Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 132A

Gene

TMEM132A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation (By similarity).By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 132A
Alternative name(s):
HSPA5-binding protein 1
Gene namesi
Name:TMEM132A
Synonyms:HSPA5BP1, KIAA1583
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:31092. TMEM132A.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini36 – 852817ExtracellularSequence AnalysisAdd
BLAST
Transmembranei853 – 87321HelicalSequence AnalysisAdd
BLAST
Topological domaini874 – 1023150CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134886953.

Polymorphism and mutation databases

BioMutaiTMEM132A.
DMDMi121940967.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3535Sequence AnalysisAdd
BLAST
Chaini36 – 1023988Transmembrane protein 132APRO_0000287096Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi280 – 2801N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ24JP5.
PaxDbiQ24JP5.
PRIDEiQ24JP5.

PTM databases

PhosphoSiteiQ24JP5.

Expressioni

Gene expression databases

BgeeiQ24JP5.
CleanExiHS_TMEM132A.
ExpressionAtlasiQ24JP5. baseline and differential.
GenevisibleiQ24JP5. HS.

Organism-specific databases

HPAiHPA051979.

Interactioni

Subunit structurei

Interacts with HSPA5/GRP78.By similarity

Protein-protein interaction databases

BioGridi120309. 12 interactions.
IntActiQ24JP5. 1 interaction.
STRINGi9606.ENSP00000005286.

Structurei

3D structure databases

ProteinModelPortaliQ24JP5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni611 – 916306Binds to HSPA5/GRP78By similarityAdd
BLAST
Regioni671 – 1023353Confers cellular localization similar to full-length formBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi812 – 83524Glu-richAdd
BLAST

Sequence similaritiesi

Belongs to the TMEM132 family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253956.
GeneTreeiENSGT00550000074550.
HOVERGENiHBG099719.
InParanoidiQ24JP5.
KOiK17599.
OMAiYQRKEPP.
OrthoDBiEOG7DJSKK.
PhylomeDBiQ24JP5.
TreeFamiTF314981.

Family and domain databases

InterProiIPR026307. TMEM132.
[Graphical view]
PANTHERiPTHR13388. PTHR13388. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q24JP5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCARMAGRTT AAPRGPYGPW LCLLVALALD VVRVDCGQAP LDPVYLPAAL
60 70 80 90 100
ELLDAPEHFR VQQVGHYPPA NSSLSSRSET FLLLQPWPRA QPLLRASYPP
110 120 130 140 150
FATQQVVPPR VTEPHQRPVP WDVRAVSVEA AVTPAEPYAR VLFHLKGQDW
160 170 180 190 200
PPGSGSLPCA RLHATHPAGT AHQACRFQPS LGACVVELEL PSHWFSQAST
210 220 230 240 250
TRAELAYTLE PAAEGPGGCG SGEENDPGEQ ALPVGGVELR PADPPQYQEV
260 270 280 290 300
PLDEAVTLRV PDMPVRPGQL FSATLLLRHN FTASLLTLRI KVKKGLHVTA
310 320 330 340 350
ARPAQPTLWT AKLDRFKGSR HHTTLITCHR AGLTEPDSSP LELSEFLWVD
360 370 380 390 400
FVVENSTGGG VAVTRPVTWQ LEYPGQAPEA EKDKMVWEIL VSERDIRALI
410 420 430 440 450
PLAKAEELVN TAPLTGVPQH VPVRLVTVDG GGALVEVTEH VGCESANTQV
460 470 480 490 500
LQVSEACDAV FVAGKESRGA RGVRVDFWWR RLRASLRLTV WAPLLPLRIE
510 520 530 540 550
LTDTTLEQVR GWRVPGPAEG PAEPAAEASD EAERRARGCH LQYQRAGVRF
560 570 580 590 600
LAPFAAHPLD GGRRLTHLLG PDWLLDVSHL VAPHARVLDS RVASLEGGRV
610 620 630 640 650
VVGREPGVTS IEVRSPLSDS ILGEQALAVT DDKVSVLELR VQPVMGISLT
660 670 680 690 700
LSRGTAHPGE VTATCWAQSA LPAPKQEVAL SLWLSFSDHT VAPAELYDRR
710 720 730 740 750
DLGLSVSAEE PGAILPAEEQ GAQLGVVVSG AGAEGLPLHV ALHPPEPCRR
760 770 780 790 800
GRHRVPLASG TAWLGLPPAS TPAPALPSSP AWSPPATEAT MGGKRQVAGS
810 820 830 840 850
VGGNTGVRGK FERAEEEARK EETEAREEEE EEEEEMVPAP QHVTELELGM
860 870 880 890 900
YALLGVFCVA IFIFLVNGVV FVLRYQRKEP PDSATDPTSP QPHNWVWLGT
910 920 930 940 950
DQEELSRQLD RQSPGPPKGE GSCPCESGGG GEAPTLAPGP PGGTTSSSST
960 970 980 990 1000
LARKEAGGRR KRVEFVTFAP APPAQSPEEP VGAPAVQSIL VAGEEDIRWV
1010 1020
CEDMGLKDPE ELRNYMERIR GSS
Length:1,023
Mass (Da):110,110
Last modified:April 18, 2006 - v1
Checksum:i464408B227D764C8
GO
Isoform 2 (identifier: Q24JP5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     337-337: D → DS

Note: No experimental confirmation available.
Show »
Length:1,024
Mass (Da):110,197
Checksum:i0CF1381EF2F126CE
GO
Isoform 3 (identifier: Q24JP5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MCARMAGRTTAAPRGPYGPWLCLLVALALDVVR → MAPGSAPASSGAVIISPSYASS
     405-423: AEELVNTAPLTGVPQHVPV → VRRPPSLPGKAGGQVPGAP
     424-1023: Missing.

Note: No experimental confirmation available.
Show »
Length:412
Mass (Da):44,358
Checksum:iD64FED452F29A03C
GO
Isoform 4 (identifier: Q24JP5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-295: Missing.
     337-337: D → DS

Note: No experimental confirmation available.
Show »
Length:774
Mass (Da):83,098
Checksum:i7CE22843F97A190E
GO

Sequence cautioni

The sequence BAB13409.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB14613.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti10 – 101T → R in BAA91245 (PubMed:14702039).Curated
Sequence conflicti824 – 8241E → K in BAB14613 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti699 – 6991R → H.
Corresponds to variant rs524523 [ dbSNP | Ensembl ].
VAR_032262
Natural varianti969 – 9691A → V.1 Publication
Corresponds to variant rs2469887 [ dbSNP | Ensembl ].
VAR_032263

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3333MCARM…LDVVR → MAPGSAPASSGAVIISPSYA SS in isoform 3. 1 PublicationVSP_025302Add
BLAST
Alternative sequencei46 – 295250Missing in isoform 4. 1 PublicationVSP_025303Add
BLAST
Alternative sequencei337 – 3371D → DS in isoform 2 and isoform 4. 2 PublicationsVSP_025304
Alternative sequencei405 – 42319AEELV…QHVPV → VRRPPSLPGKAGGQVPGAP in isoform 3. 1 PublicationVSP_025305Add
BLAST
Alternative sequencei424 – 1023600Missing in isoform 3. 1 PublicationVSP_025306Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046803 mRNA. Translation: BAB13409.1. Different initiation.
AK000546 mRNA. Translation: BAA91245.1.
AK023577 mRNA. Translation: BAB14613.1. Different initiation.
BC028106 mRNA. Translation: AAH28106.1.
BC032059 mRNA. Translation: AAH32059.1.
BC114569 mRNA. Translation: AAI14570.1.
AL359557 mRNA. Translation: CAH10668.2.
CCDSiCCDS44618.1. [Q24JP5-1]
CCDS7997.1. [Q24JP5-2]
RefSeqiNP_060340.2. NM_017870.3. [Q24JP5-2]
NP_821174.1. NM_178031.2. [Q24JP5-1]
UniGeneiHs.118552.

Genome annotation databases

EnsembliENST00000005286; ENSP00000005286; ENSG00000006118. [Q24JP5-2]
ENST00000453848; ENSP00000405823; ENSG00000006118.
GeneIDi54972.
KEGGihsa:54972.
UCSCiuc001nqi.3. human. [Q24JP5-2]
uc001nqj.3. human. [Q24JP5-1]
uc001nqk.3. human. [Q24JP5-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046803 mRNA. Translation: BAB13409.1. Different initiation.
AK000546 mRNA. Translation: BAA91245.1.
AK023577 mRNA. Translation: BAB14613.1. Different initiation.
BC028106 mRNA. Translation: AAH28106.1.
BC032059 mRNA. Translation: AAH32059.1.
BC114569 mRNA. Translation: AAI14570.1.
AL359557 mRNA. Translation: CAH10668.2.
CCDSiCCDS44618.1. [Q24JP5-1]
CCDS7997.1. [Q24JP5-2]
RefSeqiNP_060340.2. NM_017870.3. [Q24JP5-2]
NP_821174.1. NM_178031.2. [Q24JP5-1]
UniGeneiHs.118552.

3D structure databases

ProteinModelPortaliQ24JP5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120309. 12 interactions.
IntActiQ24JP5. 1 interaction.
STRINGi9606.ENSP00000005286.

PTM databases

PhosphoSiteiQ24JP5.

Polymorphism and mutation databases

BioMutaiTMEM132A.
DMDMi121940967.

Proteomic databases

MaxQBiQ24JP5.
PaxDbiQ24JP5.
PRIDEiQ24JP5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000005286; ENSP00000005286; ENSG00000006118. [Q24JP5-2]
ENST00000453848; ENSP00000405823; ENSG00000006118.
GeneIDi54972.
KEGGihsa:54972.
UCSCiuc001nqi.3. human. [Q24JP5-2]
uc001nqj.3. human. [Q24JP5-1]
uc001nqk.3. human. [Q24JP5-3]

Organism-specific databases

CTDi54972.
GeneCardsiGC11P060691.
HGNCiHGNC:31092. TMEM132A.
HPAiHPA051979.
neXtProtiNX_Q24JP5.
PharmGKBiPA134886953.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG253956.
GeneTreeiENSGT00550000074550.
HOVERGENiHBG099719.
InParanoidiQ24JP5.
KOiK17599.
OMAiYQRKEPP.
OrthoDBiEOG7DJSKK.
PhylomeDBiQ24JP5.
TreeFamiTF314981.

Miscellaneous databases

ChiTaRSiTMEM132A. human.
GenomeRNAii54972.
NextBioi58216.
PROiQ24JP5.

Gene expression databases

BgeeiQ24JP5.
CleanExiHS_TMEM132A.
ExpressionAtlasiQ24JP5. baseline and differential.
GenevisibleiQ24JP5. HS.

Family and domain databases

InterProiIPR026307. TMEM132.
[Graphical view]
PANTHERiPTHR13388. PTHR13388. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1023 (ISOFORM 1), VARIANT VAL-969.
    Tissue: Placenta.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-560 (ISOFORM 2).
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-560 (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiT132A_HUMAN
AccessioniPrimary (citable) accession number: Q24JP5
Secondary accession number(s): Q69YU7
, Q86VZ8, Q86W97, Q9H8K3, Q9HCI9, Q9NWY0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: April 18, 2006
Last modified: July 22, 2015
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.