Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q24270

- CAC1D_DROME

UniProt

Q24270 - CAC1D_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Voltage-dependent calcium channel type D subunit alpha-1

Gene

Ca-alpha1D

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei836 – 8361Calcium ion selectivity and permeabilityBy similarity
Sitei1168 – 11681Calcium ion selectivity and permeabilityBy similarity
Sitei1559 – 15591Calcium ion selectivity and permeabilityBy similarity
Sitei1869 – 18691Calcium ion selectivity and permeabilityBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi1957 – 196812By similarityAdd
BLAST

GO - Molecular functioni

  1. high voltage-gated calcium channel activity Source: RefGenome
  2. metal ion binding Source: UniProtKB-KW
  3. voltage-gated calcium channel activity Source: FlyBase

GO - Biological processi

  1. calcium ion import Source: RefGenome
  2. calcium ion transport Source: FlyBase
  3. epithelial fluid transport Source: FlyBase
  4. membrane depolarization during action potential Source: RefGenome
  5. muscle contraction Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent calcium channel type D subunit alpha-1
Short name:
DmCa1D
Gene namesi
Name:Ca-alpha1D
Synonyms:DroCa1, l(2)35Fa
ORF Names:CG4894
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 2L

Organism-specific databases

FlyBaseiFBgn0001991. Ca-alpha1D.

Subcellular locationi

GO - Cellular componenti

  1. apical plasma membrane Source: FlyBase
  2. basolateral plasma membrane Source: FlyBase
  3. voltage-gated calcium channel complex Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi629 – 6291C → Y in AR66; slower channel activation and reduction of peak current. 2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25162516Voltage-dependent calcium channel type D subunit alpha-1PRO_0000053960Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi644 – 6441N-linked (GlcNAc...)Sequence Analysis
Glycosylationi647 – 6471N-linked (GlcNAc...)Sequence Analysis
Modified residuei1937 – 19371Phosphoserine; by PKASequence Analysis

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ24270.

Expressioni

Tissue specificityi

Expressed in the adult body, head and leg. Highly expressed in the embryonic nervous system.

Developmental stagei

Faintly expressed in embryos at 9-12 hours. Expression increases rapidly as the nervous system matures, peaking just prior to hatching. A second peak is observed in late pupal stages around 73-108 hours postpuparium.

Gene expression databases

BgeeiQ24270.
ExpressionAtlasiQ24270. differential.

Interactioni

Protein-protein interaction databases

BioGridi60962. 1 interaction.
IntActiQ24270. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ24270.
SMRiQ24270. Positions 617-920, 982-1216, 1346-1610, 1665-1927, 2010-2088.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 615615CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini635 – 65319ExtracellularSequence AnalysisAdd
BLAST
Topological domaini672 – 68413CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini700 – 71112ExtracellularSequence AnalysisAdd
BLAST
Topological domaini731 – 75020CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini771 – 85383ExtracellularSequence AnalysisAdd
BLAST
Topological domaini879 – 985107CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini1006 – 101813ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1039 – 10479CytoplasmicSequence Analysis
Topological domaini1067 – 107610ExtracellularSequence Analysis
Topological domaini1096 – 111419CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini1135 – 119056ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1216 – 1339124CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini1364 – 138017ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1401 – 14088CytoplasmicSequence Analysis
Topological domaini1432 – 14398ExtracellularSequence Analysis
Topological domaini1455 – 147521CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini1496 – 158489ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1610 – 166455CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini1684 – 169714ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1718 – 17269CytoplasmicSequence Analysis
Topological domaini1746 – 177732ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1797 – 181519CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini1836 – 190267ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1922 – 2516595CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei616 – 63419Helical; Name=S1 of repeat ISequence AnalysisAdd
BLAST
Transmembranei654 – 67118Helical; Name=S2 of repeat ISequence AnalysisAdd
BLAST
Transmembranei685 – 69915Helical; Name=S3 of repeat ISequence AnalysisAdd
BLAST
Transmembranei712 – 73019Helical; Name=S4 of repeat ISequence AnalysisAdd
BLAST
Transmembranei751 – 77020Helical; Name=S5 of repeat ISequence AnalysisAdd
BLAST
Transmembranei854 – 87825Helical; Name=S6 of repeat ISequence AnalysisAdd
BLAST
Transmembranei986 – 100520Helical; Name=S1 of repeat IISequence AnalysisAdd
BLAST
Transmembranei1019 – 103820Helical; Name=S2 of repeat IISequence AnalysisAdd
BLAST
Transmembranei1048 – 106619Helical; Name=S3 of repeat IISequence AnalysisAdd
BLAST
Transmembranei1077 – 109519Helical; Name=S4 of repeat IISequence AnalysisAdd
BLAST
Transmembranei1115 – 113420Helical; Name=S5 of repeat IISequence AnalysisAdd
BLAST
Transmembranei1191 – 121525Helical; Name=S6 of repeat IISequence AnalysisAdd
BLAST
Transmembranei1340 – 136324Helical; Name=S1 of repeat IIISequence AnalysisAdd
BLAST
Transmembranei1381 – 140020Helical; Name=S2 of repeat IIISequence AnalysisAdd
BLAST
Transmembranei1409 – 143123Helical; Name=S3 of repeat IIISequence AnalysisAdd
BLAST
Transmembranei1440 – 145415Helical; Name=S4 of repeat IIISequence AnalysisAdd
BLAST
Transmembranei1476 – 149520Helical; Name=S5 of repeat IIISequence AnalysisAdd
BLAST
Transmembranei1585 – 160925Helical; Name=S6 of repeat IIISequence AnalysisAdd
BLAST
Transmembranei1665 – 168319Helical; Name=S1 of repeat IVSequence AnalysisAdd
BLAST
Transmembranei1698 – 171720Helical; Name=S2 of repeat IVSequence AnalysisAdd
BLAST
Transmembranei1727 – 174519Helical; Name=S3 of repeat IVSequence AnalysisAdd
BLAST
Transmembranei1778 – 179619Helical; Name=S4 of repeat IVSequence AnalysisAdd
BLAST
Transmembranei1816 – 183520Helical; Name=S5 of repeat IVSequence AnalysisAdd
BLAST
Transmembranei1903 – 192119Helical; Name=S6 of repeat IVSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati602 – 883282IAdd
BLAST
Repeati971 – 1217247IIAdd
BLAST
Repeati1331 – 1613283IIIAdd
BLAST
Repeati1648 – 1929282IVAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1533 – 162290Dihydropyridine bindingBy similarityAdd
BLAST
Regioni1885 – 194864Dihydropyridine bindingBy similarityAdd
BLAST
Regioni1896 – 193742Phenylalkylamine bindingBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi59 – 624Poly-Val
Compositional biasi208 – 2114Poly-Gly
Compositional biasi262 – 2676Poly-Ser
Compositional biasi322 – 3287Poly-Ala
Compositional biasi460 – 4634Poly-Glu
Compositional biasi1115 – 11217Poly-Leu
Compositional biasi1288 – 12925Poly-Glu
Compositional biasi1591 – 15977Poly-Ile
Compositional biasi2466 – 24694Poly-Asn

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
GeneTreeiENSGT00760000118827.
InParanoidiQ24270.
KOiK05315.
OMAiLCIRIVE.
OrthoDBiEOG7T1RBQ.
PhylomeDBiQ24270.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q24270-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGGELVNCI AYDDNTLVIE RKPSPSSPST SRRYLKAETP TRGSRKYNRK
60 70 80 90 100
SSAKSDLEVV VVKPEHHHQH RSPTITLPVP ANPLTTSASA GSSPTGAGLA
110 120 130 140 150
AGLGTASGTV LQQSCSALDP PEDSNQPSGT RRRPTSTELA LSNVTSQIVN
160 170 180 190 200
NATYKLDFKQ RRHKSNNGGS ESGSLTGIAT GPATSPAGPT GPTSSSGKRR
210 220 230 240 250
KSSCTSCGGG GISAPPPRLT PEEAWQLQPQ NSVTSAGSTN SSFSSGGGRD
260 270 280 290 300
DNSSYSAVGG DSSSSNSCNC DITGDNSTLH GFGVGDVCSF IADCDDNSED
310 320 330 340 350
DDGDPNNQDL SSQTLRTAAI VAAVAAAAKE QAQEQSLADC ESFSDRRQDA
360 370 380 390 400
DEDVRIIQDC CGGNNDSLED VGEVDDNADV VVRKNSRNRP SIRRTCRITE
410 420 430 440 450
EDDDEDENAD YGDFDREDQE LDDEEPEGTT IDIDEQEQQH DQGDSAEEED
460 470 480 490 500
DDEDVDEYFE EEEDDTQAFS PFYSSSAELI DNFGGGAGKF FNIMDFERGA
510 520 530 540 550
SGEGGFSPNG NGGPGSGDVS RTARYDSGEG DLGGGNNIMG IDSMGIANIP
560 570 580 590 600
ETMNGTTIGP SGAGGQKGGA AAGAAGQKRQ QRRGKPQPDR PQRALFCLSV
610 620 630 640 650
KNPLRALCIR IVEWKPFEFL ILLTIFANCI ALAVYTPYPG SDSNVTNQTL
660 670 680 690 700
EKVEYVFLVI FTAECVMKIL AYGFVLHNGA YLRNGWNLLD FTIVVIGAIS
710 720 730 740 750
TALSQLMKDA FDVKALRAFR VLRPLRLVSG VPSLQVVLNS ILKAMVPLFH
760 770 780 790 800
IALLVLFVII IYAIIGLELF SGKLHKACRD EITGEYEENI RPCGVGYQCP
810 820 830 840 850
PGYKCYGGWD GPNDGITNFD NFGLAMLTVF QCVTLEGWTD VLYSIQDAMG
860 870 880 890 900
SDWQWMYFIS MVILGAFFVM NLILGVLSGE FSKERNKAKN RGDFQKLREK
910 920 930 940 950
QQIEEDLRGY LDWITQAEDI EPDAVGGLIS DGKGKQPNEM DSTENLGEEM
960 970 980 990 1000
PEVQMTESRW RKMKKDFDRV NRRMRRACRK AVKSQAFYWL IIVLVFLNTG
1010 1020 1030 1040 1050
VLATEHYGQL DWLDNFQEYT NVFFIGLFTC EMLLKMYSLG FQGYFVSLFN
1060 1070 1080 1090 1100
RFDCFVVIGS ITETLLTNTG MMPPLGVSVL RCVRLLRVFK VTKYWRSLSN
1110 1120 1130 1140 1150
LVASLLNSIQ SIASLLLLLF LFIVIFALLG MQVFGGKFNF DGKEEKYRMN
1160 1170 1180 1190 1200
FDCFWQALLT VFQIMTGEDW NAVMYVGINA YGGVSSYGAL ACIYFIILFI
1210 1220 1230 1240 1250
CGNYILLNVF LAIAVDNLAD ADSLSEVEKE EEPHDESAQK KSHSPTPTID
1260 1270 1280 1290 1300
GMDDHLSIDI DMEQQELDDE DKMDHETLSD EEVREMCEEE EEVDEEGMIT
1310 1320 1330 1340 1350
ARPRRMSEVN TATKILPIPP GTSFFLFSQT NRFRVFCHWL CNHSNFGNII
1360 1370 1380 1390 1400
LCCIMFSSAM LAAENPLRAN DDLNKVLNKF DYFFTAVFTI ELILKLISYG
1410 1420 1430 1440 1450
FVLHDGAFCR SAFNLLDLLV VCVSLISLVS SSNAISVVKI LRVLRVLRPL
1460 1470 1480 1490 1500
RAINRAKGLK HVVQCVIVAV KTIGNIVLVT CLLQFMFAVI GVQLFKGKFF
1510 1520 1530 1540 1550
KCTDGSKMTQ DECYGTYLVY DDGDVHKPRL REREWSNNRF HFDDVAKGML
1560 1570 1580 1590 1600
TLFTVSTFEG WPGLLYVSID SNKENGGPIH NFRPIVAAYY IIYIIIIAFF
1610 1620 1630 1640 1650
MVNIFVGFVI VTFQNEGEQE YKNCDLDKNQ RNCIEFALKA KPVRRYIPKH
1660 1670 1680 1690 1700
GIQYKVWWFV TSSSFEYTIF ILIMINTVTL AMKFYNQPLW YTELLDALNM
1710 1720 1730 1740 1750
IFTAVFALEF VFKLAAFRFK NYFGDAWNVF DFIIVLGSFI DIVYSEIKSK
1760 1770 1780 1790 1800
DTSQIAECDI VEGCKSTKKS AGSNLISINF FRLFRVMRLV KLLSKGEGIR
1810 1820 1830 1840 1850
TLLWTFIKSF QALPYVALLI VLLFFIYAVV GMQVFGKIAL DGGNAITANN
1860 1870 1880 1890 1900
NFQTFQQAVL VLFRSATGEA WQEIMMSCSA QPDVKCDMNS DTPGEPCGSS
1910 1920 1930 1940 1950
IAYPYFISFY VLCSFLIINL FVAVIMDNFD YLTRDWSILG PHHLDEFIRL
1960 1970 1980 1990 2000
WSEYDPDAKG RIKHLDVVTL LRKISPPLGF GKLCPHRMAC KRLVSMNMPL
2010 2020 2030 2040 2050
NSDGTVLFNA TLFAVVRTSL SIKTDGNIDD ANSELRATIK QIWKRTNPKL
2060 2070 2080 2090 2100
LDQVVPPPGN DDEVTVGKFY ATYLIQDYFR RFKKRKEQEG KEGHPDSNTV
2110 2120 2130 2140 2150
TLQAGLRTLH EVSPALKRAI SGNLDELDQE PEPMHRRHHT LFGSVWSSIR
2160 2170 2180 2190 2200
RHGNGTFRRS AKATASQSNG ALAIGGSASA ALGVGGSSLV LGSSDPAGGD
2210 2220 2230 2240 2250
YLYDTLNRSV ADGVNNITRN IMQARLAAAG KLQDELQGAG SGGELRTFGE
2260 2270 2280 2290 2300
SISMRPLAKN GGGAATVAGT LPPEANAINY DNRNRGILLH PYNNVYAPNG
2310 2320 2330 2340 2350
ALPGHERMIQ STPASPYDQR RLPTSSDMNG LAESLIGGVL AAEGLGKYCD
2360 2370 2380 2390 2400
SEFVGTAARE MREALDMTPE EMNLAAHQIL SNEHSLSLIG SSNGSIFGGS
2410 2420 2430 2440 2450
AGGLGGAGSG GVGGLGGSSS IRNAFGGSGS GPSSLSPQHQ PYSGTLNSPP
2460 2470 2480 2490 2500
IPDNRLRRVA TVTTTNNNNK SQVSQNNSNS LNVRANANSQ MNMSPTGQPV
2510
QQQSPLRGQG NQTYSS
Length:2,516
Mass (Da):276,700
Last modified:June 20, 2003 - v2
Checksum:i8CFC07499E750901
GO
Isoform B (identifier: Q24270-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1293-1329: VDEEGMITAR...PGTSFFLFSQ → DSNSEVSARV...RGSAFFIFSY

Note: No experimental confirmation available.

Show »
Length:2,519
Mass (Da):277,108
Checksum:iCA1E9A0374D8E955
GO
Isoform C (identifier: Q24270-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1496-1496: K → KYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFK

Note: No experimental confirmation available.

Show »
Length:2,552
Mass (Da):280,745
Checksum:i6C623BE5BE1B38E5
GO
Isoform D (identifier: Q24270-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2282-2300: NRNRGILLHPYNNVYAPNG → LRTQWCSSWPRTHDPIDTS
     2301-2516: Missing.

Note: No experimental confirmation available.

Show »
Length:2,300
Mass (Da):254,650
Checksum:i7F3C7A054B90EF1A
GO

Sequence cautioni

The sequence AAL13497.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1341P → A in AAA81883. (PubMed:7869089)Curated
Sequence conflicti282 – 2821F → L in AAA81883. (PubMed:7869089)Curated
Sequence conflicti678 – 6781N → D in AAA81883. (PubMed:7869089)Curated
Sequence conflicti683 – 6831R → G in AAA81883. (PubMed:7869089)Curated
Sequence conflicti696 – 6961I → M in AAA81883. (PubMed:7869089)Curated
Sequence conflicti1390 – 13901I → M in AAA81883. (PubMed:7869089)Curated
Sequence conflicti1433 – 14331N → D in AAA81883. (PubMed:7869089)Curated
Sequence conflicti2479 – 24791N → S in AAA81883. (PubMed:7869089)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1293 – 132937VDEEG…FLFSQ → DSNSEVSARVTARPRRLSEV SMKKTKKPIPRGSAFFIFSY in isoform B. CuratedVSP_017568Add
BLAST
Alternative sequencei1496 – 14961K → KYVVKCVVVAIKTIGNIMLV TYLLQFMFAVIGVQLFK in isoform C. CuratedVSP_017569
Alternative sequencei2282 – 230019NRNRG…YAPNG → LRTQWCSSWPRTHDPIDTS in isoform D. 1 PublicationVSP_007604Add
BLAST
Alternative sequencei2301 – 2516216Missing in isoform D. 1 PublicationVSP_007605Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U00690 mRNA. Translation: AAA81883.1.
AE014134 Genomic DNA. Translation: AAF53504.1.
AE014134 Genomic DNA. Translation: AAN10929.1.
AE014134 Genomic DNA. Translation: AAN10930.1.
AE014134 Genomic DNA. Translation: AAN10931.1.
AY058268 mRNA. Translation: AAL13497.1. Different initiation.
RefSeqiNP_525104.2. NM_080365.3. [Q24270-3]
NP_602305.1. NM_134429.3. [Q24270-1]
NP_723952.1. NM_165146.2. [Q24270-4]
NP_723953.1. NM_165147.2. [Q24270-2]
UniGeneiDm.4099.

Genome annotation databases

EnsemblMetazoaiFBtr0090006; FBpp0089049; FBgn0001991. [Q24270-1]
GeneIDi34950.
KEGGidme:Dmel_CG4894.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U00690 mRNA. Translation: AAA81883.1 .
AE014134 Genomic DNA. Translation: AAF53504.1 .
AE014134 Genomic DNA. Translation: AAN10929.1 .
AE014134 Genomic DNA. Translation: AAN10930.1 .
AE014134 Genomic DNA. Translation: AAN10931.1 .
AY058268 mRNA. Translation: AAL13497.1 . Different initiation.
RefSeqi NP_525104.2. NM_080365.3. [Q24270-3 ]
NP_602305.1. NM_134429.3. [Q24270-1 ]
NP_723952.1. NM_165146.2. [Q24270-4 ]
NP_723953.1. NM_165147.2. [Q24270-2 ]
UniGenei Dm.4099.

3D structure databases

ProteinModelPortali Q24270.
SMRi Q24270. Positions 617-920, 982-1216, 1346-1610, 1665-1927, 2010-2088.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 60962. 1 interaction.
IntActi Q24270. 1 interaction.

Proteomic databases

PaxDbi Q24270.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0090006 ; FBpp0089049 ; FBgn0001991 . [Q24270-1 ]
GeneIDi 34950.
KEGGi dme:Dmel_CG4894.

Organism-specific databases

CTDi 34950.
FlyBasei FBgn0001991. Ca-alpha1D.

Phylogenomic databases

eggNOGi COG1226.
GeneTreei ENSGT00760000118827.
InParanoidi Q24270.
KOi K05315.
OMAi LCIRIVE.
OrthoDBi EOG7T1RBQ.
PhylomeDBi Q24270.

Miscellaneous databases

ChiTaRSi Ca-alpha1D. drosophila.
GenomeRNAii 34950.
NextBioi 791045.
PROi Q24270.

Gene expression databases

Bgeei Q24270.
ExpressionAtlasi Q24270. differential.

Family and domain databases

Gene3Di 1.20.120.350. 5 hits.
InterProi IPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view ]
Pfami PF08763. Ca_chan_IQ. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view ]
PRINTSi PR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
SMARTi SM01062. Ca_chan_IQ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a calcium channel alpha 1 subunit from Drosophila melanogaster with similarity to the rat brain type D isoform."
    Zheng W., Feng G., Ren D., Eberl D.F., Hannan F., Dubald M., Hall L.M.
    J. Neurosci. 15:1132-1143(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, ALTERNATIVE SPLICING.
    Strain: Canton-S.
    Tissue: Head.
  2. "An exploration of the sequence of a 2.9-Mb region of the genome of Drosophila melanogaster: the Adh region."
    Ashburner M., Misra S., Roote J., Lewis S.E., Blazej R.G., Davis T., Doyle C., Galle R.F., George R.A., Harris N.L., Hartzell G., Harvey D.A., Hong L., Houston K.A., Hoskins R.A., Johnson G., Martin C., Moshrefi A.R.
    , Palazzolo M., Reese M.G., Spradling A.C., Tsang G., Wan K.H., Whitelaw K., Celniker S.E., Rubin G.M.
    Genetics 153:179-219(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1895-2300 (ISOFORM D).
    Strain: Berkeley.
    Tissue: Head.
  6. "A mutation affecting dihydropyridine-sensitive current levels and activation kinetics in Drosophila muscle and mammalian heart calcium channels."
    Ren D., Xu H., Eberl D.F., Chopra M., Hall L.M.
    J. Neurosci. 18:2335-2341(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS OF CYS-629.
  7. "Genetic and developmental characterization of Dmca1D, a calcium channel alpha-1 subunit gene in Drosophila melanogaster."
    Eberl D.F., Ren D., Feng G., Lorenz L.J., van Vactor D., Hall L.M.
    Genetics 148:1159-1169(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS OF CYS-629.

Entry informationi

Entry nameiCAC1D_DROME
AccessioniPrimary (citable) accession number: Q24270
Secondary accession number(s): Q8IP23
, Q8IP24, Q8IP25, Q95U73, Q9V3P7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 20, 2003
Last modified: October 29, 2014
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3