Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q24JP5

- T132A_HUMAN

UniProt

Q24JP5 - T132A_HUMAN

Protein

Transmembrane protein 132A

Gene

TMEM132A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 68 (01 Oct 2014)
      Sequence version 1 (18 Apr 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation By similarity.By similarity

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transmembrane protein 132A
    Alternative name(s):
    HSPA5-binding protein 1
    Gene namesi
    Name:TMEM132A
    Synonyms:HSPA5BP1, KIAA1583
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:31092. TMEM132A.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. Golgi membrane Source: UniProtKB-SubCell
    3. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134886953.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3535Sequence AnalysisAdd
    BLAST
    Chaini36 – 1023988Transmembrane protein 132APRO_0000287096Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi280 – 2801N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ24JP5.
    PaxDbiQ24JP5.
    PRIDEiQ24JP5.

    PTM databases

    PhosphoSiteiQ24JP5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ24JP5.
    BgeeiQ24JP5.
    CleanExiHS_TMEM132A.
    GenevestigatoriQ24JP5.

    Organism-specific databases

    HPAiHPA051979.

    Interactioni

    Subunit structurei

    Interacts with HSPA5/GRP78.By similarity

    Protein-protein interaction databases

    BioGridi120309. 2 interactions.
    IntActiQ24JP5. 1 interaction.
    STRINGi9606.ENSP00000005286.

    Structurei

    3D structure databases

    ProteinModelPortaliQ24JP5.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini36 – 852817ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini874 – 1023150CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei853 – 87321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni611 – 916306Binds to HSPA5/GRP78By similarityAdd
    BLAST
    Regioni671 – 1023353Confers cellular localization similar to full-length formBy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi812 – 83524Glu-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the TMEM132 family.Curated

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG253956.
    HOVERGENiHBG099719.
    InParanoidiQ24JP5.
    KOiK17599.
    OMAiYQRKEPP.
    OrthoDBiEOG7DJSKK.
    PhylomeDBiQ24JP5.
    TreeFamiTF314981.

    Family and domain databases

    InterProiIPR026307. TMEM132.
    [Graphical view]
    PANTHERiPTHR13388. PTHR13388. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q24JP5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MCARMAGRTT AAPRGPYGPW LCLLVALALD VVRVDCGQAP LDPVYLPAAL     50
    ELLDAPEHFR VQQVGHYPPA NSSLSSRSET FLLLQPWPRA QPLLRASYPP 100
    FATQQVVPPR VTEPHQRPVP WDVRAVSVEA AVTPAEPYAR VLFHLKGQDW 150
    PPGSGSLPCA RLHATHPAGT AHQACRFQPS LGACVVELEL PSHWFSQAST 200
    TRAELAYTLE PAAEGPGGCG SGEENDPGEQ ALPVGGVELR PADPPQYQEV 250
    PLDEAVTLRV PDMPVRPGQL FSATLLLRHN FTASLLTLRI KVKKGLHVTA 300
    ARPAQPTLWT AKLDRFKGSR HHTTLITCHR AGLTEPDSSP LELSEFLWVD 350
    FVVENSTGGG VAVTRPVTWQ LEYPGQAPEA EKDKMVWEIL VSERDIRALI 400
    PLAKAEELVN TAPLTGVPQH VPVRLVTVDG GGALVEVTEH VGCESANTQV 450
    LQVSEACDAV FVAGKESRGA RGVRVDFWWR RLRASLRLTV WAPLLPLRIE 500
    LTDTTLEQVR GWRVPGPAEG PAEPAAEASD EAERRARGCH LQYQRAGVRF 550
    LAPFAAHPLD GGRRLTHLLG PDWLLDVSHL VAPHARVLDS RVASLEGGRV 600
    VVGREPGVTS IEVRSPLSDS ILGEQALAVT DDKVSVLELR VQPVMGISLT 650
    LSRGTAHPGE VTATCWAQSA LPAPKQEVAL SLWLSFSDHT VAPAELYDRR 700
    DLGLSVSAEE PGAILPAEEQ GAQLGVVVSG AGAEGLPLHV ALHPPEPCRR 750
    GRHRVPLASG TAWLGLPPAS TPAPALPSSP AWSPPATEAT MGGKRQVAGS 800
    VGGNTGVRGK FERAEEEARK EETEAREEEE EEEEEMVPAP QHVTELELGM 850
    YALLGVFCVA IFIFLVNGVV FVLRYQRKEP PDSATDPTSP QPHNWVWLGT 900
    DQEELSRQLD RQSPGPPKGE GSCPCESGGG GEAPTLAPGP PGGTTSSSST 950
    LARKEAGGRR KRVEFVTFAP APPAQSPEEP VGAPAVQSIL VAGEEDIRWV 1000
    CEDMGLKDPE ELRNYMERIR GSS 1023
    Length:1,023
    Mass (Da):110,110
    Last modified:April 18, 2006 - v1
    Checksum:i464408B227D764C8
    GO
    Isoform 2 (identifier: Q24JP5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         337-337: D → DS

    Note: No experimental confirmation available.

    Show »
    Length:1,024
    Mass (Da):110,197
    Checksum:i0CF1381EF2F126CE
    GO
    Isoform 3 (identifier: Q24JP5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-33: MCARMAGRTTAAPRGPYGPWLCLLVALALDVVR → MAPGSAPASSGAVIISPSYASS
         405-423: AEELVNTAPLTGVPQHVPV → VRRPPSLPGKAGGQVPGAP
         424-1023: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:412
    Mass (Da):44,358
    Checksum:iD64FED452F29A03C
    GO
    Isoform 4 (identifier: Q24JP5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         46-295: Missing.
         337-337: D → DS

    Note: No experimental confirmation available.

    Show »
    Length:774
    Mass (Da):83,098
    Checksum:i7CE22843F97A190E
    GO

    Sequence cautioni

    The sequence BAB13409.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB14613.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti10 – 101T → R in BAA91245. (PubMed:14702039)Curated
    Sequence conflicti824 – 8241E → K in BAB14613. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti699 – 6991R → H.
    Corresponds to variant rs524523 [ dbSNP | Ensembl ].
    VAR_032262
    Natural varianti969 – 9691A → V.1 Publication
    Corresponds to variant rs2469887 [ dbSNP | Ensembl ].
    VAR_032263

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3333MCARM…LDVVR → MAPGSAPASSGAVIISPSYA SS in isoform 3. 1 PublicationVSP_025302Add
    BLAST
    Alternative sequencei46 – 295250Missing in isoform 4. 1 PublicationVSP_025303Add
    BLAST
    Alternative sequencei337 – 3371D → DS in isoform 2 and isoform 4. 2 PublicationsVSP_025304
    Alternative sequencei405 – 42319AEELV…QHVPV → VRRPPSLPGKAGGQVPGAP in isoform 3. 1 PublicationVSP_025305Add
    BLAST
    Alternative sequencei424 – 1023600Missing in isoform 3. 1 PublicationVSP_025306Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB046803 mRNA. Translation: BAB13409.1. Different initiation.
    AK000546 mRNA. Translation: BAA91245.1.
    AK023577 mRNA. Translation: BAB14613.1. Different initiation.
    BC028106 mRNA. Translation: AAH28106.1.
    BC032059 mRNA. Translation: AAH32059.1.
    BC114569 mRNA. Translation: AAI14570.1.
    AL359557 mRNA. Translation: CAH10668.2.
    CCDSiCCDS44618.1. [Q24JP5-1]
    CCDS7997.1. [Q24JP5-2]
    RefSeqiNP_060340.2. NM_017870.3. [Q24JP5-2]
    NP_821174.1. NM_178031.2. [Q24JP5-1]
    UniGeneiHs.118552.

    Genome annotation databases

    EnsembliENST00000005286; ENSP00000005286; ENSG00000006118. [Q24JP5-2]
    ENST00000453848; ENSP00000405823; ENSG00000006118. [Q24JP5-1]
    GeneIDi54972.
    KEGGihsa:54972.
    UCSCiuc001nqi.3. human. [Q24JP5-2]
    uc001nqj.3. human. [Q24JP5-1]
    uc001nqk.3. human. [Q24JP5-3]

    Polymorphism databases

    DMDMi121940967.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB046803 mRNA. Translation: BAB13409.1 . Different initiation.
    AK000546 mRNA. Translation: BAA91245.1 .
    AK023577 mRNA. Translation: BAB14613.1 . Different initiation.
    BC028106 mRNA. Translation: AAH28106.1 .
    BC032059 mRNA. Translation: AAH32059.1 .
    BC114569 mRNA. Translation: AAI14570.1 .
    AL359557 mRNA. Translation: CAH10668.2 .
    CCDSi CCDS44618.1. [Q24JP5-1 ]
    CCDS7997.1. [Q24JP5-2 ]
    RefSeqi NP_060340.2. NM_017870.3. [Q24JP5-2 ]
    NP_821174.1. NM_178031.2. [Q24JP5-1 ]
    UniGenei Hs.118552.

    3D structure databases

    ProteinModelPortali Q24JP5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120309. 2 interactions.
    IntActi Q24JP5. 1 interaction.
    STRINGi 9606.ENSP00000005286.

    PTM databases

    PhosphoSitei Q24JP5.

    Polymorphism databases

    DMDMi 121940967.

    Proteomic databases

    MaxQBi Q24JP5.
    PaxDbi Q24JP5.
    PRIDEi Q24JP5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000005286 ; ENSP00000005286 ; ENSG00000006118 . [Q24JP5-2 ]
    ENST00000453848 ; ENSP00000405823 ; ENSG00000006118 . [Q24JP5-1 ]
    GeneIDi 54972.
    KEGGi hsa:54972.
    UCSCi uc001nqi.3. human. [Q24JP5-2 ]
    uc001nqj.3. human. [Q24JP5-1 ]
    uc001nqk.3. human. [Q24JP5-3 ]

    Organism-specific databases

    CTDi 54972.
    GeneCardsi GC11P060691.
    HGNCi HGNC:31092. TMEM132A.
    HPAi HPA051979.
    neXtProti NX_Q24JP5.
    PharmGKBi PA134886953.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG253956.
    HOVERGENi HBG099719.
    InParanoidi Q24JP5.
    KOi K17599.
    OMAi YQRKEPP.
    OrthoDBi EOG7DJSKK.
    PhylomeDBi Q24JP5.
    TreeFami TF314981.

    Miscellaneous databases

    GenomeRNAii 54972.
    NextBioi 58216.
    PROi Q24JP5.

    Gene expression databases

    ArrayExpressi Q24JP5.
    Bgeei Q24JP5.
    CleanExi HS_TMEM132A.
    Genevestigatori Q24JP5.

    Family and domain databases

    InterProi IPR026307. TMEM132.
    [Graphical view ]
    PANTHERi PTHR13388. PTHR13388. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
      DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1023 (ISOFORM 1), VARIANT VAL-969.
      Tissue: Placenta.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-560 (ISOFORM 2).
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-560 (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiT132A_HUMAN
    AccessioniPrimary (citable) accession number: Q24JP5
    Secondary accession number(s): Q69YU7
    , Q86VZ8, Q86W97, Q9H8K3, Q9HCI9, Q9NWY0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 15, 2007
    Last sequence update: April 18, 2006
    Last modified: October 1, 2014
    This is version 68 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3