Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ryanodine receptor

Gene

RyR

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Intracellular calcium channel that is required for proper muscle function during embryonic development and may be essential for excitation-contraction coupling in larval body wall muscles.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei4162 – 41621Important for activation by Ca(2+)By similarity

GO - Molecular functioni

  • ryanodine-sensitive calcium-release channel activity Source: UniProtKB

GO - Biological processi

  • calcium ion transport Source: UniProtKB
  • heart contraction Source: FlyBase
  • multicellular organism development Source: UniProtKB-KW
  • muscle contraction Source: UniProtKB
  • regulation of hemocyte proliferation Source: FlyBase
  • release of sequestered calcium ion into cytosol Source: GOC
  • response to anesthetic Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Developmental protein, Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Ryanodine receptor
Alternative name(s):
Ryanodine receptor 44F
Gene namesi
Name:RyRImported
Synonyms:dry, Rya-r44FImported
ORF Names:CG10844Imported
OrganismiDrosophila melanogaster (Fruit fly)Imported
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0011286. RyR.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 44514451CytoplasmicSequence analysisAdd
BLAST
Transmembranei4452 – 447221HelicalSequence analysisAdd
BLAST
Transmembranei4651 – 467121HelicalSequence analysisAdd
BLAST
Transmembranei4683 – 470321HelicalSequence analysisAdd
BLAST
Transmembranei4742 – 476221HelicalSequence analysisAdd
BLAST
Transmembranei4885 – 490521HelicalSequence analysisAdd
BLAST
Transmembranei4924 – 494421HelicalSequence analysisAdd
BLAST
Intramembranei4974 – 498310Pore-formingBy similarity
Transmembranei4984 – 502441HelicalSequence analysisAdd
BLAST
Topological domaini5025 – 5127103CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • endoplasmic reticulum membrane Source: FlyBase
  • integral component of membrane Source: UniProtKB
  • microtubule associated complex Source: FlyBase
  • sarcoplasmic reticulum membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Sarcoplasmic reticulum

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL6045.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 51275127Ryanodine receptorPRO_0000219364Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1459 – 14591Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ24498.
PRIDEiQ24498.

PTM databases

iPTMnetiQ24498.

Expressioni

Tissue specificityi

During embryonic stages 9-10, expression is seen in mesoderm of all segments in progenitors of the cephalic and somatic muscles. Adults exhibit high expression in tubular 'jump' muscles of thorax and leg, and lower expression in the brain, ventral ganglion, head muscles and proboscis muscles.3 Publications

Developmental stagei

Abundant in 6-12 hours embryos, reduced expression in second and third instar larval stages and adults.2 Publications

Gene expression databases

BgeeiQ24498.
ExpressionAtlasiQ24498. differential.
GenevisibleiQ24498. DM.

Interactioni

Subunit structurei

Homotetramer.By similarity

Protein-protein interaction databases

BioGridi71972. 5 interactions.
IntActiQ24498. 13 interactions.
STRINGi7227.FBpp0293114.

Chemistry

BindingDBiQ24498.

Structurei

3D structure databases

ProteinModelPortaliQ24498.
SMRiQ24498. Positions 15-199.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini94 – 14855MIR 1PROSITE-ProRule annotationAdd
BLAST
Domaini155 – 20046MIR 2PROSITE-ProRule annotationAdd
BLAST
Domaini210 – 26455MIR 3PROSITE-ProRule annotationAdd
BLAST
Domaini270 – 32859MIR 4PROSITE-ProRule annotationAdd
BLAST
Domaini336 – 39459MIR 5PROSITE-ProRule annotationAdd
BLAST
Domaini577 – 803227B30.2/SPRY 1PROSITE-ProRule annotationAdd
BLAST
Repeati845 – 9561121By similarityAdd
BLAST
Repeati957 – 10751192By similarityAdd
BLAST
Domaini1032 – 1217186B30.2/SPRY 2PROSITE-ProRule annotationAdd
BLAST
Domaini1452 – 1673222B30.2/SPRY 3PROSITE-ProRule annotationAdd
BLAST
Repeati2822 – 29451243By similarityAdd
BLAST
Repeati2946 – 30631184By similarityAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni845 – 306322194 X approximate repeatsAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi4686 – 471126Gly-richAdd
BLAST

Domaini

The calcium release channel activity resides in the C-terminal region while the remaining part of the protein resides in the cytoplasm.Curated

Sequence similaritiesi

Contains 3 B30.2/SPRY domains.PROSITE-ProRule annotation
Contains 5 MIR domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2243. Eukaryota.
ENOG410YCNW. LUCA.
GeneTreeiENSGT00760000119152.
InParanoidiQ24498.
OrthoDBiEOG71K622.
PhylomeDBiQ24498.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR001870. B30.2/SPRY.
IPR013320. ConA-like_dom.
IPR011992. EF-hand-dom_pair.
IPR014821. Ins145_P3_rcpt.
IPR005821. Ion_trans_dom.
IPR016093. MIR_motif.
IPR013662. RIH_assoc-dom.
IPR000699. RIH_dom.
IPR013333. Ryan_recept.
IPR003032. Ryanodine_rcpt.
IPR015925. Ryanodine_recept-rel.
IPR009460. Ryanrecept_TM4-6.
IPR003877. SPRY_dom.
[Graphical view]
PANTHERiPTHR13715. PTHR13715. 7 hits.
PfamiPF08709. Ins145_P3_rec. 1 hit.
PF00520. Ion_trans. 1 hit.
PF02815. MIR. 1 hit.
PF08454. RIH_assoc. 1 hit.
PF06459. RR_TM4-6. 1 hit.
PF01365. RYDR_ITPR. 2 hits.
PF02026. RyR. 4 hits.
PF00622. SPRY. 3 hits.
[Graphical view]
PRINTSiPR00795. RYANODINER.
SMARTiSM00472. MIR. 4 hits.
SM00449. SPRY. 3 hits.
[Graphical view]
SUPFAMiSSF100909. SSF100909. 1 hit.
SSF47473. SSF47473. 1 hit.
SSF49899. SSF49899. 2 hits.
SSF82109. SSF82109. 2 hits.
PROSITEiPS50188. B302_SPRY. 3 hits.
PS50919. MIR. 5 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A1 Publication (identifier: Q24498-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEAEGGSEQ DDVSFLRTED MVTLSCTATG ERVCLAAEGF GNRHCFLENI
60 70 80 90 100
ADKNVPPDLS QCVFVIEQAL SVRALQELVT AAGSETGKGT GSGHRTLLYG
110 120 130 140 150
NAILLRHHNS DMYLACLSTS SSNDKLSFDV GLQEHSQGEA CWWTVHPASK
160 170 180 190 200
QRSEGEKVRV GDDLILVSVA TERYLHTTKE NEQSIVNASF HVTHWSVQPY
210 220 230 240 250
GTGISRMKYV GYVFGGDVLR FFHGGDECLT IPSTWGREAG QNIVIYEGGV
260 270 280 290 300
VMAQARSLWR LELARTKWTG GFINWYHPMR IRHITTGRYL GVNDSNELIL
310 320 330 340 350
VKKEEASIAT TTFCLRQEKD DEKKVLEDKD LEVIGSPIIK YGDTTVIVQH
360 370 380 390 400
CETSLWLSYK SYETKKKGVG KVEEKQAILH EEGKMDDCLD FSRSQEEESK
410 420 430 440 450
TARVIRKCSS LFTQFITALE TLQSNRRHSI FFQKVNLNEM VMCLEDLINY
460 470 480 490 500
FSQPEDDMEH EEKQNRFRAL RNRQDLFQEE GVLNLILEAI DKINIITSQG
510 520 530 540 550
FLASFLAGDE TGQSWDLIST YLYQLLAAII KGNHTNCAQF ANSNRLNWLF
560 570 580 590 600
SRLGSQASSE GSGMLDVLHC VLIDSPEALN MMRDEHIKVI ISLLEKHGRD
610 620 630 640 650
PKVLDVLCSL CVGNGVAVRS SQNNICDFLL PGKNLLLQTL LVDHVASIRP
660 670 680 690 700
NIFVGRVDGS SMYQKWYFEV TMDHIEQTTH MMPHLRIGWA NTSGYVPYPG
710 720 730 740 750
GGKKWGGNGV GDDLYSFGFD GAFLWTGGRK TLVVDALPEE PFIRKGDVIG
760 770 780 790 800
VAIDLSVPII TFTFNGVKVR GSFRDFNLDG MFFPVMSCSS KLSCRFLFGG
810 820 830 840 850
DHGRLKFAPP MGFSALVQCL MPQQILSLDP CFYFGNLAKN VLAGPWLIED
860 870 880 890 900
DTAFVPKPVD TTGVTLPSSV DQIKEKLAEN IHEMWALNKI EAGWSWGEHR
910 920 930 940 950
DDYHRIHPCL THFEKLPAAE KRYDNQLAVQ TLKTIISLGY YITMDKPPAR
960 970 980 990 1000
IRPVRLPNEI FMQGNGYKPA PLDLSAVTLT PKLEELVDQL AENTHNLWAR
1010 1020 1030 1040 1050
ERIQQGWTYG LNEDSENHRS PHLVPYAKVD EAIKKANRDT ASETVRTLLV
1060 1070 1080 1090 1100
YGYVLDPPTG EGTEALLAEA QRLKFAGFRT YRVERNYAVT SGKWYFEFEV
1110 1120 1130 1140 1150
LTSGPMRVGW ARADCYPGAM LGSEDTSWAF DGHNVTKMHA GSIEHFGVRY
1160 1170 1180 1190 1200
EAGDVIGCFI DVKEQTISFS LNGELLMDAL GGETTFADVT AEGVGFVPAC
1210 1220 1230 1240 1250
TLGVGQKARL IYGQDVDSLK FFTTCGLQEG YEPFCVNMRR PVTHWYTKDQ
1260 1270 1280 1290 1300
PIFENTEEMP DCRIDVTRIP GGADTPPHLK ISHNTFETME KANWEFLRLS
1310 1320 1330 1340 1350
LPVTCMGEFI SEQEKARRWD EIKNRQYRLM REAEIAAQMQ VQTQAAHMDH
1360 1370 1380 1390 1400
MLKGGFNMND IKGLTRNFDE HADAEADHMM RGPNRPPRKG SLTRNITFET
1410 1420 1430 1440 1450
DMSAALDEMQ RSTSVLDMNG LGEEMDDKKK RGRSPFKFFS KKSRDQSREK
1460 1470 1480 1490 1500
MGARTLDTSL ERRNTVAHGR NVVNQQMTTR APTLRLNNAE IPPSPVPQGP
1510 1520 1530 1540 1550
KQLSGSNLGQ QPVETSGDEM FDAECLKLIN EYFYGVRIFP GQDPTHVYVG
1560 1570 1580 1590 1600
WVTTQYHLHS REFNKNKVRR GSVYIEDDYE MAIERIDRQS CYVVRADELF
1610 1620 1630 1640 1650
NEVTQDASGK GASQGMFVGC FVDTATGIIR FTCEGKDTSH RWMMEPDTKL
1660 1670 1680 1690 1700
FPAIFVEATS KEILQIELGR TPTTLPLSAA VLPTSDKHIN PQSPPRLKVQ
1710 1720 1730 1740 1750
CLRPHQWARV PNTALQVHAL KLSDVRGWSM LCEDPVSMLA LHIPEEDRCI
1760 1770 1780 1790 1800
DILELIEMDK LLSFHAHSLT LYAALCYQSN YRAAHALCQH VDQKQLLYAI
1810 1820 1830 1840 1850
RSEYMSGPLR QGFYDLLIAL HLESHATTME VCKNEYITPL GAELKELYSD
1860 1870 1880 1890 1900
EEMQHSLRSL VTESVRPQLR MTEITPPVIA TSSMPSVSSE PIPDIDQLYS
1910 1920 1930 1940 1950
PKFPLEVVRQ FVMEALKDAV EINQVHNRDP IGWTNENLFL PLIKLTDRLL
1960 1970 1980 1990 2000
LVGVLTDEDV QRLLVMIDPE TWDQAFEREG KDEHRKGLLT MKMAEGAKLQ
2010 2020 2030 2040 2050
MCYLLHHLYD TQLRHRVESI IAFSHDFVGD LQTDQLRRYI EIKQSDLPSA
2060 2070 2080 2090 2100
VAAKKTKEFR CPPREQMNQI LCFKNLEPDD QDNCTCGLEL RGRLGDFHDS
2110 2120 2130 2140 2150
LMQKVSLNAL QEPDGVEGTA IEEVKTGPIT KIYNFINTVK ELEEGPKEVE
2160 2170 2180 2190 2200
EPEKKTPEEV FRKVLIKTIV SWAEESQIEN PKLVREMFSL LLRQYDTVGE
2210 2220 2230 2240 2250
LVRALEKTYV INTRARDDVA EMWVGLSQIR ALLPVQMSQE EEELMRKRLW
2260 2270 2280 2290 2300
KLVNNATFFQ HPDLIRILRV HENVMAVMMN TLGRRAQAQS DAPTQSEVAE
2310 2320 2330 2340 2350
GAPSKEKDTS HEMVVACCRF LCYFCRTGRQ NQKAMFDHFD FLLDNANILL
2360 2370 2380 2390 2400
ARPSLRGSTP LDVAYSSLME NTELALALRE HYLEKIAVYL SRCGLQSNSE
2410 2420 2430 2440 2450
LVEKGYPDLG WDPVEGERYL DFLRYCVWVN GESVEENANL VIRLLIRRPE
2460 2470 2480 2490 2500
CLGPALRGEG EGLFRAIVEA NRMSERISDR CKMQDEAEGT IAGLNFTHPL
2510 2520 2530 2540 2550
PEGEEDEDYI DTGAAILNFY CTLVDLLGRC APDASVIEQG KNESLRARAI
2560 2570 2580 2590 2600
LRSLVPLEDL QGVLSLKFTL SQTAPGEEKP KSDMPSGLLP NNKQSIVLFL
2610 2620 2630 2640 2650
ERVYGIEAQD LFYRLLEDAF LPDLRTATIL DKSDGSESDM ALAMNRYIGN
2660 2670 2680 2690 2700
SILPLLIKHS KFYNEAENYA SLLDATLHTV YRLSKNRMLT KGQREAVSDF
2710 2720 2730 2740 2750
LVALTSQMQP AMLLKLLRKL TVDVSKLSEY TTVALRLLTL HFDRCAKYYG
2760 2770 2780 2790 2800
STQGQGSYGA SSDEEKRLTM LLFSNIFDSL SNMDYDPELF GKALPCLIAI
2810 2820 2830 2840 2850
GCALPPDYSL SKNTDEDYYG RQMGAPDQPQ YMPNPIDTNN VHLDNDLNSL
2860 2870 2880 2890 2900
VQKFSEHYHD AWASRRLEGG WTYGDIRSDN DRKHPRLKPY NMLSEYERER
2910 2920 2930 2940 2950
YRDPVRECLK GLLAIGWTVE HSEVEVALNH RGSTRRQSKP QINEFQNEGS
2960 2970 2980 2990 3000
PFNYNPHPVD MSNLTLSREM QNMAERLAEN SHDIWAKKKN EELNGCGGVI
3010 3020 3030 3040 3050
HPQLVPYDLL TDKEKKKDRE RSQEFLKYMQ YQGYKLHKPS KGGAVEEGGA
3060 3070 3080 3090 3100
TQAAVELRFS YSLLEKLIQY LDRATINMKL LKPSTTFSRR SSFKTATRDI
3110 3120 3130 3140 3150
KFFSKVVLPL MEKYFSTHRN YFIAIATATN NIGAASLKEK EMVASIFCKL
3160 3170 3180 3190 3200
AALLRNRLSA FGPDVRITVR CLQVLVKGID ARTLTKNCPE FIRTSMLTFF
3210 3220 3230 3240 3250
NQTSDDLGNT ILNLQDGKYS HLRGTHLKTS TSLGYVNQVV LPVLTAMFDH
3260 3270 3280 3290 3300
LAACDYGSDL LLDEIQVASY KILAALYHLG TDGTLTHDRK YLKTEIERHR
3310 3320 3330 3340 3350
PALGSCLGAY SSCFPVAFLE PHLNKHNQYS LLNRIADHSL EAQDIMVKME
3360 3370 3380 3390 3400
SCMPNLETIL AEVDQFVESD KTYNDAPHII DVILPLLCAY LPFWWSQGPD
3410 3420 3430 3440 3450
NVSPTSGNHV TMVTADHMNP LLRNVLKMIK KNIGNDNAPW MTRIAAYTQQ
3460 3470 3480 3490 3500
IIINTSEELL KDPFLPLAER VKKRTENMLH KEDSMRGFIK SATDDTSQVE
3510 3520 3530 3540 3550
TQLQEDWNLL VRDIYSFYPL LIKYVDLQRN HWLKDNIPEA EELYNHVAEI
3560 3570 3580 3590 3600
FNIWSKSQYF LKEEQNFISA NEIDNMALIM PTATRRSAIS EGAPAVGGKV
3610 3620 3630 3640 3650
KKKKKNRDKK RDKDKEVQAS LMVACLKRLL PVGLNLFAGR EQELVQHCKD
3660 3670 3680 3690 3700
RYLKKMPEYD VIEFARNQLT LPDKLDPSDE MSWQHYLYSK LGKTEEPVDE
3710 3720 3730 3740 3750
QALEKANVNS NEKGKDKTQE TVDRIVAMAK VLFGLHMIDH PQQQSKNVYR
3760 3770 3780 3790 3800
SVVSIQRKRA VIACFRQTSL HSLPRHRACN IFARSYYEQW LQEENVGQEV
3810 3820 3830 3840 3850
MVEDLTQTFE DSEKSKKEGE ETDSKPDPLT QLVTTFCRGA MTERSGALQE
3860 3870 3880 3890 3900
DLLYMSYAQI AAKSTGKEEE EGGDEEGGEG GEEGEGTSIH EQEMEKQKLL
3910 3920 3930 3940 3950
FHQARLSNRG VAEMVLLHIS ASKGIPSEMV MTTLNLGIAI LRGGNIDIQM
3960 3970 3980 3990 4000
GMLNHLKEKK DVGFFTSIAG LMNSCSVLDL DAFERNTKAE GLGVGSEGAA
4010 4020 4030 4040 4050
GEKNMHDAEF TCALFRFIQL TCEGHNLEWQ NYLRTQAGNT TTVNVVICTV
4060 4070 4080 4090 4100
DYLLRLQESI MDFYWHYSSK EIIDPAGKAN FFKAIEVASQ VFNTLTEVIQ
4110 4120 4130 4140 4150
GPCTLNQQAL AHSRLWDAVG GFLFLFSHMQ DKLSKHSSQV DLLKELLNLQ
4160 4170 4180 4190 4200
KDMITMMLSM LEGNVVNGTI GKQMVDTLVE SASNVELILK YFDMFLKLAD
4210 4220 4230 4240 4250
LIESPSFHEV DMKNEGWVTP KDFREKMEQS KNYTPEEMDF LLACCERNHE
4260 4270 4280 4290 4300
GKIDYRAFVE HFHEPSKEIG FNLAVLLTNL SEHMPNEPRL ARFLETAGSV
4310 4320 4330 4340 4350
LNYFEPFLGR IEILGSSKRI ERVYFEIKDS NIEQWEKPQI RESKRAFFYS
4360 4370 4380 4390 4400
IVTEGGDKEK LEAFVNFCED AIFEMTHASG LMATDDGGGN VKRDTAYSSY
4410 4420 4430 4440 4450
MSEEEEERAA RDPIRRTITA VKEGLKFGVH MLSPANIKHQ IGVMQTKSIP
4460 4470 4480 4490 4500
ELIVGFFKII FYIFYYTGYA HFCVVRYIFG ILLNLMRGPA PEQEEEPVVE
4510 4520 4530 4540 4550
EETFGRALPP LPLEEPPGTV QAFGLDINKE ENGMYKVVVH ESPANSSMEE
4560 4570 4580 4590 4600
GGESSPEDGA AASGELVEGE PHQEPISIVD LLGGEAAKKA AQERQEAQKA
4610 4620 4630 4640 4650
QEAAMASIEA EAKKSSSAPQ ETPAVHQIDF SQYTHRAVSF LARNFYNLKY
4660 4670 4680 4690 4700
VALVLAFSIN FMLLFYKVTS FTEEADSSAE EELILGSGSG GGADITGSGF
4710 4720 4730 4740 4750
GGSGDGGSGD GEMEDEIPEL VHVDEDFFYM EHVLRIAACL HSLVSLAMLI
4760 4770 4780 4790 4800
AYYHLKVPLA IFKREKEIAR RLEFEGLFIA EQPEDDDFKS HWDKLVISAK
4810 4820 4830 4840 4850
SFPVNYWDKF VKKKVRQKYS ETYDFDSISN LLGMEKSTFA AQESEETGIF
4860 4870 4880 4890 4900
KYIMNIDWRY QVWKAGVTFT DNAFLYSLWY FSFSVMGNFN NFFFAAHLLD
4910 4920 4930 4940 4950
VAVGFKTLRT ILQSVTHNGK QLVLTVMLLT IIVYIYTVIA FNFFRKFYIQ
4960 4970 4980 4990 5000
EEDEEVDKKC HDMLTCFVFH LYKGVRAGGG IGDEIGDPDG DDYEVYRIIF
5010 5020 5030 5040 5050
DITFFFFVII ILLAIIQGLI IDAFGELRDQ LESVKDNMES NCFICGMGKD
5060 5070 5080 5090 5100
FFDIVPHGFD THVQKEHNLA NYMFFLMHLI NKPDTEYTGQ ETYVWNMYQQ
5110 5120
RSWDFFPVGD CFRKQYEDEL SGGGGGG
Length:5,127
Mass (Da):581,012
Last modified:June 1, 2003 - v3
Checksum:i01B637D778DECE6A
GO
Isoform B1 Publication (identifier: Q24498-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1876-1889: Missing.

Show »
Length:5,113
Mass (Da):579,671
Checksum:iCFE36D40BE6729B5
GO
Isoform C1 Publication (identifier: Q24498-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1135-1165: VTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQ → EEKVYGGVSESFGKQCGPGDIVGVFLDLADH

Show »
Length:5,127
Mass (Da):580,829
Checksum:iC4F4F3B75DCEC0AC
GO
Isoform D1 Publication (identifier: Q24498-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1135-1165: VTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQ → EEKVYGGVSESFGKQCGPGDIVGVFLDLADH
     1876-1889: Missing.

Show »
Length:5,113
Mass (Da):579,487
Checksum:i6BE70740475694AB
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti314 – 3163CLR → SW in BAA41469 (PubMed:8276118).Curated
Sequence conflicti314 – 3163CLR → SW in BAA41470 (PubMed:8276118).Curated
Sequence conflicti314 – 3163CLR → SW in BAA41471 (PubMed:8276118).Curated
Sequence conflicti314 – 3163CLR → SW in BAA04212 (PubMed:8276118).Curated
Sequence conflicti1045 – 107935VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA41469 (PubMed:8276118).CuratedAdd
BLAST
Sequence conflicti1045 – 107935VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA41470 (PubMed:8276118).CuratedAdd
BLAST
Sequence conflicti1045 – 107935VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA41471 (PubMed:8276118).CuratedAdd
BLAST
Sequence conflicti1045 – 107935VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA04212 (PubMed:8276118).CuratedAdd
BLAST
Sequence conflicti2282 – 22821L → I in BAA41469 (PubMed:8276118).Curated
Sequence conflicti2282 – 22821L → I in BAA41470 (PubMed:8276118).Curated
Sequence conflicti2282 – 22821L → I in BAA41471 (PubMed:8276118).Curated
Sequence conflicti2282 – 22821L → I in BAA04212 (PubMed:8276118).Curated
Sequence conflicti2550 – 25501I → S in BAA41469 (PubMed:8276118).Curated
Sequence conflicti2550 – 25501I → S in BAA41470 (PubMed:8276118).Curated
Sequence conflicti2550 – 25501I → S in BAA41471 (PubMed:8276118).Curated
Sequence conflicti2550 – 25501I → S in BAA04212 (PubMed:8276118).Curated
Sequence conflicti2927 – 29271A → P in BAA41469 (PubMed:8276118).Curated
Sequence conflicti2927 – 29271A → P in BAA41470 (PubMed:8276118).Curated
Sequence conflicti2927 – 29271A → P in BAA41471 (PubMed:8276118).Curated
Sequence conflicti2927 – 29271A → P in BAA04212 (PubMed:8276118).Curated
Sequence conflicti3214 – 32141L → Q in BAA41469 (PubMed:8276118).Curated
Sequence conflicti3214 – 32141L → Q in BAA41470 (PubMed:8276118).Curated
Sequence conflicti3214 – 32141L → Q in BAA41471 (PubMed:8276118).Curated
Sequence conflicti3214 – 32141L → Q in BAA04212 (PubMed:8276118).Curated
Sequence conflicti3361 – 33611A → G in BAA41469 (PubMed:8276118).Curated
Sequence conflicti3361 – 33611A → G in BAA41470 (PubMed:8276118).Curated
Sequence conflicti3361 – 33611A → G in BAA41471 (PubMed:8276118).Curated
Sequence conflicti3361 – 33611A → G in BAA04212 (PubMed:8276118).Curated
Sequence conflicti4096 – 40961T → I in BAA41469 (PubMed:8276118).Curated
Sequence conflicti4096 – 40961T → I in BAA41470 (PubMed:8276118).Curated
Sequence conflicti4096 – 40961T → I in BAA41471 (PubMed:8276118).Curated
Sequence conflicti4096 – 40961T → I in BAA04212 (PubMed:8276118).Curated
Sequence conflicti4633 – 46331Y → D (PubMed:1338312).Curated
Sequence conflicti4695 – 46951I → T (PubMed:1338312).Curated
Sequence conflicti5022 – 50243DAF → AL (PubMed:1338312).Curated
Sequence conflicti5073 – 50731M → I (PubMed:1338312).Curated
Sequence conflicti5077 – 50771M → L (PubMed:1338312).Curated
Sequence conflicti5103 – 512725WDFFP…GGGGG → GTSSQWETASASNTRMSFPA EAAAA (PubMed:1338312).CuratedAdd
BLAST

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1135 – 116531VTKMH…DVKEQ → EEKVYGGVSESFGKQCGPGD IVGVFLDLADH in isoform C and isoform D. 1 PublicationVSP_050195Add
BLAST
Alternative sequencei1876 – 188914Missing in isoform B and isoform D. 1 PublicationVSP_050196Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17389 Genomic DNA. Translation: BAA04212.1.
D17389 Genomic DNA. Translation: BAA41469.1.
D17389 Genomic DNA. Translation: BAA41470.1.
D17389 Genomic DNA. Translation: BAA41471.1.
AE013599 Genomic DNA. Translation: AAF59036.2.
AE013599 Genomic DNA. Translation: AAM71082.1.
AE013599 Genomic DNA. Translation: AAM71083.1.
AE013599 Genomic DNA. Translation: AAM71084.1.
Z18536 mRNA. Translation: CAA79221.1.
PIRiB49131.
S40450.
RefSeqiNP_476991.1. NM_057643.4. [Q24498-2]
NP_476992.1. NM_057644.4. [Q24498-3]
NP_476993.1. NM_057645.3. [Q24498-4]
NP_476994.1. NM_057646.4. [Q24498-5]
UniGeneiDm.22868.

Genome annotation databases

EnsemblMetazoaiFBtr0088640; FBpp0087721; FBgn0011286. [Q24498-2]
GeneIDi49090.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17389 Genomic DNA. Translation: BAA04212.1.
D17389 Genomic DNA. Translation: BAA41469.1.
D17389 Genomic DNA. Translation: BAA41470.1.
D17389 Genomic DNA. Translation: BAA41471.1.
AE013599 Genomic DNA. Translation: AAF59036.2.
AE013599 Genomic DNA. Translation: AAM71082.1.
AE013599 Genomic DNA. Translation: AAM71083.1.
AE013599 Genomic DNA. Translation: AAM71084.1.
Z18536 mRNA. Translation: CAA79221.1.
PIRiB49131.
S40450.
RefSeqiNP_476991.1. NM_057643.4. [Q24498-2]
NP_476992.1. NM_057644.4. [Q24498-3]
NP_476993.1. NM_057645.3. [Q24498-4]
NP_476994.1. NM_057646.4. [Q24498-5]
UniGeneiDm.22868.

3D structure databases

ProteinModelPortaliQ24498.
SMRiQ24498. Positions 15-199.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi71972. 5 interactions.
IntActiQ24498. 13 interactions.
STRINGi7227.FBpp0293114.

Chemistry

BindingDBiQ24498.
ChEMBLiCHEMBL6045.

PTM databases

iPTMnetiQ24498.

Proteomic databases

PaxDbiQ24498.
PRIDEiQ24498.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0088640; FBpp0087721; FBgn0011286. [Q24498-2]
GeneIDi49090.

Organism-specific databases

CTDi49090.
FlyBaseiFBgn0011286. RyR.

Phylogenomic databases

eggNOGiKOG2243. Eukaryota.
ENOG410YCNW. LUCA.
GeneTreeiENSGT00760000119152.
InParanoidiQ24498.
OrthoDBiEOG71K622.
PhylomeDBiQ24498.

Miscellaneous databases

GenomeRNAii49090.
NextBioi839640.
PROiQ24498.

Gene expression databases

BgeeiQ24498.
ExpressionAtlasiQ24498. differential.
GenevisibleiQ24498. DM.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR001870. B30.2/SPRY.
IPR013320. ConA-like_dom.
IPR011992. EF-hand-dom_pair.
IPR014821. Ins145_P3_rcpt.
IPR005821. Ion_trans_dom.
IPR016093. MIR_motif.
IPR013662. RIH_assoc-dom.
IPR000699. RIH_dom.
IPR013333. Ryan_recept.
IPR003032. Ryanodine_rcpt.
IPR015925. Ryanodine_recept-rel.
IPR009460. Ryanrecept_TM4-6.
IPR003877. SPRY_dom.
[Graphical view]
PANTHERiPTHR13715. PTHR13715. 7 hits.
PfamiPF08709. Ins145_P3_rec. 1 hit.
PF00520. Ion_trans. 1 hit.
PF02815. MIR. 1 hit.
PF08454. RIH_assoc. 1 hit.
PF06459. RR_TM4-6. 1 hit.
PF01365. RYDR_ITPR. 2 hits.
PF02026. RyR. 4 hits.
PF00622. SPRY. 3 hits.
[Graphical view]
PRINTSiPR00795. RYANODINER.
SMARTiSM00472. MIR. 4 hits.
SM00449. SPRY. 3 hits.
[Graphical view]
SUPFAMiSSF100909. SSF100909. 1 hit.
SSF47473. SSF47473. 1 hit.
SSF49899. SSF49899. 2 hits.
SSF82109. SSF82109. 2 hits.
PROSITEiPS50188. B302_SPRY. 3 hits.
PS50919. MIR. 5 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of a gene for a ryanodine receptor/calcium release channel in Drosophila melanogaster."
    Takeshima H., Nishi M., Iwabe N., Miyata T., Hosoya T., Masai I., Hotta Y.
    FEBS Lett. 337:81-87(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS A; B; C AND D), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  2. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley1 Publication.
  3. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley1 Publication.
  4. "Drosophila homologs of two mammalian intracellular Ca(2+)-release channels: identification and expression patterns of the inositol 1,4,5-triphosphate and the ryanodine receptor genes."
    Hasan G., Rosbash M.
    Development 116:967-975(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE OF 4619-5127, DEVELOPMENTAL STAGE, TISSUE SPECIFICITY.
    Tissue: Brain1 Publication.
  5. "The ryanodine receptor is essential for larval development in Drosophila melanogaster."
    Sullivan K.M.C., Scott K., Zuker C.S., Rubin G.M.
    Proc. Natl. Acad. Sci. U.S.A. 97:5942-5947(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  6. "Phosphoproteome analysis of Drosophila melanogaster embryos."
    Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.
    J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1459, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryo.

Entry informationi

Entry nameiRYR_DROME
AccessioniPrimary (citable) accession number: Q24498
Secondary accession number(s): Q24321
, Q24499, Q24500, Q24501, Q8MKS3, Q8MKS4, Q8MKS5, Q9V4Y7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: June 1, 2003
Last modified: May 11, 2016
This is version 142 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Miscellaneous

Channel activity is modulated by the alkaloid ryanodine that binds to the open Ca-release channel with high affinity and maintains the channel in an open conformation. The calcium release channel is modulated by calcium ions, magnesium ions, ATP and calmodulin (By similarity).By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.