Q24JP5 (T132A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 57.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transmembrane protein 132A Alternative name(s): HSPA5-binding protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1023 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation By similarity. |
| Subunit structure | Interacts with HSPA5/GRP78 By similarity. |
| Subcellular location | Golgi apparatus membrane; Single-pass type I membrane protein By similarity. Endoplasmic reticulum membrane; Single-pass type I membrane protein By similarity. |
| Sequence similarities | Belongs to the TMEM132 family. |
| Sequence caution | The sequence BAB13409.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB14613.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell endoplasmic reticulum membraneInferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q24JP5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q24JP5-2) The sequence of this isoform differs from the canonical sequence as follows: 337-337: D → DS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q24JP5-3) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MCARMAGRTTAAPRGPYGPWLCLLVALALDVVR → MAPGSAPASSGAVIISPSYASS 405-423: AEELVNTAPLTGVPQHVPV → VRRPPSLPGKAGGQVPGAP 424-1023: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q24JP5-4) The sequence of this isoform differs from the canonical sequence as follows: 46-295: Missing. 337-337: D → DS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 35 | 35 | Potential | ||||||
| Chain | 36 – 1023 | 988 | Transmembrane protein 132A | PRO_0000287096 | |||||
Regions | |||||||||
| Topological domain | 36 – 852 | 817 | Extracellular Potential | ||||||
| Transmembrane | 853 – 873 | 21 | Helical; Potential | ||||||
| Topological domain | 874 – 1023 | 150 | Cytoplasmic Potential | ||||||
| Region | 611 – 916 | 306 | Binds to HSPA5/GRP78 By similarity | ||||||
| Region | 671 – 1023 | 353 | Confers cellular localization similar to full-length form By similarity | ||||||
| Compositional bias | 812 – 835 | 24 | Glu-rich | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 280 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MCARM…LDVVR → MAPGSAPASSGAVIISPSYA SS in isoform 3. | VSP_025302 | |||||
| Alternative sequence | 46 – 295 | 250 | Missing in isoform 4. | VSP_025303 | |||||
| Alternative sequence | 337 | 1 | D → DS in isoform 2 and isoform 4. | VSP_025304 | |||||
| Alternative sequence | 405 – 423 | 19 | AEELV…QHVPV → VRRPPSLPGKAGGQVPGAP in isoform 3. | VSP_025305 | |||||
| Alternative sequence | 424 – 1023 | 600 | Missing in isoform 3. | VSP_025306 | |||||
| Natural variant | 699 | 1 | R → H. Corresponds to variant rs524523 [ dbSNP | Ensembl ]. | VAR_032262 | |||||
| Natural variant | 969 | 1 | A → V. Ref.2 Corresponds to variant rs2469887 [ dbSNP | Ensembl ]. | VAR_032263 | |||||
Experimental info | |||||||||
| Sequence conflict | 10 | 1 | T → R in BAA91245. Ref.2 | ||||||
| Sequence conflict | 824 | 1 | E → K in BAB14613. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1023 (ISOFORM 1), VARIANT VAL-969. Tissue: Placenta. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-560 (ISOFORM 2). Tissue: Brain. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-560 (ISOFORM 1). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB046803 mRNA. Translation: BAB13409.1. Different initiation. AK000546 mRNA. Translation: BAA91245.1. AK023577 mRNA. Translation: BAB14613.1. Different initiation. BC028106 mRNA. Translation: AAH28106.1. BC032059 mRNA. Translation: AAH32059.1. BC114569 mRNA. Translation: AAI14570.1. AL359557 mRNA. Translation: CAH10668.2. |
| IPI | IPI00301865. IPI00383814. IPI00845230. IPI00845309. |
| RefSeq | NP_060340.2. NM_017870.3. NP_821174.1. NM_178031.2. |
| UniGene | Hs.118552. |
3D structure databases | |
| ProteinModelPortal | Q24JP5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q24JP5. 1 interaction. |
| STRING | 9606.ENSP00000005286. |
PTM databases | |
| PhosphoSite | Q24JP5. |
Polymorphism databases | |
| DMDM | 121940967. |
Proteomic databases | |
| PaxDb | Q24JP5. |
| PRIDE | Q24JP5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000005286; ENSP00000005286; ENSG00000006118. ENST00000453848; ENSP00000405823; ENSG00000006118. |
| GeneID | 54972. |
| KEGG | hsa:54972. |
| UCSC | uc001nqi.3. human. uc001nqj.3. human. uc001nqk.3. human. |
Organism-specific databases | |
| CTD | 54972. |
| GeneCards | GC11P060691. |
| HGNC | HGNC:31092. TMEM132A. |
| HPA | HPA051979. |
| neXtProt | NX_Q24JP5. |
| PharmGKB | PA134886953. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG253956. |
| HOVERGEN | HBG099719. |
| InParanoid | Q24JP5. |
| OMA | GACVVEL. |
Gene expression databases | |
| ArrayExpress | Q24JP5. |
| Bgee | Q24JP5. |
| CleanEx | HS_TMEM132A. |
| Genevestigator | Q24JP5. |
Family and domain databases | |
| InterPro | IPR026307. TMEM132. [Graphical view] |
| PANTHER | PTHR13388. PTHR13388. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 54972. |
| NextBio | 58216. |
Entry information
| Entry name | T132A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q24JP5 Secondary accession number(s): Q69YU7 Q9NWY0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
