465
Mass (Da):49,832
Checksum:i94B507E6AE0D47D6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 22MP → MFVPFTSAAHSLTSLIRGGG QPSKSNLSGQRMP in isoform c. CuratedVSP_020148
Alternative sequencei143 – 23997Missing in isoform b. CuratedVSP_020149Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z68318 Genomic DNA. Translation: CAA92692.1.
Z68318 Genomic DNA. Translation: CAD57704.1.
Z68318 Genomic DNA. Translation: CAH10783.1.
PIRiT25040.
RefSeqiNP_001022349.1. NM_001027178.2. [Q27527-3]
NP_495900.1. NM_063499.5. [Q27527-1]
NP_871916.1. NM_182116.5. [Q27527-2]
UniGeneiCel.18035.

Genome annotation databases

EnsemblMetazoaiT21B10.2a.1; T21B10.2a.1; WBGene00011884. [Q27527-1]
T21B10.2a.2; T21B10.2a.2; WBGene00011884. [Q27527-1]
T21B10.2a.3; T21B10.2a.3; WBGene00011884. [Q27527-1]
GeneIDi174423.
KEGGicel:CELE_T21B10.2.
UCSCiT21B10.2c.1. c. elegans. [Q27527-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z68318 Genomic DNA. Translation: CAA92692.1.
Z68318 Genomic DNA. Translation: CAD57704.1.
Z68318 Genomic DNA. Translation: CAH10783.1.
PIRiT25040.
RefSeqiNP_001022349.1. NM_001027178.2. [Q27527-3]
NP_495900.1. NM_063499.5. [Q27527-1]
NP_871916.1. NM_182116.5. [Q27527-2]
UniGeneiCel.18035.

3D structure databases

ProteinModelPortaliQ27527.
SMRiQ27527. Positions 3-432.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ27527. 1 interaction.
STRINGi6239.T21B10.2c.2.

2D gel databases

World-2DPAGE0020:Q27527.

Proteomic databases

EPDiQ27527.
PaxDbiQ27527.
PRIDEiQ27527.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiT21B10.2a.1; T21B10.2a.1; WBGene00011884. [Q27527-1]
T21B10.2a.2; T21B10.2a.2; WBGene00011884. [Q27527-1]
T21B10.2a.3; T21B10.2a.3; WBGene00011884. [Q27527-1]
GeneIDi174423.
KEGGicel:CELE_T21B10.2.
UCSCiT21B10.2c.1. c. elegans. [Q27527-1]

Organism-specific databases

CTDi174423.
WormBaseiT21B10.2a; CE03684; WBGene00011884; enol-1.
T21B10.2b; CE32730; WBGene00011884; enol-1.
T21B10.2c; CE36954; WBGene00011884; enol-1.

Phylogenomic databases

eggNOGiKOG2670. Eukaryota.
COG0148. LUCA.
GeneTreeiENSGT00840000130007.
HOGENOMiHOG000072174.
InParanoidiQ27527.
KOiK01689.
OMAiEAYAGNQ.
PhylomeDBiQ27527.

Enzyme and pathway databases

UniPathwayiUPA00109; UER00187.
ReactomeiR-CEL-70171. Glycolysis.
R-CEL-70263. Gluconeogenesis.

Miscellaneous databases

PROiQ27527.

Family and domain databases

Gene3Di3.20.20.120. 1 hit.
3.30.390.10. 1 hit.
HAMAPiMF_00318. Enolase.
InterProiIPR000941. Enolase.
IPR020810. Enolase_C.
IPR029065. Enolase_C-like.
IPR020809. Enolase_CS.
IPR020811. Enolase_N.
IPR029017. Enolase_N-like.
[Graphical view]
PANTHERiPTHR11902. PTHR11902. 1 hit.
PfamiPF00113. Enolase_C. 1 hit.
PF03952. Enolase_N. 1 hit.
[Graphical view]
PIRSFiPIRSF001400. Enolase. 1 hit.
PRINTSiPR00148. ENOLASE.
SMARTiSM01192. Enolase_C. 1 hit.
SM01193. Enolase_N. 1 hit.
[Graphical view]
SUPFAMiSSF51604. SSF51604. 1 hit.
SSF54826. SSF54826. 1 hit.
TIGRFAMsiTIGR01060. eno. 1 hit.
PROSITEiPS00164. ENOLASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  2. "Two-dimensional gel electrophoresis of Caenorhabditis elegans homogenates and identification of protein spots by microsequencing."
    Bini L., Heid H., Liberatori S., Geier G., Pallini V., Zwilling R.
    Electrophoresis 18:557-562(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 2-11 (ISOFORM A).
    Strain: Bristol N2.

Entry informationi

Entry nameiENO_CAEEL
AccessioniPrimary (citable) accession number: Q27527
Secondary accession number(s): Q6A4N1, Q8I4F9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: June 8, 2016
This is version 122 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.