Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptobrevin-like protein

Gene
N/A
Organism
Schistosoma mansoni (Blood fluke)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Unknown, but synaptobrevins are presumed to be involved in targeting and fusion of synaptic vesicles with the presynaptic membrane as well as in neurotransmitter release.

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptobrevin-like protein
OrganismiSchistosoma mansoni (Blood fluke)
Taxonomic identifieri6183 [NCBI]
Taxonomic lineageiEukaryotaMetazoaPlatyhelminthesTrematodaDigeneaStrigeididaSchistosomatoideaSchistosomatidaeSchistosoma

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 81CytoplasmicCuratedAdd BLAST81
Transmembranei82 – 102Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini103 – 131VesicularCuratedAdd BLAST29

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse, Synaptosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002067631 – 131Synaptobrevin-like proteinAdd BLAST131

Interactioni

Protein-protein interaction databases

STRINGi6183.Smp_102160.1__mRNA.

Structurei

3D structure databases

ProteinModelPortaliQ27236.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 78v-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST61

Sequence similaritiesi

Belongs to the synaptobrevin family.Curated
Contains 1 v-SNARE coiled-coil homology domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0860. Eukaryota.
COG5143. LUCA.
OrthoDBiEOG091G0MPE.

Family and domain databases

Gene3Di1.10.3840.10. 1 hit.
InterProiIPR001388. Synaptobrevin.
[Graphical view]
PfamiPF00957. Synaptobrevin. 1 hit.
[Graphical view]
PRINTSiPR00219. SYNAPTOBREVN.
PROSITEiPS00417. SYNAPTOBREVIN. 1 hit.
PS50892. V_SNARE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: Q27236-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLHITTMTDK APIKTNKRLQ QTQAQVNEVV DIMRVNVDKV LERDKNLSEL
60 70 80 90 100
DGRADALQAG ASQFEASAGK LKRKFWWKNC KMLAVLGVLV VILIIVLIVW
110 120 130
VVSEQKNKVE QSEHSSHHLV MDNSSHLLSE Q
Length:131
Mass (Da):14,842
Last modified:November 1, 1996 - v1
Checksum:iC104ED22D870BDD2
GO
Isoform Short (identifier: Q27236-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     82-131: MLAVLGVLVVILIIVLIVWVVSEQKNKVEQSEHSSHHLVMDNSSHLLSEQ → YGSFLNKKIKLNKVNIHLIIL

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,709
Checksum:i877BADB0FC6C8089
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00632982 – 131MLAVL…LLSEQ → YGSFLNKKIKLNKVNIHLII L in isoform Short. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30183 mRNA. Translation: AAC46892.1.
U30182 mRNA. Translation: AAC46891.1.
U30181 mRNA. Translation: AAC46890.1.
U30180 mRNA. Translation: AAC46889.1.
U30291 Genomic DNA. Translation: AAC46901.1.

Genome annotation databases

GeneDBiSmp_102160.1:pep.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U30183 mRNA. Translation: AAC46892.1.
U30182 mRNA. Translation: AAC46891.1.
U30181 mRNA. Translation: AAC46890.1.
U30180 mRNA. Translation: AAC46889.1.
U30291 Genomic DNA. Translation: AAC46901.1.

3D structure databases

ProteinModelPortaliQ27236.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi6183.Smp_102160.1__mRNA.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneDBiSmp_102160.1:pep.

Phylogenomic databases

eggNOGiKOG0860. Eukaryota.
COG5143. LUCA.
OrthoDBiEOG091G0MPE.

Family and domain databases

Gene3Di1.10.3840.10. 1 hit.
InterProiIPR001388. Synaptobrevin.
[Graphical view]
PfamiPF00957. Synaptobrevin. 1 hit.
[Graphical view]
PRINTSiPR00219. SYNAPTOBREVN.
PROSITEiPS00417. SYNAPTOBREVIN. 1 hit.
PS50892. V_SNARE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSYBL_SCHMA
AccessioniPrimary (citable) accession number: Q27236
Secondary accession number(s): Q26550, Q27353
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: November 1, 1996
Last modified: October 5, 2016
This is version 72 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)

Miscellaneousi

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.