Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-binding protein Ewg

Gene

ewg

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

May function as a positive regulator of transcription in developing and differentiated neurons, regulating common aspects of neuronal differentiation and maintenance. Requirement in the CNS may be higher than in the peripheral system. Vital for development of the indirect flight muscles.1 Publication1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi167 – 379By similarityAdd BLAST213

GO - Molecular functioni

  • DNA binding Source: UniProtKB

GO - Biological processi

  • central nervous system development Source: UniProtKB
  • imaginal disc morphogenesis Source: UniProtKB
  • muscle organ development Source: UniProtKB
  • negative regulation of synaptic growth at neuromuscular junction Source: FlyBase
  • positive regulation of Wnt signaling pathway Source: FlyBase
  • regulation of transcription from RNA polymerase II promoter Source: FlyBase
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
DNA-binding protein Ewg
Alternative name(s):
Protein erect wing
Gene namesi
Name:ewg
ORF Names:CG3114
OrganismiDrosophila melanogaster (Fruit fly)Imported
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0005427. ewg.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001002131 – 733DNA-binding protein EwgAdd BLAST733

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei97Phosphoserine; by CK2By similarity1
Modified residuei110Phosphoserine; by CK2By similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ24312.
PRIDEiQ24312.

Expressioni

Tissue specificityi

Isoform A is highly expressed in possibly all embryonic neurons and is enriched in adult heads. Other isoforms show similar expression at a much lower level. Transient expression in migrating myoblasts.2 Publications

Developmental stagei

Expressed throughout development, beginning at embryonic stage 12 when levels steadily increase and then drop dramatically at third-instar larvae. Levels increase in 24 hour pupae and remain until adulthood.1 Publication

Gene expression databases

BgeeiFBgn0005427.
ExpressionAtlasiQ24312. differential.
GenevisibleiQ24312. DM.

Interactioni

Subunit structurei

Homodimer. Binds DNA as a dimer (By similarity).By similarity

Protein-protein interaction databases

BioGridi57548. 64 interactors.
IntActiQ24312. 4 interactors.
STRINGi7227.FBpp0300529.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni69 – 136DimerizationBy similarityAdd BLAST68
Regioni375 – 663Required for transcriptional activationBy similarityAdd BLAST289

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi146 – 174Nuclear localization signalBy similarityAdd BLAST29

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi86 – 124Asp/Glu-rich (acidic)Add BLAST39
Compositional biasi126 – 144Ala-richAdd BLAST19
Compositional biasi442 – 528Ala/Gln-richAdd BLAST87

Sequence similaritiesi

Belongs to the NRF1/Ewg family.Curated

Phylogenomic databases

eggNOGiENOG410IDYK. Eukaryota.
ENOG410XNU7. LUCA.
InParanoidiQ24312.
KOiK11831.
OrthoDBiEOG091G0BDT.

Family and domain databases

InterProiView protein in InterPro
IPR019526. Nrf1_activation-bd.
IPR019525. Nrf1_NLS/DNA-bd_dimer.
PfamiView protein in Pfam
PF10492. Nrf1_activ_bdg. 1 hit.
PF10491. Nrf1_DNA-bind. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform A (identifier: Q24312-1) [UniParc]FASTAAdd to basket
Also known as: C

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATTSYRLVV APAGSQRSST GNVVVTTTSS GSHSSNGANG GTGGTSAGSS
60 70 80 90 100
TLGSGLNVTT ITATSGGQLQ SAGNTSQSNG TTYKIEMLEE DIQSLGSDDD
110 120 130 140 150
DEDLISSDGS LYEGDLGSMP VNDDVAHQLA AAGPVGVAAA AAIASSKKRK
160 170 180 190 200
RPHCFETNPS VRKRQQNRLL RKLRAIIYEF TGRVGKQAVV LVATPGKPNT
210 220 230 240 250
SYKVFGAKPL EDVLRNLKNI VMDELDNALA QQAPPPPQDD PSLFELPGLV
260 270 280 290 300
IDGIPTPVEK MTQAQLRAFI PLMLKYSTGR GKPGWGREST RPPWWPKELP
310 320 330 340 350
WANVRMDARS EDDKQKISWT HALRKIVINC YKYHGREDLL PTFADDEDKV
360 370 380 390 400
NALISQSGDE DEDMELSNPP TIHTVTTMTP PTGNSNQPQQ VNVVKINSAG
410 420 430 440 450
TVITTHTAQS NTPAPTIIQS TNNQHVTTTA TLPASTKIEI CQAPAQNQQH
460 470 480 490 500
HQHHQTHLPN AVHIQPVAGG QPQTIQLTTA SGTATATAVQ TTAAAVSAAQ
510 520 530 540 550
AHAHSQSQAH SQSSANQTVT AQQIANAQVC IEPITLSDVD YTTQTVLSQN
560 570 580 590 600
ADGTVSLIQV DPNNPIITLP DGTTAQVQGV ATLHQGEGGA TIQTVQSLTD
610 620 630 640 650
VNGHENMTVD LTETQDGQIY ITTEDGQGYP VSVSNVISVP VSMYQSVMAN
660 670 680 690 700
VQQIQTNSDG TVCLAPMQVE NGDQLETITM SPGMHQMMIQ GGPGQEPQLV
710 720 730
QVVSLKDATL LSKAMEAINS GNVKSEDTII MEQ
Length:733
Mass (Da):77,763
Last modified:October 1, 2001 - v2
Checksum:iA1CA6CD7AB3177A3
GO
Isoform B (identifier: Q24312-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-733: ENGDQLETIT...KSEDTIIMEQ → DTSINRSTST...LPAIKLEHLG

Note: No experimental confirmation available.Curated
Show »
Length:840
Mass (Da):88,487
Checksum:i95AEE47C155AC795
GO
Isoform D (identifier: Q24312-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     541-581: YTTQTVLSQN...GTTAQVQGVA → LIVIELLVIS...SHRTPMVPYR
     582-733: Missing.

Note: No experimental confirmation available.
Show »
Length:581
Mass (Da):62,183
Checksum:i1B51DEAAA0E14E71
GO
Isoform E (identifier: Q24312-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-733: VENGDQLETI...KSEDTIIMEQ → IGKLENFRGPLDLWRMATSWRPSPCRLECTR

Note: No experimental confirmation available.
Show »
Length:699
Mass (Da):74,454
Checksum:iDD78AD23DD77624E
GO
Isoform F (identifier: Q24312-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-540: Missing.

Note: No experimental confirmation available.
Show »
Length:579
Mass (Da):61,836
Checksum:iD2297EA6D7510A01
GO
Isoform G (identifier: Q24312-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-540: Missing.
     669-733: VENGDQLETI...KSEDTIIMEQ → IGKLENFRGPLDLWRMATSWRPSPCRLECTR

Note: No experimental confirmation available.
Show »
Length:545
Mass (Da):58,526
Checksum:i253961D186BE408D
GO
Isoform H (identifier: Q24312-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-427: QPQQVNVVKI...IQSTNNQHVT → LIVIELLVIS...SHRTPMVPYR
     428-733: Missing.

Note: No experimental confirmation available.
Show »
Length:427
Mass (Da):46,255
Checksum:i9F862F6D0E674AAE
GO

Sequence cautioni

The sequence AAL90347 differs from that shown. Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.Curated
The sequence CAB43325 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti172 – 173KL → NV in AAA28478 (PubMed:8388540).Curated2
Sequence conflicti172 – 173KL → NV in AAD34460 (PubMed:10330140).Curated2
Isoform B (identifier: Q24312-4)
Sequence conflicti777V → A in AAL90347 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026515387 – 540Missing in isoform F and isoform G. CuratedAdd BLAST154
Alternative sequenceiVSP_026516387 – 427QPQQV…NQHVT → LIVIELLVISIIICIRHKLK KHTHITPRKRSSHRTPMVPY R in isoform H. CuratedAdd BLAST41
Alternative sequenceiVSP_026517428 – 733Missing in isoform H. CuratedAdd BLAST306
Alternative sequenceiVSP_026518541 – 581YTTQT…VQGVA → LIVIELLVISIIICIRHKLK KHTHITPRKRSSHRTPMVPY R in isoform D. CuratedAdd BLAST41
Alternative sequenceiVSP_026519582 – 733Missing in isoform D. CuratedAdd BLAST152
Alternative sequenceiVSP_026520669 – 733VENGD…IIMEQ → IGKLENFRGPLDLWRMATSW RPSPCRLECTR in isoform E and isoform G. CuratedAdd BLAST65
Alternative sequenceiVSP_003603670 – 733ENGDQ…IIMEQ → DTSINRSTSTAASSSSSLGN GGVQCYSLISAGSSVLSRRS GGVIGHQVTPGERYYLATTT SSSLGLNNNNNCTLANNNNS VKMPIVLATPSIPQVANKRS TGKRSTGVSGGDDVMVQKRG RPNSSSRSKSQLNANENAHS SGTSSSIRCVDSASLTNVQL QLPAIKLEHLG in isoform B. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11345 mRNA. Translation: AAA28478.1.
AF135590 Genomic DNA. Translation: AAD34460.1.
AE014298 Genomic DNA. Translation: AAF45491.5.
AE014298 Genomic DNA. Translation: AAF45492.5.
AE014298 Genomic DNA. Translation: AAX52466.1.
AE014298 Genomic DNA. Translation: AAX52467.1.
AE014298 Genomic DNA. Translation: AAX52468.1.
AE014298 Genomic DNA. Translation: AAX52469.1.
AE014298 Genomic DNA. Translation: AAX52470.1.
AE014298 Genomic DNA. Translation: AAX52471.1.
AL050231 Genomic DNA. Translation: CAB43325.1. Sequence problems.
AY089609 mRNA. Translation: AAL90347.1. Sequence problems.
PIRiA48128.
RefSeqiNP_001014707.1. NM_001014707.2. [Q24312-8]
NP_001014708.1. NM_001014708.2. [Q24312-7]
NP_001014709.1. NM_001014709.2. [Q24312-6]
NP_001014710.1. NM_001014710.2. [Q24312-5]
NP_001014711.1. NM_001014711.2. [Q24312-1]
NP_001014712.1. NM_001014712.2. [Q24312-9]
NP_476892.4. NM_057544.4. [Q24312-4]
NP_726660.3. NM_166836.2. [Q24312-1]
UniGeneiDm.4971.

Genome annotation databases

GeneIDi30975.
KEGGidme:Dmel_CG3114.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiEWG_DROME
AccessioniPrimary (citable) accession number: Q24312
Secondary accession number(s): A4V3R8
, Q59E73, Q59E74, Q59E75, Q59E76, Q59E77, Q8SXJ1, Q9NF76, Q9W5G8, Q9W5G9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: October 1, 2001
Last modified: September 27, 2017
This is version 142 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families