Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q24270 (CAC1D_DROME) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 131. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Voltage-dependent calcium channel type D subunit alpha-1

Short name=DmCa1D
Gene names
Name:Ca-alpha1D
Synonyms:DroCa1, l(2)35Fa
ORF Names:CG4894
OrganismDrosophila melanogaster (Fruit fly) [Reference proteome]
Taxonomic identifier7227 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora

Protein attributes

Sequence length2516 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development. Ref.1

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Expressed in the adult body, head and leg. Highly expressed in the embryonic nervous system.

Developmental stage

Faintly expressed in embryos at 9-12 hours. Expression increases rapidly as the nervous system matures, peaking just prior to hatching. A second peak is observed in late pupal stages around 73-108 hours postpuparium.

Domain

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Sequence similarities

Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. [View classification]

Caution

It is uncertain whether Met-1, Met-494, Met-539, Met-544 or Met-553 is the initiator.

Sequence caution

The sequence AAL13497.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processCalcium transport
Ion transport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainRepeat
Transmembrane
Transmembrane helix
   LigandCalcium
Metal-binding
   Molecular functionCalcium channel
Ion channel
Voltage-gated channel
   PTMGlycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcalcium ion import

Inferred from Biological aspect of Ancestor. Source: RefGenome

calcium ion transport

Non-traceable author statement PubMed 10798390. Source: FlyBase

epithelial fluid transport

Inferred from direct assay PubMed 11208535. Source: FlyBase

membrane depolarization during action potential

Inferred from Biological aspect of Ancestor. Source: RefGenome

muscle contraction

Traceable author statement PubMed 10798390. Source: FlyBase

   Cellular_componentapical plasma membrane

Inferred from direct assay PubMed 11208535. Source: FlyBase

basolateral plasma membrane

Inferred from direct assay PubMed 11208535. Source: FlyBase

voltage-gated calcium channel complex

Inferred from sequence or structural similarity Ref.2. Source: FlyBase

   Molecular_functionhigh voltage-gated calcium channel activity

Inferred from Biological aspect of Ancestor. Source: RefGenome

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

voltage-gated calcium channel activity

Inferred from sequence or structural similarity Ref.2. Source: FlyBase

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform A (identifier: Q24270-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B (identifier: Q24270-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1293-1329: VDEEGMITAR...PGTSFFLFSQ → DSNSEVSARV...RGSAFFIFSY
Note: No experimental confirmation available.
Isoform C (identifier: Q24270-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1496-1496: K → KYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFK
Note: No experimental confirmation available.
Isoform D (identifier: Q24270-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2282-2300: NRNRGILLHPYNNVYAPNG → LRTQWCSSWPRTHDPIDTS
     2301-2516: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 25162516Voltage-dependent calcium channel type D subunit alpha-1
PRO_0000053960

Regions

Topological domain1 – 615615Cytoplasmic Potential
Transmembrane616 – 63419Helical; Name=S1 of repeat I; Potential
Topological domain635 – 65319Extracellular Potential
Transmembrane654 – 67118Helical; Name=S2 of repeat I; Potential
Topological domain672 – 68413Cytoplasmic Potential
Transmembrane685 – 69915Helical; Name=S3 of repeat I; Potential
Topological domain700 – 71112Extracellular Potential
Transmembrane712 – 73019Helical; Name=S4 of repeat I; Potential
Topological domain731 – 75020Cytoplasmic Potential
Transmembrane751 – 77020Helical; Name=S5 of repeat I; Potential
Topological domain771 – 85383Extracellular Potential
Transmembrane854 – 87825Helical; Name=S6 of repeat I; Potential
Topological domain879 – 985107Cytoplasmic Potential
Transmembrane986 – 100520Helical; Name=S1 of repeat II; Potential
Topological domain1006 – 101813Extracellular Potential
Transmembrane1019 – 103820Helical; Name=S2 of repeat II; Potential
Topological domain1039 – 10479Cytoplasmic Potential
Transmembrane1048 – 106619Helical; Name=S3 of repeat II; Potential
Topological domain1067 – 107610Extracellular Potential
Transmembrane1077 – 109519Helical; Name=S4 of repeat II; Potential
Topological domain1096 – 111419Cytoplasmic Potential
Transmembrane1115 – 113420Helical; Name=S5 of repeat II; Potential
Topological domain1135 – 119056Extracellular Potential
Transmembrane1191 – 121525Helical; Name=S6 of repeat II; Potential
Topological domain1216 – 1339124Cytoplasmic Potential
Transmembrane1340 – 136324Helical; Name=S1 of repeat III; Potential
Topological domain1364 – 138017Extracellular Potential
Transmembrane1381 – 140020Helical; Name=S2 of repeat III; Potential
Topological domain1401 – 14088Cytoplasmic Potential
Transmembrane1409 – 143123Helical; Name=S3 of repeat III; Potential
Topological domain1432 – 14398Extracellular Potential
Transmembrane1440 – 145415Helical; Name=S4 of repeat III; Potential
Topological domain1455 – 147521Cytoplasmic Potential
Transmembrane1476 – 149520Helical; Name=S5 of repeat III; Potential
Topological domain1496 – 158489Extracellular Potential
Transmembrane1585 – 160925Helical; Name=S6 of repeat III; Potential
Topological domain1610 – 166455Cytoplasmic Potential
Transmembrane1665 – 168319Helical; Name=S1 of repeat IV; Potential
Topological domain1684 – 169714Extracellular Potential
Transmembrane1698 – 171720Helical; Name=S2 of repeat IV; Potential
Topological domain1718 – 17269Cytoplasmic Potential
Transmembrane1727 – 174519Helical; Name=S3 of repeat IV; Potential
Topological domain1746 – 177732Extracellular Potential
Transmembrane1778 – 179619Helical; Name=S4 of repeat IV; Potential
Topological domain1797 – 181519Cytoplasmic Potential
Transmembrane1816 – 183520Helical; Name=S5 of repeat IV; Potential
Topological domain1836 – 190267Extracellular Potential
Transmembrane1903 – 192119Helical; Name=S6 of repeat IV; Potential
Topological domain1922 – 2516595Cytoplasmic Potential
Repeat602 – 883282I
Repeat971 – 1217247II
Repeat1331 – 1613283III
Repeat1648 – 1929282IV
Calcium binding1957 – 196812 By similarity
Region1533 – 162290Dihydropyridine binding By similarity
Region1885 – 194864Dihydropyridine binding By similarity
Region1896 – 193742Phenylalkylamine binding By similarity
Compositional bias59 – 624Poly-Val
Compositional bias208 – 2114Poly-Gly
Compositional bias262 – 2676Poly-Ser
Compositional bias322 – 3287Poly-Ala
Compositional bias460 – 4634Poly-Glu
Compositional bias1115 – 11217Poly-Leu
Compositional bias1288 – 12925Poly-Glu
Compositional bias1591 – 15977Poly-Ile
Compositional bias2466 – 24694Poly-Asn

Sites

Site8361Calcium ion selectivity and permeability By similarity
Site11681Calcium ion selectivity and permeability By similarity
Site15591Calcium ion selectivity and permeability By similarity
Site18691Calcium ion selectivity and permeability By similarity

Amino acid modifications

Modified residue19371Phosphoserine; by PKA Potential
Glycosylation6441N-linked (GlcNAc...) Potential
Glycosylation6471N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1293 – 132937VDEEG…FLFSQ → DSNSEVSARVTARPRRLSEV SMKKTKKPIPRGSAFFIFSY in isoform B.
VSP_017568
Alternative sequence14961K → KYVVKCVVVAIKTIGNIMLV TYLLQFMFAVIGVQLFK in isoform C.
VSP_017569
Alternative sequence2282 – 230019NRNRG…YAPNG → LRTQWCSSWPRTHDPIDTS in isoform D.
VSP_007604
Alternative sequence2301 – 2516216Missing in isoform D.
VSP_007605

Experimental info

Mutagenesis6291C → Y in AR66; slower channel activation and reduction of peak current. Ref.6 Ref.7
Sequence conflict1341P → A in AAA81883. Ref.1
Sequence conflict2821F → L in AAA81883. Ref.1
Sequence conflict6781N → D in AAA81883. Ref.1
Sequence conflict6831R → G in AAA81883. Ref.1
Sequence conflict6961I → M in AAA81883. Ref.1
Sequence conflict13901I → M in AAA81883. Ref.1
Sequence conflict14331N → D in AAA81883. Ref.1
Sequence conflict24791N → S in AAA81883. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform A [UniParc].

Last modified June 20, 2003. Version 2.
Checksum: 8CFC07499E750901

FASTA2,516276,700
        10         20         30         40         50         60 
MGGGELVNCI AYDDNTLVIE RKPSPSSPST SRRYLKAETP TRGSRKYNRK SSAKSDLEVV 

        70         80         90        100        110        120 
VVKPEHHHQH RSPTITLPVP ANPLTTSASA GSSPTGAGLA AGLGTASGTV LQQSCSALDP 

       130        140        150        160        170        180 
PEDSNQPSGT RRRPTSTELA LSNVTSQIVN NATYKLDFKQ RRHKSNNGGS ESGSLTGIAT 

       190        200        210        220        230        240 
GPATSPAGPT GPTSSSGKRR KSSCTSCGGG GISAPPPRLT PEEAWQLQPQ NSVTSAGSTN 

       250        260        270        280        290        300 
SSFSSGGGRD DNSSYSAVGG DSSSSNSCNC DITGDNSTLH GFGVGDVCSF IADCDDNSED 

       310        320        330        340        350        360 
DDGDPNNQDL SSQTLRTAAI VAAVAAAAKE QAQEQSLADC ESFSDRRQDA DEDVRIIQDC 

       370        380        390        400        410        420 
CGGNNDSLED VGEVDDNADV VVRKNSRNRP SIRRTCRITE EDDDEDENAD YGDFDREDQE 

       430        440        450        460        470        480 
LDDEEPEGTT IDIDEQEQQH DQGDSAEEED DDEDVDEYFE EEEDDTQAFS PFYSSSAELI 

       490        500        510        520        530        540 
DNFGGGAGKF FNIMDFERGA SGEGGFSPNG NGGPGSGDVS RTARYDSGEG DLGGGNNIMG 

       550        560        570        580        590        600 
IDSMGIANIP ETMNGTTIGP SGAGGQKGGA AAGAAGQKRQ QRRGKPQPDR PQRALFCLSV 

       610        620        630        640        650        660 
KNPLRALCIR IVEWKPFEFL ILLTIFANCI ALAVYTPYPG SDSNVTNQTL EKVEYVFLVI 

       670        680        690        700        710        720 
FTAECVMKIL AYGFVLHNGA YLRNGWNLLD FTIVVIGAIS TALSQLMKDA FDVKALRAFR 

       730        740        750        760        770        780 
VLRPLRLVSG VPSLQVVLNS ILKAMVPLFH IALLVLFVII IYAIIGLELF SGKLHKACRD 

       790        800        810        820        830        840 
EITGEYEENI RPCGVGYQCP PGYKCYGGWD GPNDGITNFD NFGLAMLTVF QCVTLEGWTD 

       850        860        870        880        890        900 
VLYSIQDAMG SDWQWMYFIS MVILGAFFVM NLILGVLSGE FSKERNKAKN RGDFQKLREK 

       910        920        930        940        950        960 
QQIEEDLRGY LDWITQAEDI EPDAVGGLIS DGKGKQPNEM DSTENLGEEM PEVQMTESRW 

       970        980        990       1000       1010       1020 
RKMKKDFDRV NRRMRRACRK AVKSQAFYWL IIVLVFLNTG VLATEHYGQL DWLDNFQEYT 

      1030       1040       1050       1060       1070       1080 
NVFFIGLFTC EMLLKMYSLG FQGYFVSLFN RFDCFVVIGS ITETLLTNTG MMPPLGVSVL 

      1090       1100       1110       1120       1130       1140 
RCVRLLRVFK VTKYWRSLSN LVASLLNSIQ SIASLLLLLF LFIVIFALLG MQVFGGKFNF 

      1150       1160       1170       1180       1190       1200 
DGKEEKYRMN FDCFWQALLT VFQIMTGEDW NAVMYVGINA YGGVSSYGAL ACIYFIILFI 

      1210       1220       1230       1240       1250       1260 
CGNYILLNVF LAIAVDNLAD ADSLSEVEKE EEPHDESAQK KSHSPTPTID GMDDHLSIDI 

      1270       1280       1290       1300       1310       1320 
DMEQQELDDE DKMDHETLSD EEVREMCEEE EEVDEEGMIT ARPRRMSEVN TATKILPIPP 

      1330       1340       1350       1360       1370       1380 
GTSFFLFSQT NRFRVFCHWL CNHSNFGNII LCCIMFSSAM LAAENPLRAN DDLNKVLNKF 

      1390       1400       1410       1420       1430       1440 
DYFFTAVFTI ELILKLISYG FVLHDGAFCR SAFNLLDLLV VCVSLISLVS SSNAISVVKI 

      1450       1460       1470       1480       1490       1500 
LRVLRVLRPL RAINRAKGLK HVVQCVIVAV KTIGNIVLVT CLLQFMFAVI GVQLFKGKFF 

      1510       1520       1530       1540       1550       1560 
KCTDGSKMTQ DECYGTYLVY DDGDVHKPRL REREWSNNRF HFDDVAKGML TLFTVSTFEG 

      1570       1580       1590       1600       1610       1620 
WPGLLYVSID SNKENGGPIH NFRPIVAAYY IIYIIIIAFF MVNIFVGFVI VTFQNEGEQE 

      1630       1640       1650       1660       1670       1680 
YKNCDLDKNQ RNCIEFALKA KPVRRYIPKH GIQYKVWWFV TSSSFEYTIF ILIMINTVTL 

      1690       1700       1710       1720       1730       1740 
AMKFYNQPLW YTELLDALNM IFTAVFALEF VFKLAAFRFK NYFGDAWNVF DFIIVLGSFI 

      1750       1760       1770       1780       1790       1800 
DIVYSEIKSK DTSQIAECDI VEGCKSTKKS AGSNLISINF FRLFRVMRLV KLLSKGEGIR 

      1810       1820       1830       1840       1850       1860 
TLLWTFIKSF QALPYVALLI VLLFFIYAVV GMQVFGKIAL DGGNAITANN NFQTFQQAVL 

      1870       1880       1890       1900       1910       1920 
VLFRSATGEA WQEIMMSCSA QPDVKCDMNS DTPGEPCGSS IAYPYFISFY VLCSFLIINL 

      1930       1940       1950       1960       1970       1980 
FVAVIMDNFD YLTRDWSILG PHHLDEFIRL WSEYDPDAKG RIKHLDVVTL LRKISPPLGF 

      1990       2000       2010       2020       2030       2040 
GKLCPHRMAC KRLVSMNMPL NSDGTVLFNA TLFAVVRTSL SIKTDGNIDD ANSELRATIK 

      2050       2060       2070       2080       2090       2100 
QIWKRTNPKL LDQVVPPPGN DDEVTVGKFY ATYLIQDYFR RFKKRKEQEG KEGHPDSNTV 

      2110       2120       2130       2140       2150       2160 
TLQAGLRTLH EVSPALKRAI SGNLDELDQE PEPMHRRHHT LFGSVWSSIR RHGNGTFRRS 

      2170       2180       2190       2200       2210       2220 
AKATASQSNG ALAIGGSASA ALGVGGSSLV LGSSDPAGGD YLYDTLNRSV ADGVNNITRN 

      2230       2240       2250       2260       2270       2280 
IMQARLAAAG KLQDELQGAG SGGELRTFGE SISMRPLAKN GGGAATVAGT LPPEANAINY 

      2290       2300       2310       2320       2330       2340 
DNRNRGILLH PYNNVYAPNG ALPGHERMIQ STPASPYDQR RLPTSSDMNG LAESLIGGVL 

      2350       2360       2370       2380       2390       2400 
AAEGLGKYCD SEFVGTAARE MREALDMTPE EMNLAAHQIL SNEHSLSLIG SSNGSIFGGS 

      2410       2420       2430       2440       2450       2460 
AGGLGGAGSG GVGGLGGSSS IRNAFGGSGS GPSSLSPQHQ PYSGTLNSPP IPDNRLRRVA 

      2470       2480       2490       2500       2510 
TVTTTNNNNK SQVSQNNSNS LNVRANANSQ MNMSPTGQPV QQQSPLRGQG NQTYSS 

« Hide

Isoform B [UniParc].

Checksum: CA1E9A0374D8E955
Show »

FASTA2,519277,108
Isoform C [UniParc].

Checksum: 6C623BE5BE1B38E5
Show »

FASTA2,552280,745
Isoform D [UniParc].

Checksum: 7F3C7A054B90EF1A
Show »

FASTA2,300254,650

References

« Hide 'large scale' references
[1]"Cloning and characterization of a calcium channel alpha 1 subunit from Drosophila melanogaster with similarity to the rat brain type D isoform."
Zheng W., Feng G., Ren D., Eberl D.F., Hannan F., Dubald M., Hall L.M.
J. Neurosci. 15:1132-1143(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, ALTERNATIVE SPLICING.
Strain: Canton-S.
Tissue: Head.
[2]"An exploration of the sequence of a 2.9-Mb region of the genome of Drosophila melanogaster: the Adh region."
Ashburner M., Misra S., Roote J., Lewis S.E., Blazej R.G., Davis T., Doyle C., Galle R.F., George R.A., Harris N.L., Hartzell G., Harvey D.A., Hong L., Houston K.A., Hoskins R.A., Johnson G., Martin C., Moshrefi A.R. expand/collapse author list , Palazzolo M., Reese M.G., Spradling A.C., Tsang G., Wan K.H., Whitelaw K., Celniker S.E., Rubin G.M.
Genetics 153:179-219(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Berkeley.
[3]"The genome sequence of Drosophila melanogaster."
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. expand/collapse author list , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Berkeley.
[4]"Annotation of the Drosophila melanogaster euchromatic genome: a systematic review."
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. expand/collapse author list , Drysdale R.A., Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q., Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M., Lewis S.E.
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
Strain: Berkeley.
[5]"A Drosophila full-length cDNA resource."
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E.
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1895-2300 (ISOFORM D).
Strain: Berkeley.
Tissue: Head.
[6]"A mutation affecting dihydropyridine-sensitive current levels and activation kinetics in Drosophila muscle and mammalian heart calcium channels."
Ren D., Xu H., Eberl D.F., Chopra M., Hall L.M.
J. Neurosci. 18:2335-2341(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: MUTAGENESIS OF CYS-629.
[7]"Genetic and developmental characterization of Dmca1D, a calcium channel alpha-1 subunit gene in Drosophila melanogaster."
Eberl D.F., Ren D., Feng G., Lorenz L.J., van Vactor D., Hall L.M.
Genetics 148:1159-1169(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: MUTAGENESIS OF CYS-629.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U00690 mRNA. Translation: AAA81883.1.
AE014134 Genomic DNA. Translation: AAF53504.1.
AE014134 Genomic DNA. Translation: AAN10929.1.
AE014134 Genomic DNA. Translation: AAN10930.1.
AE014134 Genomic DNA. Translation: AAN10931.1.
AY058268 mRNA. Translation: AAL13497.1. Different initiation.
RefSeqNP_525104.2. NM_080365.3. [Q24270-3]
NP_602305.1. NM_134429.3. [Q24270-1]
NP_723952.1. NM_165146.2. [Q24270-4]
NP_723953.1. NM_165147.2. [Q24270-2]
UniGeneDm.4099.

3D structure databases

ProteinModelPortalQ24270.
SMRQ24270. Positions 617-877, 892-920, 982-1216, 1346-1610, 1665-1927, 2010-2088.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid60962. 1 interaction.
IntActQ24270. 1 interaction.

Proteomic databases

PaxDbQ24270.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaFBtr0090006; FBpp0089049; FBgn0001991. [Q24270-1]
GeneID34950.
KEGGdme:Dmel_CG4894.

Organism-specific databases

CTD34950.
FlyBaseFBgn0001991. Ca-alpha1D.

Phylogenomic databases

eggNOGCOG1226.
GeneTreeENSGT00750000117407.
InParanoidQ24270.
KOK05315.
OMALCIRIVE.
OrthoDBEOG7T1RBQ.
PhylomeDBQ24270.

Gene expression databases

BgeeQ24270.

Family and domain databases

Gene3D1.20.120.350. 5 hits.
InterProIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamPF08763. Ca_chan_IQ. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
SMARTSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCa-alpha1D. drosophila.
GenomeRNAi34950.
NextBio791045.
PROQ24270.

Entry information

Entry nameCAC1D_DROME
AccessionPrimary (citable) accession number: Q24270
Secondary accession number(s): Q8IP23 expand/collapse secondary AC list , Q8IP24, Q8IP25, Q95U73, Q9V3P7
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 20, 2003
Last modified: July 9, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Drosophila

Drosophila: entries, gene names and cross-references to FlyBase