Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent calcium channel type D subunit alpha-1

Gene

Ca-alpha1D

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei836Calcium ion selectivity and permeabilityBy similarity1
Sitei1168Calcium ion selectivity and permeabilityBy similarity1
Sitei1559Calcium ion selectivity and permeabilityBy similarity1
Sitei1869Calcium ion selectivity and permeabilityBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi1957 – 1968By similarityAdd BLAST12

GO - Molecular functioni

GO - Biological processi

  • calcium ion transport Source: FlyBase
  • epithelial fluid transport Source: FlyBase
  • membrane depolarization during action potential Source: GO_Central
  • muscle contraction Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent calcium channel type D subunit alpha-1
Short name:
DmCa1D
Gene namesi
Name:Ca-alpha1D
Synonyms:DroCa1, l(2)35Fa
ORF Names:CG4894
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2L

Organism-specific databases

FlyBaseiFBgn0001991. Ca-alpha1D.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 615CytoplasmicSequence analysisAdd BLAST615
Transmembranei616 – 634Helical; Name=S1 of repeat ISequence analysisAdd BLAST19
Topological domaini635 – 653ExtracellularSequence analysisAdd BLAST19
Transmembranei654 – 671Helical; Name=S2 of repeat ISequence analysisAdd BLAST18
Topological domaini672 – 684CytoplasmicSequence analysisAdd BLAST13
Transmembranei685 – 699Helical; Name=S3 of repeat ISequence analysisAdd BLAST15
Topological domaini700 – 711ExtracellularSequence analysisAdd BLAST12
Transmembranei712 – 730Helical; Name=S4 of repeat ISequence analysisAdd BLAST19
Topological domaini731 – 750CytoplasmicSequence analysisAdd BLAST20
Transmembranei751 – 770Helical; Name=S5 of repeat ISequence analysisAdd BLAST20
Topological domaini771 – 853ExtracellularSequence analysisAdd BLAST83
Transmembranei854 – 878Helical; Name=S6 of repeat ISequence analysisAdd BLAST25
Topological domaini879 – 985CytoplasmicSequence analysisAdd BLAST107
Transmembranei986 – 1005Helical; Name=S1 of repeat IISequence analysisAdd BLAST20
Topological domaini1006 – 1018ExtracellularSequence analysisAdd BLAST13
Transmembranei1019 – 1038Helical; Name=S2 of repeat IISequence analysisAdd BLAST20
Topological domaini1039 – 1047CytoplasmicSequence analysis9
Transmembranei1048 – 1066Helical; Name=S3 of repeat IISequence analysisAdd BLAST19
Topological domaini1067 – 1076ExtracellularSequence analysis10
Transmembranei1077 – 1095Helical; Name=S4 of repeat IISequence analysisAdd BLAST19
Topological domaini1096 – 1114CytoplasmicSequence analysisAdd BLAST19
Transmembranei1115 – 1134Helical; Name=S5 of repeat IISequence analysisAdd BLAST20
Topological domaini1135 – 1190ExtracellularSequence analysisAdd BLAST56
Transmembranei1191 – 1215Helical; Name=S6 of repeat IISequence analysisAdd BLAST25
Topological domaini1216 – 1339CytoplasmicSequence analysisAdd BLAST124
Transmembranei1340 – 1363Helical; Name=S1 of repeat IIISequence analysisAdd BLAST24
Topological domaini1364 – 1380ExtracellularSequence analysisAdd BLAST17
Transmembranei1381 – 1400Helical; Name=S2 of repeat IIISequence analysisAdd BLAST20
Topological domaini1401 – 1408CytoplasmicSequence analysis8
Transmembranei1409 – 1431Helical; Name=S3 of repeat IIISequence analysisAdd BLAST23
Topological domaini1432 – 1439ExtracellularSequence analysis8
Transmembranei1440 – 1454Helical; Name=S4 of repeat IIISequence analysisAdd BLAST15
Topological domaini1455 – 1475CytoplasmicSequence analysisAdd BLAST21
Transmembranei1476 – 1495Helical; Name=S5 of repeat IIISequence analysisAdd BLAST20
Topological domaini1496 – 1584ExtracellularSequence analysisAdd BLAST89
Transmembranei1585 – 1609Helical; Name=S6 of repeat IIISequence analysisAdd BLAST25
Topological domaini1610 – 1664CytoplasmicSequence analysisAdd BLAST55
Transmembranei1665 – 1683Helical; Name=S1 of repeat IVSequence analysisAdd BLAST19
Topological domaini1684 – 1697ExtracellularSequence analysisAdd BLAST14
Transmembranei1698 – 1717Helical; Name=S2 of repeat IVSequence analysisAdd BLAST20
Topological domaini1718 – 1726CytoplasmicSequence analysis9
Transmembranei1727 – 1745Helical; Name=S3 of repeat IVSequence analysisAdd BLAST19
Topological domaini1746 – 1777ExtracellularSequence analysisAdd BLAST32
Transmembranei1778 – 1796Helical; Name=S4 of repeat IVSequence analysisAdd BLAST19
Topological domaini1797 – 1815CytoplasmicSequence analysisAdd BLAST19
Transmembranei1816 – 1835Helical; Name=S5 of repeat IVSequence analysisAdd BLAST20
Topological domaini1836 – 1902ExtracellularSequence analysisAdd BLAST67
Transmembranei1903 – 1921Helical; Name=S6 of repeat IVSequence analysisAdd BLAST19
Topological domaini1922 – 2516CytoplasmicSequence analysisAdd BLAST595

GO - Cellular componenti

  • apical plasma membrane Source: FlyBase
  • basolateral plasma membrane Source: FlyBase
  • voltage-gated calcium channel complex Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi629C → Y in AR66; slower channel activation and reduction of peak current. 2 Publications1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000539601 – 2516Voltage-dependent calcium channel type D subunit alpha-1Add BLAST2516

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi644N-linked (GlcNAc...)Sequence analysis1
Glycosylationi647N-linked (GlcNAc...)Sequence analysis1
Modified residuei1937Phosphoserine; by PKASequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ24270.
PRIDEiQ24270.

Expressioni

Tissue specificityi

Expressed in the adult body, head and leg. Highly expressed in the embryonic nervous system.

Developmental stagei

Faintly expressed in embryos at 9-12 hours. Expression increases rapidly as the nervous system matures, peaking just prior to hatching. A second peak is observed in late pupal stages around 73-108 hours postpuparium.

Gene expression databases

BgeeiFBgn0001991.
ExpressionAtlasiQ24270. baseline.
GenevisibleiQ24270. DM.

Interactioni

Protein-protein interaction databases

BioGridi60962. 1 interactor.
IntActiQ24270. 7 interactors.
STRINGi7227.FBpp0089047.

Structurei

3D structure databases

ProteinModelPortaliQ24270.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati602 – 883IAdd BLAST282
Repeati971 – 1217IIAdd BLAST247
Repeati1331 – 1613IIIAdd BLAST283
Repeati1648 – 1929IVAdd BLAST282

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1533 – 1622Dihydropyridine bindingBy similarityAdd BLAST90
Regioni1885 – 1948Dihydropyridine bindingBy similarityAdd BLAST64
Regioni1896 – 1937Phenylalkylamine bindingBy similarityAdd BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi59 – 62Poly-Val4
Compositional biasi208 – 211Poly-Gly4
Compositional biasi262 – 267Poly-Ser6
Compositional biasi322 – 328Poly-Ala7
Compositional biasi460 – 463Poly-Glu4
Compositional biasi1115 – 1121Poly-Leu7
Compositional biasi1288 – 1292Poly-Glu5
Compositional biasi1591 – 1597Poly-Ile7
Compositional biasi2466 – 2469Poly-Asn4

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
GeneTreeiENSGT00830000128247.
InParanoidiQ24270.
KOiK04851.
OMAiIQVERPE.
OrthoDBiEOG091G0TKO.
PhylomeDBiQ24270.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q24270-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGGELVNCI AYDDNTLVIE RKPSPSSPST SRRYLKAETP TRGSRKYNRK
60 70 80 90 100
SSAKSDLEVV VVKPEHHHQH RSPTITLPVP ANPLTTSASA GSSPTGAGLA
110 120 130 140 150
AGLGTASGTV LQQSCSALDP PEDSNQPSGT RRRPTSTELA LSNVTSQIVN
160 170 180 190 200
NATYKLDFKQ RRHKSNNGGS ESGSLTGIAT GPATSPAGPT GPTSSSGKRR
210 220 230 240 250
KSSCTSCGGG GISAPPPRLT PEEAWQLQPQ NSVTSAGSTN SSFSSGGGRD
260 270 280 290 300
DNSSYSAVGG DSSSSNSCNC DITGDNSTLH GFGVGDVCSF IADCDDNSED
310 320 330 340 350
DDGDPNNQDL SSQTLRTAAI VAAVAAAAKE QAQEQSLADC ESFSDRRQDA
360 370 380 390 400
DEDVRIIQDC CGGNNDSLED VGEVDDNADV VVRKNSRNRP SIRRTCRITE
410 420 430 440 450
EDDDEDENAD YGDFDREDQE LDDEEPEGTT IDIDEQEQQH DQGDSAEEED
460 470 480 490 500
DDEDVDEYFE EEEDDTQAFS PFYSSSAELI DNFGGGAGKF FNIMDFERGA
510 520 530 540 550
SGEGGFSPNG NGGPGSGDVS RTARYDSGEG DLGGGNNIMG IDSMGIANIP
560 570 580 590 600
ETMNGTTIGP SGAGGQKGGA AAGAAGQKRQ QRRGKPQPDR PQRALFCLSV
610 620 630 640 650
KNPLRALCIR IVEWKPFEFL ILLTIFANCI ALAVYTPYPG SDSNVTNQTL
660 670 680 690 700
EKVEYVFLVI FTAECVMKIL AYGFVLHNGA YLRNGWNLLD FTIVVIGAIS
710 720 730 740 750
TALSQLMKDA FDVKALRAFR VLRPLRLVSG VPSLQVVLNS ILKAMVPLFH
760 770 780 790 800
IALLVLFVII IYAIIGLELF SGKLHKACRD EITGEYEENI RPCGVGYQCP
810 820 830 840 850
PGYKCYGGWD GPNDGITNFD NFGLAMLTVF QCVTLEGWTD VLYSIQDAMG
860 870 880 890 900
SDWQWMYFIS MVILGAFFVM NLILGVLSGE FSKERNKAKN RGDFQKLREK
910 920 930 940 950
QQIEEDLRGY LDWITQAEDI EPDAVGGLIS DGKGKQPNEM DSTENLGEEM
960 970 980 990 1000
PEVQMTESRW RKMKKDFDRV NRRMRRACRK AVKSQAFYWL IIVLVFLNTG
1010 1020 1030 1040 1050
VLATEHYGQL DWLDNFQEYT NVFFIGLFTC EMLLKMYSLG FQGYFVSLFN
1060 1070 1080 1090 1100
RFDCFVVIGS ITETLLTNTG MMPPLGVSVL RCVRLLRVFK VTKYWRSLSN
1110 1120 1130 1140 1150
LVASLLNSIQ SIASLLLLLF LFIVIFALLG MQVFGGKFNF DGKEEKYRMN
1160 1170 1180 1190 1200
FDCFWQALLT VFQIMTGEDW NAVMYVGINA YGGVSSYGAL ACIYFIILFI
1210 1220 1230 1240 1250
CGNYILLNVF LAIAVDNLAD ADSLSEVEKE EEPHDESAQK KSHSPTPTID
1260 1270 1280 1290 1300
GMDDHLSIDI DMEQQELDDE DKMDHETLSD EEVREMCEEE EEVDEEGMIT
1310 1320 1330 1340 1350
ARPRRMSEVN TATKILPIPP GTSFFLFSQT NRFRVFCHWL CNHSNFGNII
1360 1370 1380 1390 1400
LCCIMFSSAM LAAENPLRAN DDLNKVLNKF DYFFTAVFTI ELILKLISYG
1410 1420 1430 1440 1450
FVLHDGAFCR SAFNLLDLLV VCVSLISLVS SSNAISVVKI LRVLRVLRPL
1460 1470 1480 1490 1500
RAINRAKGLK HVVQCVIVAV KTIGNIVLVT CLLQFMFAVI GVQLFKGKFF
1510 1520 1530 1540 1550
KCTDGSKMTQ DECYGTYLVY DDGDVHKPRL REREWSNNRF HFDDVAKGML
1560 1570 1580 1590 1600
TLFTVSTFEG WPGLLYVSID SNKENGGPIH NFRPIVAAYY IIYIIIIAFF
1610 1620 1630 1640 1650
MVNIFVGFVI VTFQNEGEQE YKNCDLDKNQ RNCIEFALKA KPVRRYIPKH
1660 1670 1680 1690 1700
GIQYKVWWFV TSSSFEYTIF ILIMINTVTL AMKFYNQPLW YTELLDALNM
1710 1720 1730 1740 1750
IFTAVFALEF VFKLAAFRFK NYFGDAWNVF DFIIVLGSFI DIVYSEIKSK
1760 1770 1780 1790 1800
DTSQIAECDI VEGCKSTKKS AGSNLISINF FRLFRVMRLV KLLSKGEGIR
1810 1820 1830 1840 1850
TLLWTFIKSF QALPYVALLI VLLFFIYAVV GMQVFGKIAL DGGNAITANN
1860 1870 1880 1890 1900
NFQTFQQAVL VLFRSATGEA WQEIMMSCSA QPDVKCDMNS DTPGEPCGSS
1910 1920 1930 1940 1950
IAYPYFISFY VLCSFLIINL FVAVIMDNFD YLTRDWSILG PHHLDEFIRL
1960 1970 1980 1990 2000
WSEYDPDAKG RIKHLDVVTL LRKISPPLGF GKLCPHRMAC KRLVSMNMPL
2010 2020 2030 2040 2050
NSDGTVLFNA TLFAVVRTSL SIKTDGNIDD ANSELRATIK QIWKRTNPKL
2060 2070 2080 2090 2100
LDQVVPPPGN DDEVTVGKFY ATYLIQDYFR RFKKRKEQEG KEGHPDSNTV
2110 2120 2130 2140 2150
TLQAGLRTLH EVSPALKRAI SGNLDELDQE PEPMHRRHHT LFGSVWSSIR
2160 2170 2180 2190 2200
RHGNGTFRRS AKATASQSNG ALAIGGSASA ALGVGGSSLV LGSSDPAGGD
2210 2220 2230 2240 2250
YLYDTLNRSV ADGVNNITRN IMQARLAAAG KLQDELQGAG SGGELRTFGE
2260 2270 2280 2290 2300
SISMRPLAKN GGGAATVAGT LPPEANAINY DNRNRGILLH PYNNVYAPNG
2310 2320 2330 2340 2350
ALPGHERMIQ STPASPYDQR RLPTSSDMNG LAESLIGGVL AAEGLGKYCD
2360 2370 2380 2390 2400
SEFVGTAARE MREALDMTPE EMNLAAHQIL SNEHSLSLIG SSNGSIFGGS
2410 2420 2430 2440 2450
AGGLGGAGSG GVGGLGGSSS IRNAFGGSGS GPSSLSPQHQ PYSGTLNSPP
2460 2470 2480 2490 2500
IPDNRLRRVA TVTTTNNNNK SQVSQNNSNS LNVRANANSQ MNMSPTGQPV
2510
QQQSPLRGQG NQTYSS
Length:2,516
Mass (Da):276,700
Last modified:June 20, 2003 - v2
Checksum:i8CFC07499E750901
GO
Isoform B (identifier: Q24270-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1293-1329: VDEEGMITAR...PGTSFFLFSQ → DSNSEVSARV...RGSAFFIFSY

Note: No experimental confirmation available.
Show »
Length:2,519
Mass (Da):277,108
Checksum:iCA1E9A0374D8E955
GO
Isoform C (identifier: Q24270-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1496-1496: K → KYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFK

Note: No experimental confirmation available.
Show »
Length:2,552
Mass (Da):280,745
Checksum:i6C623BE5BE1B38E5
GO
Isoform D (identifier: Q24270-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2282-2300: NRNRGILLHPYNNVYAPNG → LRTQWCSSWPRTHDPIDTS
     2301-2516: Missing.

Note: No experimental confirmation available.
Show »
Length:2,300
Mass (Da):254,650
Checksum:i7F3C7A054B90EF1A
GO

Sequence cautioni

The sequence AAL13497 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti134P → A in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti282F → L in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti678N → D in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti683R → G in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti696I → M in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti1390I → M in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti1433N → D in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti2479N → S in AAA81883 (PubMed:7869089).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0175681293 – 1329VDEEG…FLFSQ → DSNSEVSARVTARPRRLSEV SMKKTKKPIPRGSAFFIFSY in isoform B. CuratedAdd BLAST37
Alternative sequenceiVSP_0175691496K → KYVVKCVVVAIKTIGNIMLV TYLLQFMFAVIGVQLFK in isoform C. Curated1
Alternative sequenceiVSP_0076042282 – 2300NRNRG…YAPNG → LRTQWCSSWPRTHDPIDTS in isoform D. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0076052301 – 2516Missing in isoform D. 1 PublicationAdd BLAST216

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U00690 mRNA. Translation: AAA81883.1.
AE014134 Genomic DNA. Translation: AAF53504.1.
AE014134 Genomic DNA. Translation: AAN10929.1.
AE014134 Genomic DNA. Translation: AAN10930.1.
AE014134 Genomic DNA. Translation: AAN10931.1.
AY058268 mRNA. Translation: AAL13497.1. Different initiation.
RefSeqiNP_525104.2. NM_080365.3. [Q24270-3]
NP_602305.1. NM_134429.3. [Q24270-1]
NP_723952.1. NM_165146.2. [Q24270-4]
NP_723953.1. NM_165147.2. [Q24270-2]
UniGeneiDm.4099.

Genome annotation databases

EnsemblMetazoaiFBtr0090006; FBpp0089049; FBgn0001991. [Q24270-1]
GeneIDi34950.
KEGGidme:Dmel_CG4894.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U00690 mRNA. Translation: AAA81883.1.
AE014134 Genomic DNA. Translation: AAF53504.1.
AE014134 Genomic DNA. Translation: AAN10929.1.
AE014134 Genomic DNA. Translation: AAN10930.1.
AE014134 Genomic DNA. Translation: AAN10931.1.
AY058268 mRNA. Translation: AAL13497.1. Different initiation.
RefSeqiNP_525104.2. NM_080365.3. [Q24270-3]
NP_602305.1. NM_134429.3. [Q24270-1]
NP_723952.1. NM_165146.2. [Q24270-4]
NP_723953.1. NM_165147.2. [Q24270-2]
UniGeneiDm.4099.

3D structure databases

ProteinModelPortaliQ24270.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi60962. 1 interactor.
IntActiQ24270. 7 interactors.
STRINGi7227.FBpp0089047.

Proteomic databases

PaxDbiQ24270.
PRIDEiQ24270.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0090006; FBpp0089049; FBgn0001991. [Q24270-1]
GeneIDi34950.
KEGGidme:Dmel_CG4894.

Organism-specific databases

CTDi34950.
FlyBaseiFBgn0001991. Ca-alpha1D.

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
GeneTreeiENSGT00830000128247.
InParanoidiQ24270.
KOiK04851.
OMAiIQVERPE.
OrthoDBiEOG091G0TKO.
PhylomeDBiQ24270.

Miscellaneous databases

ChiTaRSiCa-alpha1D. fly.
GenomeRNAii34950.
PROiQ24270.

Gene expression databases

BgeeiFBgn0001991.
ExpressionAtlasiQ24270. baseline.
GenevisibleiQ24270. DM.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAC1D_DROME
AccessioniPrimary (citable) accession number: Q24270
Secondary accession number(s): Q8IP23
, Q8IP24, Q8IP25, Q95U73, Q9V3P7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 20, 2003
Last modified: November 30, 2016
This is version 151 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Caution

It is uncertain whether Met-1, Met-494, Met-539, Met-544 or Met-553 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.