Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein sex-lethal

Gene

Sxl

Organism
Drosophila subobscura (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Sex determination switch protein which controls sexual development by sex-specific splicing. Regulates dosage compensation in females by suppressing hyperactivation of X-linked genes. Expression of the embryo-specific isoform is under the control of primary sex-determining signal, which depends on the ratio of X chromosomes relative to autosomes (X:A ratio). Expression occurs in 2X:2A cells, but not in X:2A cells. The X:A ratio seems to be signaled by the relative concentration of the X-linked transcription factors SIS-A and SIS-B. As a result, the embryo-specific product is expressed early only in female embryos and specifies female-adult specific splicing; in the male where it is not expressed, the default splicing gives rise to a truncated nonfunctional protein. The female-specific isoform specifies the splicing of its own transcript, thereby initiating a positive autoregulatory feedback loop leading to female development pathway. The female-specific isoform controls the sex-specific splicing of transformer (TRA); acts as a translational repressor for male-specific lethal-2 (MSL-2) and prevents male-less (MLE), MSL-1 and MSL-3 proteins from associating with the female X chromosome (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Differentiation, Sexual differentiation, Transcription, Transcription regulation

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein sex-lethal
Gene namesi
Name:Sxl
OrganismiDrosophila subobscura (Fruit fly)
Taxonomic identifieri7241 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora

Organism-specific databases

FlyBaseiFBgn0016371. Dsub\Sxl.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000819681 – 354Protein sex-lethalAdd BLAST354

Expressioni

Tissue specificityi

The embryo-specific isoform is not expressed in the pole cells, which are the progenitors of the germline.

Developmental stagei

The embryo-specific isoform is expressed during the syncytial blastoderm stage. Expressed only in chromosomal female embryos.

Interactioni

Subunit structurei

Part of a complex containing fl2d, Sxl and vir.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ24668.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini127 – 205RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini213 – 293RRM 2PROSITE-ProRule annotationAdd BLAST81

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1 – 31Asn/Gly-richAdd BLAST31
Compositional biasi56 – 59Poly-Ser4
Compositional biasi68 – 75Poly-Gly8
Compositional biasi314 – 321Poly-Pro8

Domaini

The Gly-Asn rich domain is required for the cooperative interaction with RNA and for regulating the splicing activity.By similarity

Sequence similaritiesi

Contains 2 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR002343. Hud_Sxl_RNA.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR006546. Sxl.
[Graphical view]
PfamiPF00076. RRM_1. 2 hits.
[Graphical view]
PRINTSiPR00961. HUDSXLRNA.
SMARTiSM00360. RRM. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
TIGRFAMsiTIGR01659. sex-lethal. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 2 (identifier: Q24668-1) [UniParc]FASTAAdd to basket
Also known as: Female-specific

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYGNNNPGSN NNNGGYPPYG YNKSSGGRGF GMSHSLPSGM SRYAFSPQDT
60 70 80 90 100
EFSFPSSSSR RGYNEFPGGG GIGIGANGGS ANNLGGNMCN LLPMTSNNSL
110 120 130 140 150
SNLCGLSLGS GGSDDHMMMH DQRSSNTNLI VNYLPQDMTD RELYALFRAI
160 170 180 190 200
GPINTCRIMR DYKTGYSFGY AFVDFTSEMD SQRAIKVLNG ITVRNKRLKV
210 220 230 240 250
SYARPGGESI KDTNLYVTNL PRTITDDQLD TIFGKYGSIV QKNILRDKLT
260 270 280 290 300
GRPRGVAFVR YNKREEAQEA ISALNNVIPE GGSQPLSVRL AQEHGKAKAA
310 320 330 340 350
HFMSQIGVPS ANAPPPPPPP PHMAFNNMVH RGRSIKSQQR FQKTHPYFDA

QKFI
Length:354
Mass (Da):38,715
Last modified:November 1, 1999 - v2
Checksum:i760347AEF4D87868
GO
Isoform 1 (identifier: Q24668-2) [UniParc]FASTAAdd to basket
Also known as: Embryo-specific

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MYGNNNPGSNNNNGGYPPYGYNKSS → MDFSFETVTPPCRPHGRRIIISRWQ

Show »
Length:354
Mass (Da):39,065
Checksum:i0BBA1C76F51D6AEB
GO
Isoform 3 (identifier: Q24668-3) [UniParc]FASTAAdd to basket
Also known as: Male-specific

The sequence of this isoform differs from the canonical sequence as follows:
     26-59: GGRGFGMSHSLPSGMSRYAFSPQDTEFSFPSSSS → SFHSYGVAGVTACPPSKSRNRFRFRQKRKDTRNS
     60-354: Missing.

Show »
Length:59
Mass (Da):6,605
Checksum:i06EDD18E7DBE0788
GO
Isoform 4 (identifier: Q24668-4) [UniParc]FASTAAdd to basket
Also known as: Embryo-specific-8AA

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MYGNNNPGSNNNNGGYPPYGYNKSS → MDFSFETVTPPCRPHGRRIIISRWQ
     41-48: Missing.

Show »
Length:346
Mass (Da):38,128
Checksum:iBD969449CBA71582
GO
Isoform 5 (identifier: Q24668-5) [UniParc]FASTAAdd to basket
Also known as: Female-specific-8AA

The sequence of this isoform differs from the canonical sequence as follows:
     41-48: Missing.

Show »
Length:346
Mass (Da):37,778
Checksum:i20E8CDED58BDA036
GO

Sequence cautioni

The sequence CAA67017 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAA67019 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0058871 – 25MYGNN…YNKSS → MDFSFETVTPPCRPHGRRII ISRWQ in isoform 1 and isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_00588826 – 59GGRGF…PSSSS → SFHSYGVAGVTACPPSKSRN RFRFRQKRKDTRNS in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_00589041 – 48Missing in isoform 4 and isoform 5. 1 Publication8
Alternative sequenceiVSP_00588960 – 354Missing in isoform 3. 1 PublicationAdd BLAST295

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X98370 mRNA. Translation: CAA67016.1.
X98371 Genomic DNA. Translation: CAA67017.1. Sequence problems.
X98371 Genomic DNA. Translation: CAA67018.1.
X98371 Genomic DNA. Translation: CAA67019.1. Sequence problems.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X98370 mRNA. Translation: CAA67016.1.
X98371 Genomic DNA. Translation: CAA67017.1. Sequence problems.
X98371 Genomic DNA. Translation: CAA67018.1.
X98371 Genomic DNA. Translation: CAA67019.1. Sequence problems.

3D structure databases

ProteinModelPortaliQ24668.
ModBaseiSearch...
MobiDBiSearch...

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

FlyBaseiFBgn0016371. Dsub\Sxl.

Family and domain databases

Gene3Di3.30.70.330. 2 hits.
InterProiIPR002343. Hud_Sxl_RNA.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR006546. Sxl.
[Graphical view]
PfamiPF00076. RRM_1. 2 hits.
[Graphical view]
PRINTSiPR00961. HUDSXLRNA.
SMARTiSM00360. RRM. 2 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
TIGRFAMsiTIGR01659. sex-lethal. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSXL_DROSU
AccessioniPrimary (citable) accession number: Q24668
Secondary accession number(s): Q24665, Q24666, Q24667
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1999
Last modified: October 5, 2016
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.