Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q24270

- CAC1D_DROME

UniProt

Q24270 - CAC1D_DROME

Protein

Voltage-dependent calcium channel type D subunit alpha-1

Gene

Ca-alpha1D

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (20 Jun 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei836 – 8361Calcium ion selectivity and permeabilityBy similarity
    Sitei1168 – 11681Calcium ion selectivity and permeabilityBy similarity
    Sitei1559 – 15591Calcium ion selectivity and permeabilityBy similarity
    Sitei1869 – 18691Calcium ion selectivity and permeabilityBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi1957 – 196812By similarityAdd
    BLAST

    GO - Molecular functioni

    1. high voltage-gated calcium channel activity Source: RefGenome
    2. metal ion binding Source: UniProtKB-KW
    3. voltage-gated calcium channel activity Source: FlyBase

    GO - Biological processi

    1. calcium ion import Source: RefGenome
    2. calcium ion transport Source: FlyBase
    3. epithelial fluid transport Source: FlyBase
    4. membrane depolarization during action potential Source: RefGenome
    5. muscle contraction Source: FlyBase

    Keywords - Molecular functioni

    Calcium channel, Ion channel, Voltage-gated channel

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    Calcium, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Voltage-dependent calcium channel type D subunit alpha-1
    Short name:
    DmCa1D
    Gene namesi
    Name:Ca-alpha1D
    Synonyms:DroCa1, l(2)35Fa
    ORF Names:CG4894
    OrganismiDrosophila melanogaster (Fruit fly)
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome 2L

    Organism-specific databases

    FlyBaseiFBgn0001991. Ca-alpha1D.

    Subcellular locationi

    GO - Cellular componenti

    1. apical plasma membrane Source: FlyBase
    2. basolateral plasma membrane Source: FlyBase
    3. voltage-gated calcium channel complex Source: FlyBase

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi629 – 6291C → Y in AR66; slower channel activation and reduction of peak current. 2 Publications

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 25162516Voltage-dependent calcium channel type D subunit alpha-1PRO_0000053960Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi644 – 6441N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi647 – 6471N-linked (GlcNAc...)Sequence Analysis
    Modified residuei1937 – 19371Phosphoserine; by PKASequence Analysis

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ24270.

    Expressioni

    Tissue specificityi

    Expressed in the adult body, head and leg. Highly expressed in the embryonic nervous system.

    Developmental stagei

    Faintly expressed in embryos at 9-12 hours. Expression increases rapidly as the nervous system matures, peaking just prior to hatching. A second peak is observed in late pupal stages around 73-108 hours postpuparium.

    Gene expression databases

    BgeeiQ24270.

    Interactioni

    Protein-protein interaction databases

    BioGridi60962. 1 interaction.
    IntActiQ24270. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ24270.
    SMRiQ24270. Positions 617-877, 892-920, 982-1216, 1346-1610, 1665-1927, 2010-2088.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 615615CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini635 – 65319ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini672 – 68413CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini700 – 71112ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini731 – 75020CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini771 – 85383ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini879 – 985107CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1006 – 101813ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1039 – 10479CytoplasmicSequence Analysis
    Topological domaini1067 – 107610ExtracellularSequence Analysis
    Topological domaini1096 – 111419CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1135 – 119056ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1216 – 1339124CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1364 – 138017ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1401 – 14088CytoplasmicSequence Analysis
    Topological domaini1432 – 14398ExtracellularSequence Analysis
    Topological domaini1455 – 147521CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1496 – 158489ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1610 – 166455CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1684 – 169714ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1718 – 17269CytoplasmicSequence Analysis
    Topological domaini1746 – 177732ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1797 – 181519CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1836 – 190267ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1922 – 2516595CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei616 – 63419Helical; Name=S1 of repeat ISequence AnalysisAdd
    BLAST
    Transmembranei654 – 67118Helical; Name=S2 of repeat ISequence AnalysisAdd
    BLAST
    Transmembranei685 – 69915Helical; Name=S3 of repeat ISequence AnalysisAdd
    BLAST
    Transmembranei712 – 73019Helical; Name=S4 of repeat ISequence AnalysisAdd
    BLAST
    Transmembranei751 – 77020Helical; Name=S5 of repeat ISequence AnalysisAdd
    BLAST
    Transmembranei854 – 87825Helical; Name=S6 of repeat ISequence AnalysisAdd
    BLAST
    Transmembranei986 – 100520Helical; Name=S1 of repeat IISequence AnalysisAdd
    BLAST
    Transmembranei1019 – 103820Helical; Name=S2 of repeat IISequence AnalysisAdd
    BLAST
    Transmembranei1048 – 106619Helical; Name=S3 of repeat IISequence AnalysisAdd
    BLAST
    Transmembranei1077 – 109519Helical; Name=S4 of repeat IISequence AnalysisAdd
    BLAST
    Transmembranei1115 – 113420Helical; Name=S5 of repeat IISequence AnalysisAdd
    BLAST
    Transmembranei1191 – 121525Helical; Name=S6 of repeat IISequence AnalysisAdd
    BLAST
    Transmembranei1340 – 136324Helical; Name=S1 of repeat IIISequence AnalysisAdd
    BLAST
    Transmembranei1381 – 140020Helical; Name=S2 of repeat IIISequence AnalysisAdd
    BLAST
    Transmembranei1409 – 143123Helical; Name=S3 of repeat IIISequence AnalysisAdd
    BLAST
    Transmembranei1440 – 145415Helical; Name=S4 of repeat IIISequence AnalysisAdd
    BLAST
    Transmembranei1476 – 149520Helical; Name=S5 of repeat IIISequence AnalysisAdd
    BLAST
    Transmembranei1585 – 160925Helical; Name=S6 of repeat IIISequence AnalysisAdd
    BLAST
    Transmembranei1665 – 168319Helical; Name=S1 of repeat IVSequence AnalysisAdd
    BLAST
    Transmembranei1698 – 171720Helical; Name=S2 of repeat IVSequence AnalysisAdd
    BLAST
    Transmembranei1727 – 174519Helical; Name=S3 of repeat IVSequence AnalysisAdd
    BLAST
    Transmembranei1778 – 179619Helical; Name=S4 of repeat IVSequence AnalysisAdd
    BLAST
    Transmembranei1816 – 183520Helical; Name=S5 of repeat IVSequence AnalysisAdd
    BLAST
    Transmembranei1903 – 192119Helical; Name=S6 of repeat IVSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati602 – 883282IAdd
    BLAST
    Repeati971 – 1217247IIAdd
    BLAST
    Repeati1331 – 1613283IIIAdd
    BLAST
    Repeati1648 – 1929282IVAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1533 – 162290Dihydropyridine bindingBy similarityAdd
    BLAST
    Regioni1885 – 194864Dihydropyridine bindingBy similarityAdd
    BLAST
    Regioni1896 – 193742Phenylalkylamine bindingBy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi59 – 624Poly-Val
    Compositional biasi208 – 2114Poly-Gly
    Compositional biasi262 – 2676Poly-Ser
    Compositional biasi322 – 3287Poly-Ala
    Compositional biasi460 – 4634Poly-Glu
    Compositional biasi1115 – 11217Poly-Leu
    Compositional biasi1288 – 12925Poly-Glu
    Compositional biasi1591 – 15977Poly-Ile
    Compositional biasi2466 – 24694Poly-Asn

    Domaini

    Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

    Sequence similaritiesi

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1226.
    GeneTreeiENSGT00750000117407.
    InParanoidiQ24270.
    KOiK05315.
    OMAiLCIRIVE.
    OrthoDBiEOG7T1RBQ.
    PhylomeDBiQ24270.

    Family and domain databases

    Gene3Di1.20.120.350. 5 hits.
    InterProiIPR027359. Channel_four-helix_dom.
    IPR005821. Ion_trans_dom.
    IPR014873. VDCC_a1su_IQ.
    IPR005446. VDCC_L_a1su.
    IPR002077. VDCCAlpha1.
    [Graphical view]
    PfamiPF08763. Ca_chan_IQ. 1 hit.
    PF00520. Ion_trans. 4 hits.
    [Graphical view]
    PRINTSiPR00167. CACHANNEL.
    PR01630. LVDCCALPHA1.
    SMARTiSM01062. Ca_chan_IQ. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform A (identifier: Q24270-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGGGELVNCI AYDDNTLVIE RKPSPSSPST SRRYLKAETP TRGSRKYNRK     50
    SSAKSDLEVV VVKPEHHHQH RSPTITLPVP ANPLTTSASA GSSPTGAGLA 100
    AGLGTASGTV LQQSCSALDP PEDSNQPSGT RRRPTSTELA LSNVTSQIVN 150
    NATYKLDFKQ RRHKSNNGGS ESGSLTGIAT GPATSPAGPT GPTSSSGKRR 200
    KSSCTSCGGG GISAPPPRLT PEEAWQLQPQ NSVTSAGSTN SSFSSGGGRD 250
    DNSSYSAVGG DSSSSNSCNC DITGDNSTLH GFGVGDVCSF IADCDDNSED 300
    DDGDPNNQDL SSQTLRTAAI VAAVAAAAKE QAQEQSLADC ESFSDRRQDA 350
    DEDVRIIQDC CGGNNDSLED VGEVDDNADV VVRKNSRNRP SIRRTCRITE 400
    EDDDEDENAD YGDFDREDQE LDDEEPEGTT IDIDEQEQQH DQGDSAEEED 450
    DDEDVDEYFE EEEDDTQAFS PFYSSSAELI DNFGGGAGKF FNIMDFERGA 500
    SGEGGFSPNG NGGPGSGDVS RTARYDSGEG DLGGGNNIMG IDSMGIANIP 550
    ETMNGTTIGP SGAGGQKGGA AAGAAGQKRQ QRRGKPQPDR PQRALFCLSV 600
    KNPLRALCIR IVEWKPFEFL ILLTIFANCI ALAVYTPYPG SDSNVTNQTL 650
    EKVEYVFLVI FTAECVMKIL AYGFVLHNGA YLRNGWNLLD FTIVVIGAIS 700
    TALSQLMKDA FDVKALRAFR VLRPLRLVSG VPSLQVVLNS ILKAMVPLFH 750
    IALLVLFVII IYAIIGLELF SGKLHKACRD EITGEYEENI RPCGVGYQCP 800
    PGYKCYGGWD GPNDGITNFD NFGLAMLTVF QCVTLEGWTD VLYSIQDAMG 850
    SDWQWMYFIS MVILGAFFVM NLILGVLSGE FSKERNKAKN RGDFQKLREK 900
    QQIEEDLRGY LDWITQAEDI EPDAVGGLIS DGKGKQPNEM DSTENLGEEM 950
    PEVQMTESRW RKMKKDFDRV NRRMRRACRK AVKSQAFYWL IIVLVFLNTG 1000
    VLATEHYGQL DWLDNFQEYT NVFFIGLFTC EMLLKMYSLG FQGYFVSLFN 1050
    RFDCFVVIGS ITETLLTNTG MMPPLGVSVL RCVRLLRVFK VTKYWRSLSN 1100
    LVASLLNSIQ SIASLLLLLF LFIVIFALLG MQVFGGKFNF DGKEEKYRMN 1150
    FDCFWQALLT VFQIMTGEDW NAVMYVGINA YGGVSSYGAL ACIYFIILFI 1200
    CGNYILLNVF LAIAVDNLAD ADSLSEVEKE EEPHDESAQK KSHSPTPTID 1250
    GMDDHLSIDI DMEQQELDDE DKMDHETLSD EEVREMCEEE EEVDEEGMIT 1300
    ARPRRMSEVN TATKILPIPP GTSFFLFSQT NRFRVFCHWL CNHSNFGNII 1350
    LCCIMFSSAM LAAENPLRAN DDLNKVLNKF DYFFTAVFTI ELILKLISYG 1400
    FVLHDGAFCR SAFNLLDLLV VCVSLISLVS SSNAISVVKI LRVLRVLRPL 1450
    RAINRAKGLK HVVQCVIVAV KTIGNIVLVT CLLQFMFAVI GVQLFKGKFF 1500
    KCTDGSKMTQ DECYGTYLVY DDGDVHKPRL REREWSNNRF HFDDVAKGML 1550
    TLFTVSTFEG WPGLLYVSID SNKENGGPIH NFRPIVAAYY IIYIIIIAFF 1600
    MVNIFVGFVI VTFQNEGEQE YKNCDLDKNQ RNCIEFALKA KPVRRYIPKH 1650
    GIQYKVWWFV TSSSFEYTIF ILIMINTVTL AMKFYNQPLW YTELLDALNM 1700
    IFTAVFALEF VFKLAAFRFK NYFGDAWNVF DFIIVLGSFI DIVYSEIKSK 1750
    DTSQIAECDI VEGCKSTKKS AGSNLISINF FRLFRVMRLV KLLSKGEGIR 1800
    TLLWTFIKSF QALPYVALLI VLLFFIYAVV GMQVFGKIAL DGGNAITANN 1850
    NFQTFQQAVL VLFRSATGEA WQEIMMSCSA QPDVKCDMNS DTPGEPCGSS 1900
    IAYPYFISFY VLCSFLIINL FVAVIMDNFD YLTRDWSILG PHHLDEFIRL 1950
    WSEYDPDAKG RIKHLDVVTL LRKISPPLGF GKLCPHRMAC KRLVSMNMPL 2000
    NSDGTVLFNA TLFAVVRTSL SIKTDGNIDD ANSELRATIK QIWKRTNPKL 2050
    LDQVVPPPGN DDEVTVGKFY ATYLIQDYFR RFKKRKEQEG KEGHPDSNTV 2100
    TLQAGLRTLH EVSPALKRAI SGNLDELDQE PEPMHRRHHT LFGSVWSSIR 2150
    RHGNGTFRRS AKATASQSNG ALAIGGSASA ALGVGGSSLV LGSSDPAGGD 2200
    YLYDTLNRSV ADGVNNITRN IMQARLAAAG KLQDELQGAG SGGELRTFGE 2250
    SISMRPLAKN GGGAATVAGT LPPEANAINY DNRNRGILLH PYNNVYAPNG 2300
    ALPGHERMIQ STPASPYDQR RLPTSSDMNG LAESLIGGVL AAEGLGKYCD 2350
    SEFVGTAARE MREALDMTPE EMNLAAHQIL SNEHSLSLIG SSNGSIFGGS 2400
    AGGLGGAGSG GVGGLGGSSS IRNAFGGSGS GPSSLSPQHQ PYSGTLNSPP 2450
    IPDNRLRRVA TVTTTNNNNK SQVSQNNSNS LNVRANANSQ MNMSPTGQPV 2500
    QQQSPLRGQG NQTYSS 2516
    Length:2,516
    Mass (Da):276,700
    Last modified:June 20, 2003 - v2
    Checksum:i8CFC07499E750901
    GO
    Isoform B (identifier: Q24270-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1293-1329: VDEEGMITAR...PGTSFFLFSQ → DSNSEVSARV...RGSAFFIFSY

    Note: No experimental confirmation available.

    Show »
    Length:2,519
    Mass (Da):277,108
    Checksum:iCA1E9A0374D8E955
    GO
    Isoform C (identifier: Q24270-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1496-1496: K → KYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFK

    Note: No experimental confirmation available.

    Show »
    Length:2,552
    Mass (Da):280,745
    Checksum:i6C623BE5BE1B38E5
    GO
    Isoform D (identifier: Q24270-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2282-2300: NRNRGILLHPYNNVYAPNG → LRTQWCSSWPRTHDPIDTS
         2301-2516: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:2,300
    Mass (Da):254,650
    Checksum:i7F3C7A054B90EF1A
    GO

    Sequence cautioni

    The sequence AAL13497.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti134 – 1341P → A in AAA81883. (PubMed:7869089)Curated
    Sequence conflicti282 – 2821F → L in AAA81883. (PubMed:7869089)Curated
    Sequence conflicti678 – 6781N → D in AAA81883. (PubMed:7869089)Curated
    Sequence conflicti683 – 6831R → G in AAA81883. (PubMed:7869089)Curated
    Sequence conflicti696 – 6961I → M in AAA81883. (PubMed:7869089)Curated
    Sequence conflicti1390 – 13901I → M in AAA81883. (PubMed:7869089)Curated
    Sequence conflicti1433 – 14331N → D in AAA81883. (PubMed:7869089)Curated
    Sequence conflicti2479 – 24791N → S in AAA81883. (PubMed:7869089)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1293 – 132937VDEEG…FLFSQ → DSNSEVSARVTARPRRLSEV SMKKTKKPIPRGSAFFIFSY in isoform B. CuratedVSP_017568Add
    BLAST
    Alternative sequencei1496 – 14961K → KYVVKCVVVAIKTIGNIMLV TYLLQFMFAVIGVQLFK in isoform C. CuratedVSP_017569
    Alternative sequencei2282 – 230019NRNRG…YAPNG → LRTQWCSSWPRTHDPIDTS in isoform D. 1 PublicationVSP_007604Add
    BLAST
    Alternative sequencei2301 – 2516216Missing in isoform D. 1 PublicationVSP_007605Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U00690 mRNA. Translation: AAA81883.1.
    AE014134 Genomic DNA. Translation: AAF53504.1.
    AE014134 Genomic DNA. Translation: AAN10929.1.
    AE014134 Genomic DNA. Translation: AAN10930.1.
    AE014134 Genomic DNA. Translation: AAN10931.1.
    AY058268 mRNA. Translation: AAL13497.1. Different initiation.
    RefSeqiNP_525104.2. NM_080365.3. [Q24270-3]
    NP_602305.1. NM_134429.3. [Q24270-1]
    NP_723952.1. NM_165146.2. [Q24270-4]
    NP_723953.1. NM_165147.2. [Q24270-2]
    UniGeneiDm.4099.

    Genome annotation databases

    EnsemblMetazoaiFBtr0090006; FBpp0089049; FBgn0001991. [Q24270-1]
    GeneIDi34950.
    KEGGidme:Dmel_CG4894.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U00690 mRNA. Translation: AAA81883.1 .
    AE014134 Genomic DNA. Translation: AAF53504.1 .
    AE014134 Genomic DNA. Translation: AAN10929.1 .
    AE014134 Genomic DNA. Translation: AAN10930.1 .
    AE014134 Genomic DNA. Translation: AAN10931.1 .
    AY058268 mRNA. Translation: AAL13497.1 . Different initiation.
    RefSeqi NP_525104.2. NM_080365.3. [Q24270-3 ]
    NP_602305.1. NM_134429.3. [Q24270-1 ]
    NP_723952.1. NM_165146.2. [Q24270-4 ]
    NP_723953.1. NM_165147.2. [Q24270-2 ]
    UniGenei Dm.4099.

    3D structure databases

    ProteinModelPortali Q24270.
    SMRi Q24270. Positions 617-877, 892-920, 982-1216, 1346-1610, 1665-1927, 2010-2088.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 60962. 1 interaction.
    IntActi Q24270. 1 interaction.

    Proteomic databases

    PaxDbi Q24270.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai FBtr0090006 ; FBpp0089049 ; FBgn0001991 . [Q24270-1 ]
    GeneIDi 34950.
    KEGGi dme:Dmel_CG4894.

    Organism-specific databases

    CTDi 34950.
    FlyBasei FBgn0001991. Ca-alpha1D.

    Phylogenomic databases

    eggNOGi COG1226.
    GeneTreei ENSGT00750000117407.
    InParanoidi Q24270.
    KOi K05315.
    OMAi LCIRIVE.
    OrthoDBi EOG7T1RBQ.
    PhylomeDBi Q24270.

    Miscellaneous databases

    ChiTaRSi Ca-alpha1D. drosophila.
    GenomeRNAii 34950.
    NextBioi 791045.
    PROi Q24270.

    Gene expression databases

    Bgeei Q24270.

    Family and domain databases

    Gene3Di 1.20.120.350. 5 hits.
    InterProi IPR027359. Channel_four-helix_dom.
    IPR005821. Ion_trans_dom.
    IPR014873. VDCC_a1su_IQ.
    IPR005446. VDCC_L_a1su.
    IPR002077. VDCCAlpha1.
    [Graphical view ]
    Pfami PF08763. Ca_chan_IQ. 1 hit.
    PF00520. Ion_trans. 4 hits.
    [Graphical view ]
    PRINTSi PR00167. CACHANNEL.
    PR01630. LVDCCALPHA1.
    SMARTi SM01062. Ca_chan_IQ. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a calcium channel alpha 1 subunit from Drosophila melanogaster with similarity to the rat brain type D isoform."
      Zheng W., Feng G., Ren D., Eberl D.F., Hannan F., Dubald M., Hall L.M.
      J. Neurosci. 15:1132-1143(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, ALTERNATIVE SPLICING.
      Strain: Canton-S.
      Tissue: Head.
    2. "An exploration of the sequence of a 2.9-Mb region of the genome of Drosophila melanogaster: the Adh region."
      Ashburner M., Misra S., Roote J., Lewis S.E., Blazej R.G., Davis T., Doyle C., Galle R.F., George R.A., Harris N.L., Hartzell G., Harvey D.A., Hong L., Houston K.A., Hoskins R.A., Johnson G., Martin C., Moshrefi A.R.
      , Palazzolo M., Reese M.G., Spradling A.C., Tsang G., Wan K.H., Whitelaw K., Celniker S.E., Rubin G.M.
      Genetics 153:179-219(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley.
    3. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley.
    4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
      Strain: Berkeley.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1895-2300 (ISOFORM D).
      Strain: Berkeley.
      Tissue: Head.
    6. "A mutation affecting dihydropyridine-sensitive current levels and activation kinetics in Drosophila muscle and mammalian heart calcium channels."
      Ren D., Xu H., Eberl D.F., Chopra M., Hall L.M.
      J. Neurosci. 18:2335-2341(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: MUTAGENESIS OF CYS-629.
    7. "Genetic and developmental characterization of Dmca1D, a calcium channel alpha-1 subunit gene in Drosophila melanogaster."
      Eberl D.F., Ren D., Feng G., Lorenz L.J., van Vactor D., Hall L.M.
      Genetics 148:1159-1169(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: MUTAGENESIS OF CYS-629.

    Entry informationi

    Entry nameiCAC1D_DROME
    AccessioniPrimary (citable) accession number: Q24270
    Secondary accession number(s): Q8IP23
    , Q8IP24, Q8IP25, Q95U73, Q9V3P7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: June 20, 2003
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3