Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q24JP5 (T132A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 65. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transmembrane protein 132A
Alternative name(s):
HSPA5-binding protein 1
Gene names
Name:TMEM132A
Synonyms:HSPA5BP1, KIAA1583
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1023 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation By similarity.

Subunit structure

Interacts with HSPA5/GRP78 By similarity.

Subcellular location

Golgi apparatus membrane; Single-pass type I membrane protein By similarity. Endoplasmic reticulum membrane; Single-pass type I membrane protein By similarity.

Sequence similarities

Belongs to the TMEM132 family.

Sequence caution

The sequence BAB13409.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB14613.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q24JP5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q24JP5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     337-337: D → DS
Note: No experimental confirmation available.
Isoform 3 (identifier: Q24JP5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MCARMAGRTTAAPRGPYGPWLCLLVALALDVVR → MAPGSAPASSGAVIISPSYASS
     405-423: AEELVNTAPLTGVPQHVPV → VRRPPSLPGKAGGQVPGAP
     424-1023: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q24JP5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     46-295: Missing.
     337-337: D → DS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3535 Potential
Chain36 – 1023988Transmembrane protein 132A
PRO_0000287096

Regions

Topological domain36 – 852817Extracellular Potential
Transmembrane853 – 87321Helical; Potential
Topological domain874 – 1023150Cytoplasmic Potential
Region611 – 916306Binds to HSPA5/GRP78 By similarity
Region671 – 1023353Confers cellular localization similar to full-length form By similarity
Compositional bias812 – 83524Glu-rich

Amino acid modifications

Glycosylation2801N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 3333MCARM…LDVVR → MAPGSAPASSGAVIISPSYA SS in isoform 3.
VSP_025302
Alternative sequence46 – 295250Missing in isoform 4.
VSP_025303
Alternative sequence3371D → DS in isoform 2 and isoform 4.
VSP_025304
Alternative sequence405 – 42319AEELV…QHVPV → VRRPPSLPGKAGGQVPGAP in isoform 3.
VSP_025305
Alternative sequence424 – 1023600Missing in isoform 3.
VSP_025306
Natural variant6991R → H.
Corresponds to variant rs524523 [ dbSNP | Ensembl ].
VAR_032262
Natural variant9691A → V. Ref.2
Corresponds to variant rs2469887 [ dbSNP | Ensembl ].
VAR_032263

Experimental info

Sequence conflict101T → R in BAA91245. Ref.2
Sequence conflict8241E → K in BAB14613. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 18, 2006. Version 1.
Checksum: 464408B227D764C8

FASTA1,023110,110
        10         20         30         40         50         60 
MCARMAGRTT AAPRGPYGPW LCLLVALALD VVRVDCGQAP LDPVYLPAAL ELLDAPEHFR 

        70         80         90        100        110        120 
VQQVGHYPPA NSSLSSRSET FLLLQPWPRA QPLLRASYPP FATQQVVPPR VTEPHQRPVP 

       130        140        150        160        170        180 
WDVRAVSVEA AVTPAEPYAR VLFHLKGQDW PPGSGSLPCA RLHATHPAGT AHQACRFQPS 

       190        200        210        220        230        240 
LGACVVELEL PSHWFSQAST TRAELAYTLE PAAEGPGGCG SGEENDPGEQ ALPVGGVELR 

       250        260        270        280        290        300 
PADPPQYQEV PLDEAVTLRV PDMPVRPGQL FSATLLLRHN FTASLLTLRI KVKKGLHVTA 

       310        320        330        340        350        360 
ARPAQPTLWT AKLDRFKGSR HHTTLITCHR AGLTEPDSSP LELSEFLWVD FVVENSTGGG 

       370        380        390        400        410        420 
VAVTRPVTWQ LEYPGQAPEA EKDKMVWEIL VSERDIRALI PLAKAEELVN TAPLTGVPQH 

       430        440        450        460        470        480 
VPVRLVTVDG GGALVEVTEH VGCESANTQV LQVSEACDAV FVAGKESRGA RGVRVDFWWR 

       490        500        510        520        530        540 
RLRASLRLTV WAPLLPLRIE LTDTTLEQVR GWRVPGPAEG PAEPAAEASD EAERRARGCH 

       550        560        570        580        590        600 
LQYQRAGVRF LAPFAAHPLD GGRRLTHLLG PDWLLDVSHL VAPHARVLDS RVASLEGGRV 

       610        620        630        640        650        660 
VVGREPGVTS IEVRSPLSDS ILGEQALAVT DDKVSVLELR VQPVMGISLT LSRGTAHPGE 

       670        680        690        700        710        720 
VTATCWAQSA LPAPKQEVAL SLWLSFSDHT VAPAELYDRR DLGLSVSAEE PGAILPAEEQ 

       730        740        750        760        770        780 
GAQLGVVVSG AGAEGLPLHV ALHPPEPCRR GRHRVPLASG TAWLGLPPAS TPAPALPSSP 

       790        800        810        820        830        840 
AWSPPATEAT MGGKRQVAGS VGGNTGVRGK FERAEEEARK EETEAREEEE EEEEEMVPAP 

       850        860        870        880        890        900 
QHVTELELGM YALLGVFCVA IFIFLVNGVV FVLRYQRKEP PDSATDPTSP QPHNWVWLGT 

       910        920        930        940        950        960 
DQEELSRQLD RQSPGPPKGE GSCPCESGGG GEAPTLAPGP PGGTTSSSST LARKEAGGRR 

       970        980        990       1000       1010       1020 
KRVEFVTFAP APPAQSPEEP VGAPAVQSIL VAGEEDIRWV CEDMGLKDPE ELRNYMERIR 


GSS 

« Hide

Isoform 2 [UniParc].

Checksum: 0CF1381EF2F126CE
Show »

FASTA1,024110,197
Isoform 3 [UniParc].

Checksum: D64FED452F29A03C
Show »

FASTA41244,358
Isoform 4 [UniParc].

Checksum: 7CE22843F97A190E
Show »

FASTA77483,098

References

[1]"Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1023 (ISOFORM 1), VARIANT VAL-969.
Tissue: Placenta.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-560 (ISOFORM 2).
Tissue: Brain.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-560 (ISOFORM 1).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB046803 mRNA. Translation: BAB13409.1. Different initiation.
AK000546 mRNA. Translation: BAA91245.1.
AK023577 mRNA. Translation: BAB14613.1. Different initiation.
BC028106 mRNA. Translation: AAH28106.1.
BC032059 mRNA. Translation: AAH32059.1.
BC114569 mRNA. Translation: AAI14570.1.
AL359557 mRNA. Translation: CAH10668.2.
RefSeqNP_060340.2. NM_017870.3.
NP_821174.1. NM_178031.2.
UniGeneHs.118552.

3D structure databases

ProteinModelPortalQ24JP5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120309. 2 interactions.
IntActQ24JP5. 1 interaction.
STRING9606.ENSP00000005286.

PTM databases

PhosphoSiteQ24JP5.

Polymorphism databases

DMDM121940967.

Proteomic databases

PaxDbQ24JP5.
PRIDEQ24JP5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000005286; ENSP00000005286; ENSG00000006118. [Q24JP5-2]
ENST00000453848; ENSP00000405823; ENSG00000006118. [Q24JP5-1]
GeneID54972.
KEGGhsa:54972.
UCSCuc001nqi.3. human. [Q24JP5-2]
uc001nqj.3. human. [Q24JP5-1]
uc001nqk.3. human. [Q24JP5-3]

Organism-specific databases

CTD54972.
GeneCardsGC11P060691.
HGNCHGNC:31092. TMEM132A.
HPAHPA051979.
neXtProtNX_Q24JP5.
PharmGKBPA134886953.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG253956.
HOVERGENHBG099719.
InParanoidQ24JP5.
KOK17599.
OMAYQRKEPP.
OrthoDBEOG7DJSKK.
PhylomeDBQ24JP5.
TreeFamTF314981.

Gene expression databases

ArrayExpressQ24JP5.
BgeeQ24JP5.
CleanExHS_TMEM132A.
GenevestigatorQ24JP5.

Family and domain databases

InterProIPR026307. TMEM132.
[Graphical view]
PANTHERPTHR13388. PTHR13388. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi54972.
NextBio58216.
PROQ24JP5.

Entry information

Entry nameT132A_HUMAN
AccessionPrimary (citable) accession number: Q24JP5
Secondary accession number(s): Q69YU7 expand/collapse secondary AC list , Q86VZ8, Q86W97, Q9H8K3, Q9HCI9, Q9NWY0
Entry history
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: April 18, 2006
Last modified: April 16, 2014
This is version 65 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM