Q24270 (CAC1D_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent calcium channel type D subunit alpha-1 Short name=DmCa1D | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 2516 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development. Ref.1 |
| Subcellular location | |
| Tissue specificity | Expressed in the adult body, head and leg. Highly expressed in the embryonic nervous system. |
| Developmental stage | Faintly expressed in embryos at 9-12 hours. Expression increases rapidly as the nervous system matures, peaking just prior to hatching. A second peak is observed in late pupal stages around 73-108 hours postpuparium. |
| Domain | Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. |
| Sequence similarities | Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. [View classification] |
| Caution | It is uncertain whether Met-1, Met-494, Met-539, Met-544 or Met-553 is the initiator. |
| Sequence caution | The sequence AAL13497.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q24270-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q24270-3) The sequence of this isoform differs from the canonical sequence as follows: 1293-1329: VDEEGMITAR...PGTSFFLFSQ → DSNSEVSARV...RGSAFFIFSY | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform C (identifier: Q24270-4) The sequence of this isoform differs from the canonical sequence as follows: 1496-1496: K → KYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform D (identifier: Q24270-2) The sequence of this isoform differs from the canonical sequence as follows: 2282-2300: NRNRGILLHPYNNVYAPNG → LRTQWCSSWPRTHDPIDTS 2301-2516: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2516 | 2516 | Voltage-dependent calcium channel type D subunit alpha-1 | PRO_0000053960 | |||||
Regions | |||||||||
| Topological domain | 1 – 615 | 615 | Cytoplasmic Potential | ||||||
| Transmembrane | 616 – 634 | 19 | Helical; Name=S1 of repeat I; Potential | ||||||
| Topological domain | 635 – 653 | 19 | Extracellular Potential | ||||||
| Transmembrane | 654 – 671 | 18 | Helical; Name=S2 of repeat I; Potential | ||||||
| Topological domain | 672 – 684 | 13 | Cytoplasmic Potential | ||||||
| Transmembrane | 685 – 699 | 15 | Helical; Name=S3 of repeat I; Potential | ||||||
| Topological domain | 700 – 711 | 12 | Extracellular Potential | ||||||
| Transmembrane | 712 – 730 | 19 | Helical; Name=S4 of repeat I; Potential | ||||||
| Topological domain | 731 – 750 | 20 | Cytoplasmic Potential | ||||||
| Transmembrane | 751 – 770 | 20 | Helical; Name=S5 of repeat I; Potential | ||||||
| Topological domain | 771 – 853 | 83 | Extracellular Potential | ||||||
| Transmembrane | 854 – 878 | 25 | Helical; Name=S6 of repeat I; Potential | ||||||
| Topological domain | 879 – 985 | 107 | Cytoplasmic Potential | ||||||
| Transmembrane | 986 – 1005 | 20 | Helical; Name=S1 of repeat II; Potential | ||||||
| Topological domain | 1006 – 1018 | 13 | Extracellular Potential | ||||||
| Transmembrane | 1019 – 1038 | 20 | Helical; Name=S2 of repeat II; Potential | ||||||
| Topological domain | 1039 – 1047 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 1048 – 1066 | 19 | Helical; Name=S3 of repeat II; Potential | ||||||
| Topological domain | 1067 – 1076 | 10 | Extracellular Potential | ||||||
| Transmembrane | 1077 – 1095 | 19 | Helical; Name=S4 of repeat II; Potential | ||||||
| Topological domain | 1096 – 1114 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1115 – 1134 | 20 | Helical; Name=S5 of repeat II; Potential | ||||||
| Topological domain | 1135 – 1190 | 56 | Extracellular Potential | ||||||
| Transmembrane | 1191 – 1215 | 25 | Helical; Name=S6 of repeat II; Potential | ||||||
| Topological domain | 1216 – 1339 | 124 | Cytoplasmic Potential | ||||||
| Transmembrane | 1340 – 1363 | 24 | Helical; Name=S1 of repeat III; Potential | ||||||
| Topological domain | 1364 – 1380 | 17 | Extracellular Potential | ||||||
| Transmembrane | 1381 – 1400 | 20 | Helical; Name=S2 of repeat III; Potential | ||||||
| Topological domain | 1401 – 1408 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 1409 – 1431 | 23 | Helical; Name=S3 of repeat III; Potential | ||||||
| Topological domain | 1432 – 1439 | 8 | Extracellular Potential | ||||||
| Transmembrane | 1440 – 1454 | 15 | Helical; Name=S4 of repeat III; Potential | ||||||
| Topological domain | 1455 – 1475 | 21 | Cytoplasmic Potential | ||||||
| Transmembrane | 1476 – 1495 | 20 | Helical; Name=S5 of repeat III; Potential | ||||||
| Topological domain | 1496 – 1584 | 89 | Extracellular Potential | ||||||
| Transmembrane | 1585 – 1609 | 25 | Helical; Name=S6 of repeat III; Potential | ||||||
| Topological domain | 1610 – 1664 | 55 | Cytoplasmic Potential | ||||||
| Transmembrane | 1665 – 1683 | 19 | Helical; Name=S1 of repeat IV; Potential | ||||||
| Topological domain | 1684 – 1697 | 14 | Extracellular Potential | ||||||
| Transmembrane | 1698 – 1717 | 20 | Helical; Name=S2 of repeat IV; Potential | ||||||
| Topological domain | 1718 – 1726 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 1727 – 1745 | 19 | Helical; Name=S3 of repeat IV; Potential | ||||||
| Topological domain | 1746 – 1777 | 32 | Extracellular Potential | ||||||
| Transmembrane | 1778 – 1796 | 19 | Helical; Name=S4 of repeat IV; Potential | ||||||
| Topological domain | 1797 – 1815 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1816 – 1835 | 20 | Helical; Name=S5 of repeat IV; Potential | ||||||
| Topological domain | 1836 – 1902 | 67 | Extracellular Potential | ||||||
| Transmembrane | 1903 – 1921 | 19 | Helical; Name=S6 of repeat IV; Potential | ||||||
| Topological domain | 1922 – 2516 | 595 | Cytoplasmic Potential | ||||||
| Repeat | 602 – 883 | 282 | I | ||||||
| Repeat | 971 – 1217 | 247 | II | ||||||
| Repeat | 1331 – 1613 | 283 | III | ||||||
| Repeat | 1648 – 1929 | 282 | IV | ||||||
| Calcium binding | 1957 – 1968 | 12 | By similarity | ||||||
| Region | 1533 – 1622 | 90 | Dihydropyridine binding By similarity | ||||||
| Region | 1885 – 1948 | 64 | Dihydropyridine binding By similarity | ||||||
| Region | 1896 – 1937 | 42 | Phenylalkylamine binding By similarity | ||||||
| Compositional bias | 59 – 62 | 4 | Poly-Val | ||||||
| Compositional bias | 208 – 211 | 4 | Poly-Gly | ||||||
| Compositional bias | 262 – 267 | 6 | Poly-Ser | ||||||
| Compositional bias | 322 – 328 | 7 | Poly-Ala | ||||||
| Compositional bias | 460 – 463 | 4 | Poly-Glu | ||||||
| Compositional bias | 1115 – 1121 | 7 | Poly-Leu | ||||||
| Compositional bias | 1288 – 1292 | 5 | Poly-Glu | ||||||
| Compositional bias | 1591 – 1597 | 7 | Poly-Ile | ||||||
| Compositional bias | 2466 – 2469 | 4 | Poly-Asn | ||||||
Sites | |||||||||
| Site | 836 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 1168 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 1559 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 1869 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1937 | 1 | Phosphoserine; by PKA Potential | ||||||
| Glycosylation | 644 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 647 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1293 – 1329 | 37 | VDEEG…FLFSQ → DSNSEVSARVTARPRRLSEV SMKKTKKPIPRGSAFFIFSY in isoform B. | VSP_017568 | |||||
| Alternative sequence | 1496 | 1 | K → KYVVKCVVVAIKTIGNIMLV TYLLQFMFAVIGVQLFK in isoform C. | VSP_017569 | |||||
| Alternative sequence | 2282 – 2300 | 19 | NRNRG…YAPNG → LRTQWCSSWPRTHDPIDTS in isoform D. | VSP_007604 | |||||
| Alternative sequence | 2301 – 2516 | 216 | Missing in isoform D. | VSP_007605 | |||||
Experimental info | |||||||||
| Mutagenesis | 629 | 1 | C → Y in AR66; slower channel activation and reduction of peak current. Ref.6 Ref.7 | ||||||
| Sequence conflict | 134 | 1 | P → A in AAA81883. Ref.1 | ||||||
| Sequence conflict | 282 | 1 | F → L in AAA81883. Ref.1 | ||||||
| Sequence conflict | 678 | 1 | N → D in AAA81883. Ref.1 | ||||||
| Sequence conflict | 683 | 1 | R → G in AAA81883. Ref.1 | ||||||
| Sequence conflict | 696 | 1 | I → M in AAA81883. Ref.1 | ||||||
| Sequence conflict | 1390 | 1 | I → M in AAA81883. Ref.1 | ||||||
| Sequence conflict | 1433 | 1 | N → D in AAA81883. Ref.1 | ||||||
| Sequence conflict | 2479 | 1 | N → S in AAA81883. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a calcium channel alpha 1 subunit from Drosophila melanogaster with similarity to the rat brain type D isoform." Zheng W., Feng G., Ren D., Eberl D.F., Hannan F., Dubald M., Hall L.M. J. Neurosci. 15:1132-1143(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, ALTERNATIVE SPLICING. Strain: Canton-S. Tissue: Head. |
| [2] | "An exploration of the sequence of a 2.9-Mb region of the genome of Drosophila melanogaster: the Adh region." Ashburner M., Misra S., Roote J., Lewis S.E., Blazej R.G., Davis T., Doyle C., Galle R.F., George R.A., Harris N.L., Hartzell G., Harvey D.A., Hong L., Houston K.A., Hoskins R.A., Johnson G., Martin C., Moshrefi A.R. Rubin G.M.Genetics 153:179-219(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1895-2300 (ISOFORM D). Strain: Berkeley. Tissue: Head. |
| [6] | "A mutation affecting dihydropyridine-sensitive current levels and activation kinetics in Drosophila muscle and mammalian heart calcium channels." Ren D., Xu H., Eberl D.F., Chopra M., Hall L.M. J. Neurosci. 18:2335-2341(1998) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF CYS-629. |
| [7] | "Genetic and developmental characterization of Dmca1D, a calcium channel alpha-1 subunit gene in Drosophila melanogaster." Eberl D.F., Ren D., Feng G., Lorenz L.J., van Vactor D., Hall L.M. Genetics 148:1159-1169(1998) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF CYS-629. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U00690 mRNA. Translation: AAA81883.1. AE014134 Genomic DNA. Translation: AAF53504.1. AE014134 Genomic DNA. Translation: AAN10929.1. AE014134 Genomic DNA. Translation: AAN10930.1. AE014134 Genomic DNA. Translation: AAN10931.1. AY058268 mRNA. Translation: AAL13497.1. Different initiation. |
| RefSeq | NP_525104.2. NM_080365.3. NP_602305.1. NM_134429.3. NP_723952.1. NM_165146.2. NP_723953.1. NM_165147.2. |
| UniGene | Dm.4099. |
3D structure databases | |
| ProteinModelPortal | Q24270. |
| SMR | Q24270. Positions 617-877, 892-920, 982-1218, 1346-1610, 1665-1927, 2010-2088. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q24270. 1 interaction. |
Proteomic databases | |
| PaxDb | Q24270. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0090006; FBpp0089049; FBgn0001991. |
| GeneID | 34950. |
| KEGG | dme:Dmel_CG4894. |
Organism-specific databases | |
| CTD | 34950. |
| FlyBase | FBgn0001991. Ca-alpha1D. |
Phylogenomic databases | |
| eggNOG | COG1226. |
| GeneTree | ENSGT00680000099727. |
| InParanoid | Q24270. |
| KO | K05315. |
| OMA | LCIRIVE. |
| OrthoDB | EOG476HF0. |
Gene expression databases | |
| Bgee | Q24270. |
| GermOnline | CG4894. Drosophila melanogaster. |
Family and domain databases | |
| Gene3D | 1.20.120.350. 5 hits. |
| InterPro | IPR005821. Ion_trans_dom. IPR027359. K_channel_four-helix_dom. IPR014873. VDCC_a1su_IQ. IPR005446. VDCC_L_a1su. IPR002077. VDCCAlpha1. [Graphical view] |
| Pfam | PF08763. Ca_chan_IQ. 1 hit. PF00520. Ion_trans. 4 hits. [Graphical view] |
| PRINTS | PR00167. CACHANNEL. PR01630. LVDCCALPHA1. |
| SMART | SM01062. Ca_chan_IQ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | Ca-alpha1D. drosophila. |
| GenomeRNAi | 34950. |
| NextBio | 791045. |
Entry information
| Entry name | CAC1D_DROME | ||||||||
| Accession | Primary (citable) accession number: Q24270 Secondary accession number(s): Q8IP23 Q9V3P7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
