Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein bunched, class 1/class 3/D/E isoforms

Gene

bun

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis. May be required for the transmission of the dpp signal and for a morphogenetic movement of the medulla in the brain that reorients the second optic lobe relative to the first. Plays a role in determining proper dorsal cell fates leading to the formation of the dorsal appendages.2 Publications

GO - Molecular functioni

GO - Biological processi

  • autophagic cell death Source: FlyBase
  • cell fate determination Source: FlyBase
  • chorion-containing eggshell formation Source: FlyBase
  • compound eye development Source: FlyBase
  • compound eye photoreceptor cell differentiation Source: FlyBase
  • decapentaplegic signaling pathway Source: FlyBase
  • determination of adult lifespan Source: FlyBase
  • dorsal appendage formation Source: FlyBase
  • imaginal disc-derived wing morphogenesis Source: FlyBase
  • mushroom body development Source: FlyBase
  • negative regulation of apoptotic process Source: FlyBase
  • negative regulation of cell fate specification Source: FlyBase
  • negative regulation of Notch signaling pathway Source: FlyBase
  • oogenesis Source: FlyBase
  • ovarian follicle cell development Source: FlyBase
  • ovarian follicle cell migration Source: FlyBase
  • peripheral nervous system development Source: FlyBase
  • positive regulation of cell growth Source: FlyBase
  • positive regulation of cell proliferation Source: FlyBase
  • positive regulation of neuroblast proliferation Source: FlyBase
  • salivary gland cell autophagic cell death Source: FlyBase
  • segmentation Source: FlyBase
  • sleep Source: FlyBase
  • tissue regeneration Source: FlyBase
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Oogenesis, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bunched, class 1/class 3/D/E isoforms
Alternative name(s):
Protein shortsighted
Gene namesi
Name:bun
Synonyms:shs
ORF Names:CG42281
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2L

Organism-specific databases

FlyBaseiFBgn0259176. bun.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus 1 Publication

GO - Cellular componenti

  • cytoplasm Source: FlyBase
  • cytosol Source: FlyBase
  • nucleus Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 219219Protein bunched, class 1/class 3/D/E isoformsPRO_0000219376Add
BLAST

Proteomic databases

PaxDbiQ24522.

Expressioni

Tissue specificityi

Anterior dorsal follicle cells at stages 10-12 of oogenesis.1 Publication

Gene expression databases

BgeeiFBgn0259176.
ExpressionAtlasiQ24522. differential.
GenevisibleiQ24522. DM.

Interactioni

GO - Molecular functioni

  • protein homodimerization activity Source: FlyBase

Protein-protein interaction databases

BioGridi60711. 13 interactions.
STRINGi7227.FBpp0288933.

Structurei

3D structure databases

ProteinModelPortaliQ24522.
SMRiQ24522. Positions 64-119.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni82 – 10322Leucine-zipperAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi122 – 20988Ala-richAdd
BLAST

Sequence similaritiesi

Belongs to the TSC-22/Dip/Bun family.Curated

Phylogenomic databases

eggNOGiKOG4797. Eukaryota.
ENOG411251N. LUCA.
GeneTreeiENSGT00530000063062.
OrthoDBiEOG091G06PM.

Family and domain databases

InterProiIPR000580. TSC-22_Dip_Bun.
[Graphical view]
PANTHERiPTHR12348. PTHR12348. 1 hit.
PfamiPF01166. TSC22. 1 hit.
[Graphical view]
ProDomiPD007152. TSC-22_Dip_Bun. 1 hit.
[Graphical view] [Entries sharing at least one domain]
PROSITEiPS01289. TSC22. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Class 1 (identifier: Q24522-1) [UniParc]FASTAAdd to basket
Also known as: B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKTETGSNNN NTTVVNMDFD MYPSISGKQQ DPVREVVMKY IDYFLPDASG
60 70 80 90 100
TSAVAIDNKI EQAMDLVKSH LMIAVREEVE VLKERISELM DKINKLELEN
110 120 130 140 150
SILKSNIPQE TLQQLQLQLQ LAAPPATPAI QAAPAVQSVV APAAAGQAVQ
160 170 180 190 200
QQAAGAVAVT GVATSPASAV VPTSIPNGSA ENGSSAVESA AVSVEQQVQQ
210
VTSAAAAAAS VVTANGPMS
Length:219
Mass (Da):22,742
Last modified:May 10, 2004 - v2
Checksum:i29B3C20698C38743
GO
Isoform Class 3 (identifier: Q24522-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MKTETGSNNN...AIDNKIEQAM → MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAK

Note: No experimental confirmation available.
Show »
Length:189
Mass (Da):19,687
Checksum:i068C40870CA12CAC
GO
Isoform D (identifier: Q24522-3) [UniParc]FASTAAdd to basket
Also known as: H

The sequence of this isoform differs from the canonical sequence as follows:
     2-47: KTETGSNNNN...MKYIDYFLPD → IKYPRTTSST...VRMFSTEVDN

Note: No experimental confirmation available.
Show »
Length:226
Mass (Da):23,543
Checksum:iE0BB59F88C1D6576
GO
Isoform E (identifier: Q24522-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MKTETGSNNN...MKYIDYFLPD → MAALANKMAA...VYCFIKDFIG

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):26,424
Checksum:iFB2ECECF8652DCAF
GO
Isoform Class 2 (identifier: Q24523-1) [UniParc]FASTAAdd to basket
Also known as: A
The sequence of this isoform can be found in the external entry Q24523.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,206
Mass (Da):124,802
GO
Isoform F (identifier: Q24523-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q24523.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Length:1,097
Mass (Da):113,365
GO
Isoform G (identifier: Q24523-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q24523.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Length:1,331
Mass (Da):138,064
GO

Sequence cautioni

The sequence AAB61239 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti30 – 301Q → E in AAB61239 (PubMed:9256356).Curated
Sequence conflicti34 – 341R → C in AAB61239 (PubMed:9256356).Curated
Sequence conflicti100 – 1001N → H in AAB61239 (PubMed:9256356).Curated
Sequence conflicti106 – 1061N → K in AAB61239 (PubMed:9256356).Curated
Sequence conflicti122 – 1232AA → PR in AAB61239 (PubMed:9256356).Curated
Sequence conflicti188 – 1881E → G in AAB61239 (PubMed:9256356).Curated
Sequence conflicti192 – 1921V → G in AAB61239 (PubMed:9256356).Curated
Sequence conflicti202 – 2032TS → QQVTSAA in AAC41607 (PubMed:7555710).Curated
Sequence conflicti202 – 2032TS → QQVTSAA in AAB61239 (PubMed:9256356).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6464MKTET…IEQAM → MMGTMSLRQPENWLYEIWQK GYDSPCYVMVPNAK in isoform Class 3. 1 PublicationVSP_010282Add
BLAST
Alternative sequencei1 – 4747MKTET…YFLPD → MAALANKMAANMATTSSSSN NNNIAGSESTLQQQQMLHHQ QQQQQQTQSNLIMPAAVIQP EYLLNNDRGLFKVYCFIKDF IG in isoform E. CuratedVSP_035859Add
BLAST
Alternative sequencei2 – 4746KTETG…YFLPD → IKYPRTTSSTSSGYFDDDEA MMNPYQTPPASPQSVPQYLQ RHMVRMFSTEVDN in isoform D. CuratedVSP_035860Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L42511 mRNA. Translation: AAC41607.1.
AF003342 mRNA. Translation: AAB61239.1. Different initiation.
AE014134 Genomic DNA. Translation: AAF53200.3.
AE014134 Genomic DNA. Translation: AAN10817.1.
AE014134 Genomic DNA. Translation: ABI31312.1.
AE014134 Genomic DNA. Translation: ACZ94250.1.
AE014134 Genomic DNA. Translation: ACZ94251.1.
AY060295 mRNA. Translation: AAL25334.1.
RefSeqiNP_001036358.1. NM_001042893.2. [Q24522-4]
NP_001162964.1. NM_001169493.2. [Q24522-3]
NP_001162965.1. NM_001169494.2. [Q24522-1]
NP_723755.2. NM_165012.2. [Q24522-3]
NP_723756.1. NM_165013.4. [Q24522-2]
UniGeneiDm.7349.

Genome annotation databases

EnsemblMetazoaiFBtr0299656; FBpp0288931; FBgn0259176. [Q24522-1]
GeneIDi34665.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L42511 mRNA. Translation: AAC41607.1.
AF003342 mRNA. Translation: AAB61239.1. Different initiation.
AE014134 Genomic DNA. Translation: AAF53200.3.
AE014134 Genomic DNA. Translation: AAN10817.1.
AE014134 Genomic DNA. Translation: ABI31312.1.
AE014134 Genomic DNA. Translation: ACZ94250.1.
AE014134 Genomic DNA. Translation: ACZ94251.1.
AY060295 mRNA. Translation: AAL25334.1.
RefSeqiNP_001036358.1. NM_001042893.2. [Q24522-4]
NP_001162964.1. NM_001169493.2. [Q24522-3]
NP_001162965.1. NM_001169494.2. [Q24522-1]
NP_723755.2. NM_165012.2. [Q24522-3]
NP_723756.1. NM_165013.4. [Q24522-2]
UniGeneiDm.7349.

3D structure databases

ProteinModelPortaliQ24522.
SMRiQ24522. Positions 64-119.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi60711. 13 interactions.
STRINGi7227.FBpp0288933.

Proteomic databases

PaxDbiQ24522.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0299656; FBpp0288931; FBgn0259176. [Q24522-1]
GeneIDi34665.

Organism-specific databases

CTDi34665.
FlyBaseiFBgn0259176. bun.

Phylogenomic databases

eggNOGiKOG4797. Eukaryota.
ENOG411251N. LUCA.
GeneTreeiENSGT00530000063062.
OrthoDBiEOG091G06PM.

Miscellaneous databases

ChiTaRSibun. fly.
GenomeRNAii34665.

Gene expression databases

BgeeiFBgn0259176.
ExpressionAtlasiQ24522. differential.
GenevisibleiQ24522. DM.

Family and domain databases

InterProiIPR000580. TSC-22_Dip_Bun.
[Graphical view]
PANTHERiPTHR12348. PTHR12348. 1 hit.
PfamiPF01166. TSC22. 1 hit.
[Graphical view]
ProDomiPD007152. TSC-22_Dip_Bun. 1 hit.
[Graphical view] [Entries sharing at least one domain]
PROSITEiPS01289. TSC22. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBUN1_DROME
AccessioniPrimary (citable) accession number: Q24522
Secondary accession number(s): E1JH96
, E1JHG7, O02431, Q0E8Q8, Q0E8Q9, Q95T76
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 10, 2004
Last modified: September 7, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.