SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q24270

- CAC1D_DROME

UniProt

Q24270 - CAC1D_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Voltage-dependent calcium channel type D subunit alpha-1
Gene
Ca-alpha1D, DroCa1, l(2)35Fa, CG4894
Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei836 – 8361Calcium ion selectivity and permeability By similarity
Sitei1168 – 11681Calcium ion selectivity and permeability By similarity
Sitei1559 – 15591Calcium ion selectivity and permeability By similarity
Sitei1869 – 18691Calcium ion selectivity and permeability By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi1957 – 196812 By similarity
Add
BLAST

GO - Molecular functioni

  1. high voltage-gated calcium channel activity Source: RefGenome
  2. metal ion binding Source: UniProtKB-KW
  3. voltage-gated calcium channel activity Source: FlyBase

GO - Biological processi

  1. calcium ion import Source: RefGenome
  2. calcium ion transport Source: FlyBase
  3. epithelial fluid transport Source: FlyBase
  4. membrane depolarization during action potential Source: RefGenome
  5. muscle contraction Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent calcium channel type D subunit alpha-1
Short name:
DmCa1D
Gene namesi
Name:Ca-alpha1D
Synonyms:DroCa1, l(2)35Fa
ORF Names:CG4894
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 2L

Organism-specific databases

FlyBaseiFBgn0001991. Ca-alpha1D.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 615615Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei616 – 63419Helical; Name=S1 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini635 – 65319Extracellular Reviewed prediction
Add
BLAST
Transmembranei654 – 67118Helical; Name=S2 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini672 – 68413Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei685 – 69915Helical; Name=S3 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini700 – 71112Extracellular Reviewed prediction
Add
BLAST
Transmembranei712 – 73019Helical; Name=S4 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini731 – 75020Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei751 – 77020Helical; Name=S5 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini771 – 85383Extracellular Reviewed prediction
Add
BLAST
Transmembranei854 – 87825Helical; Name=S6 of repeat I; Reviewed prediction
Add
BLAST
Topological domaini879 – 985107Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei986 – 100520Helical; Name=S1 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini1006 – 101813Extracellular Reviewed prediction
Add
BLAST
Transmembranei1019 – 103820Helical; Name=S2 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini1039 – 10479Cytoplasmic Reviewed prediction
Transmembranei1048 – 106619Helical; Name=S3 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini1067 – 107610Extracellular Reviewed prediction
Transmembranei1077 – 109519Helical; Name=S4 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini1096 – 111419Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1115 – 113420Helical; Name=S5 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini1135 – 119056Extracellular Reviewed prediction
Add
BLAST
Transmembranei1191 – 121525Helical; Name=S6 of repeat II; Reviewed prediction
Add
BLAST
Topological domaini1216 – 1339124Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1340 – 136324Helical; Name=S1 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1364 – 138017Extracellular Reviewed prediction
Add
BLAST
Transmembranei1381 – 140020Helical; Name=S2 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1401 – 14088Cytoplasmic Reviewed prediction
Transmembranei1409 – 143123Helical; Name=S3 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1432 – 14398Extracellular Reviewed prediction
Transmembranei1440 – 145415Helical; Name=S4 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1455 – 147521Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1476 – 149520Helical; Name=S5 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1496 – 158489Extracellular Reviewed prediction
Add
BLAST
Transmembranei1585 – 160925Helical; Name=S6 of repeat III; Reviewed prediction
Add
BLAST
Topological domaini1610 – 166455Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1665 – 168319Helical; Name=S1 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1684 – 169714Extracellular Reviewed prediction
Add
BLAST
Transmembranei1698 – 171720Helical; Name=S2 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1718 – 17269Cytoplasmic Reviewed prediction
Transmembranei1727 – 174519Helical; Name=S3 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1746 – 177732Extracellular Reviewed prediction
Add
BLAST
Transmembranei1778 – 179619Helical; Name=S4 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1797 – 181519Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1816 – 183520Helical; Name=S5 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1836 – 190267Extracellular Reviewed prediction
Add
BLAST
Transmembranei1903 – 192119Helical; Name=S6 of repeat IV; Reviewed prediction
Add
BLAST
Topological domaini1922 – 2516595Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. apical plasma membrane Source: FlyBase
  2. basolateral plasma membrane Source: FlyBase
  3. voltage-gated calcium channel complex Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi629 – 6291C → Y in AR66; slower channel activation and reduction of peak current. 2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25162516Voltage-dependent calcium channel type D subunit alpha-1
PRO_0000053960Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi644 – 6441N-linked (GlcNAc...) Reviewed prediction
Glycosylationi647 – 6471N-linked (GlcNAc...) Reviewed prediction
Modified residuei1937 – 19371Phosphoserine; by PKA Reviewed prediction

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ24270.

Expressioni

Tissue specificityi

Expressed in the adult body, head and leg. Highly expressed in the embryonic nervous system.

Developmental stagei

Faintly expressed in embryos at 9-12 hours. Expression increases rapidly as the nervous system matures, peaking just prior to hatching. A second peak is observed in late pupal stages around 73-108 hours postpuparium.

Gene expression databases

BgeeiQ24270.

Interactioni

Protein-protein interaction databases

BioGridi60962. 1 interaction.
IntActiQ24270. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ24270.
SMRiQ24270. Positions 617-877, 892-920, 982-1216, 1346-1610, 1665-1927, 2010-2088.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati602 – 883282I
Add
BLAST
Repeati971 – 1217247II
Add
BLAST
Repeati1331 – 1613283III
Add
BLAST
Repeati1648 – 1929282IV
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1533 – 162290Dihydropyridine binding By similarity
Add
BLAST
Regioni1885 – 194864Dihydropyridine binding By similarity
Add
BLAST
Regioni1896 – 193742Phenylalkylamine binding By similarity
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi59 – 624Poly-Val
Compositional biasi208 – 2114Poly-Gly
Compositional biasi262 – 2676Poly-Ser
Compositional biasi322 – 3287Poly-Ala
Compositional biasi460 – 4634Poly-Glu
Compositional biasi1115 – 11217Poly-Leu
Compositional biasi1288 – 12925Poly-Glu
Compositional biasi1591 – 15977Poly-Ile
Compositional biasi2466 – 24694Poly-Asn

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1226.
GeneTreeiENSGT00750000117407.
InParanoidiQ24270.
KOiK05315.
OMAiLCIRIVE.
OrthoDBiEOG7T1RBQ.
PhylomeDBiQ24270.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q24270-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGGGELVNCI AYDDNTLVIE RKPSPSSPST SRRYLKAETP TRGSRKYNRK     50
SSAKSDLEVV VVKPEHHHQH RSPTITLPVP ANPLTTSASA GSSPTGAGLA 100
AGLGTASGTV LQQSCSALDP PEDSNQPSGT RRRPTSTELA LSNVTSQIVN 150
NATYKLDFKQ RRHKSNNGGS ESGSLTGIAT GPATSPAGPT GPTSSSGKRR 200
KSSCTSCGGG GISAPPPRLT PEEAWQLQPQ NSVTSAGSTN SSFSSGGGRD 250
DNSSYSAVGG DSSSSNSCNC DITGDNSTLH GFGVGDVCSF IADCDDNSED 300
DDGDPNNQDL SSQTLRTAAI VAAVAAAAKE QAQEQSLADC ESFSDRRQDA 350
DEDVRIIQDC CGGNNDSLED VGEVDDNADV VVRKNSRNRP SIRRTCRITE 400
EDDDEDENAD YGDFDREDQE LDDEEPEGTT IDIDEQEQQH DQGDSAEEED 450
DDEDVDEYFE EEEDDTQAFS PFYSSSAELI DNFGGGAGKF FNIMDFERGA 500
SGEGGFSPNG NGGPGSGDVS RTARYDSGEG DLGGGNNIMG IDSMGIANIP 550
ETMNGTTIGP SGAGGQKGGA AAGAAGQKRQ QRRGKPQPDR PQRALFCLSV 600
KNPLRALCIR IVEWKPFEFL ILLTIFANCI ALAVYTPYPG SDSNVTNQTL 650
EKVEYVFLVI FTAECVMKIL AYGFVLHNGA YLRNGWNLLD FTIVVIGAIS 700
TALSQLMKDA FDVKALRAFR VLRPLRLVSG VPSLQVVLNS ILKAMVPLFH 750
IALLVLFVII IYAIIGLELF SGKLHKACRD EITGEYEENI RPCGVGYQCP 800
PGYKCYGGWD GPNDGITNFD NFGLAMLTVF QCVTLEGWTD VLYSIQDAMG 850
SDWQWMYFIS MVILGAFFVM NLILGVLSGE FSKERNKAKN RGDFQKLREK 900
QQIEEDLRGY LDWITQAEDI EPDAVGGLIS DGKGKQPNEM DSTENLGEEM 950
PEVQMTESRW RKMKKDFDRV NRRMRRACRK AVKSQAFYWL IIVLVFLNTG 1000
VLATEHYGQL DWLDNFQEYT NVFFIGLFTC EMLLKMYSLG FQGYFVSLFN 1050
RFDCFVVIGS ITETLLTNTG MMPPLGVSVL RCVRLLRVFK VTKYWRSLSN 1100
LVASLLNSIQ SIASLLLLLF LFIVIFALLG MQVFGGKFNF DGKEEKYRMN 1150
FDCFWQALLT VFQIMTGEDW NAVMYVGINA YGGVSSYGAL ACIYFIILFI 1200
CGNYILLNVF LAIAVDNLAD ADSLSEVEKE EEPHDESAQK KSHSPTPTID 1250
GMDDHLSIDI DMEQQELDDE DKMDHETLSD EEVREMCEEE EEVDEEGMIT 1300
ARPRRMSEVN TATKILPIPP GTSFFLFSQT NRFRVFCHWL CNHSNFGNII 1350
LCCIMFSSAM LAAENPLRAN DDLNKVLNKF DYFFTAVFTI ELILKLISYG 1400
FVLHDGAFCR SAFNLLDLLV VCVSLISLVS SSNAISVVKI LRVLRVLRPL 1450
RAINRAKGLK HVVQCVIVAV KTIGNIVLVT CLLQFMFAVI GVQLFKGKFF 1500
KCTDGSKMTQ DECYGTYLVY DDGDVHKPRL REREWSNNRF HFDDVAKGML 1550
TLFTVSTFEG WPGLLYVSID SNKENGGPIH NFRPIVAAYY IIYIIIIAFF 1600
MVNIFVGFVI VTFQNEGEQE YKNCDLDKNQ RNCIEFALKA KPVRRYIPKH 1650
GIQYKVWWFV TSSSFEYTIF ILIMINTVTL AMKFYNQPLW YTELLDALNM 1700
IFTAVFALEF VFKLAAFRFK NYFGDAWNVF DFIIVLGSFI DIVYSEIKSK 1750
DTSQIAECDI VEGCKSTKKS AGSNLISINF FRLFRVMRLV KLLSKGEGIR 1800
TLLWTFIKSF QALPYVALLI VLLFFIYAVV GMQVFGKIAL DGGNAITANN 1850
NFQTFQQAVL VLFRSATGEA WQEIMMSCSA QPDVKCDMNS DTPGEPCGSS 1900
IAYPYFISFY VLCSFLIINL FVAVIMDNFD YLTRDWSILG PHHLDEFIRL 1950
WSEYDPDAKG RIKHLDVVTL LRKISPPLGF GKLCPHRMAC KRLVSMNMPL 2000
NSDGTVLFNA TLFAVVRTSL SIKTDGNIDD ANSELRATIK QIWKRTNPKL 2050
LDQVVPPPGN DDEVTVGKFY ATYLIQDYFR RFKKRKEQEG KEGHPDSNTV 2100
TLQAGLRTLH EVSPALKRAI SGNLDELDQE PEPMHRRHHT LFGSVWSSIR 2150
RHGNGTFRRS AKATASQSNG ALAIGGSASA ALGVGGSSLV LGSSDPAGGD 2200
YLYDTLNRSV ADGVNNITRN IMQARLAAAG KLQDELQGAG SGGELRTFGE 2250
SISMRPLAKN GGGAATVAGT LPPEANAINY DNRNRGILLH PYNNVYAPNG 2300
ALPGHERMIQ STPASPYDQR RLPTSSDMNG LAESLIGGVL AAEGLGKYCD 2350
SEFVGTAARE MREALDMTPE EMNLAAHQIL SNEHSLSLIG SSNGSIFGGS 2400
AGGLGGAGSG GVGGLGGSSS IRNAFGGSGS GPSSLSPQHQ PYSGTLNSPP 2450
IPDNRLRRVA TVTTTNNNNK SQVSQNNSNS LNVRANANSQ MNMSPTGQPV 2500
QQQSPLRGQG NQTYSS 2516
Length:2,516
Mass (Da):276,700
Last modified:June 20, 2003 - v2
Checksum:i8CFC07499E750901
GO
Isoform B (identifier: Q24270-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1293-1329: VDEEGMITAR...PGTSFFLFSQ → DSNSEVSARV...RGSAFFIFSY

Note: No experimental confirmation available.

Show »
Length:2,519
Mass (Da):277,108
Checksum:iCA1E9A0374D8E955
GO
Isoform C (identifier: Q24270-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1496-1496: K → KYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFK

Note: No experimental confirmation available.

Show »
Length:2,552
Mass (Da):280,745
Checksum:i6C623BE5BE1B38E5
GO
Isoform D (identifier: Q24270-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2282-2300: NRNRGILLHPYNNVYAPNG → LRTQWCSSWPRTHDPIDTS
     2301-2516: Missing.

Note: No experimental confirmation available.

Show »
Length:2,300
Mass (Da):254,650
Checksum:i7F3C7A054B90EF1A
GO

Sequence cautioni

The sequence AAL13497.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1293 – 132937VDEEG…FLFSQ → DSNSEVSARVTARPRRLSEV SMKKTKKPIPRGSAFFIFSY in isoform B.
VSP_017568Add
BLAST
Alternative sequencei1496 – 14961K → KYVVKCVVVAIKTIGNIMLV TYLLQFMFAVIGVQLFK in isoform C.
VSP_017569
Alternative sequencei2282 – 230019NRNRG…YAPNG → LRTQWCSSWPRTHDPIDTS in isoform D.
VSP_007604Add
BLAST
Alternative sequencei2301 – 2516216Missing in isoform D.
VSP_007605Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1341P → A in AAA81883. 1 Publication
Sequence conflicti282 – 2821F → L in AAA81883. 1 Publication
Sequence conflicti678 – 6781N → D in AAA81883. 1 Publication
Sequence conflicti683 – 6831R → G in AAA81883. 1 Publication
Sequence conflicti696 – 6961I → M in AAA81883. 1 Publication
Sequence conflicti1390 – 13901I → M in AAA81883. 1 Publication
Sequence conflicti1433 – 14331N → D in AAA81883. 1 Publication
Sequence conflicti2479 – 24791N → S in AAA81883. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U00690 mRNA. Translation: AAA81883.1.
AE014134 Genomic DNA. Translation: AAF53504.1.
AE014134 Genomic DNA. Translation: AAN10929.1.
AE014134 Genomic DNA. Translation: AAN10930.1.
AE014134 Genomic DNA. Translation: AAN10931.1.
AY058268 mRNA. Translation: AAL13497.1. Different initiation.
RefSeqiNP_525104.2. NM_080365.3. [Q24270-3]
NP_602305.1. NM_134429.3. [Q24270-1]
NP_723952.1. NM_165146.2. [Q24270-4]
NP_723953.1. NM_165147.2. [Q24270-2]
UniGeneiDm.4099.

Genome annotation databases

EnsemblMetazoaiFBtr0090006; FBpp0089049; FBgn0001991. [Q24270-1]
GeneIDi34950.
KEGGidme:Dmel_CG4894.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U00690 mRNA. Translation: AAA81883.1 .
AE014134 Genomic DNA. Translation: AAF53504.1 .
AE014134 Genomic DNA. Translation: AAN10929.1 .
AE014134 Genomic DNA. Translation: AAN10930.1 .
AE014134 Genomic DNA. Translation: AAN10931.1 .
AY058268 mRNA. Translation: AAL13497.1 . Different initiation.
RefSeqi NP_525104.2. NM_080365.3. [Q24270-3 ]
NP_602305.1. NM_134429.3. [Q24270-1 ]
NP_723952.1. NM_165146.2. [Q24270-4 ]
NP_723953.1. NM_165147.2. [Q24270-2 ]
UniGenei Dm.4099.

3D structure databases

ProteinModelPortali Q24270.
SMRi Q24270. Positions 617-877, 892-920, 982-1216, 1346-1610, 1665-1927, 2010-2088.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 60962. 1 interaction.
IntActi Q24270. 1 interaction.

Proteomic databases

PaxDbi Q24270.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0090006 ; FBpp0089049 ; FBgn0001991 . [Q24270-1 ]
GeneIDi 34950.
KEGGi dme:Dmel_CG4894.

Organism-specific databases

CTDi 34950.
FlyBasei FBgn0001991. Ca-alpha1D.

Phylogenomic databases

eggNOGi COG1226.
GeneTreei ENSGT00750000117407.
InParanoidi Q24270.
KOi K05315.
OMAi LCIRIVE.
OrthoDBi EOG7T1RBQ.
PhylomeDBi Q24270.

Miscellaneous databases

ChiTaRSi Ca-alpha1D. drosophila.
GenomeRNAii 34950.
NextBioi 791045.
PROi Q24270.

Gene expression databases

Bgeei Q24270.

Family and domain databases

Gene3Di 1.20.120.350. 5 hits.
InterProi IPR027359. Channel_four-helix_dom.
IPR005821. Ion_trans_dom.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view ]
Pfami PF08763. Ca_chan_IQ. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view ]
PRINTSi PR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
SMARTi SM01062. Ca_chan_IQ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a calcium channel alpha 1 subunit from Drosophila melanogaster with similarity to the rat brain type D isoform."
    Zheng W., Feng G., Ren D., Eberl D.F., Hannan F., Dubald M., Hall L.M.
    J. Neurosci. 15:1132-1143(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, ALTERNATIVE SPLICING.
    Strain: Canton-S.
    Tissue: Head.
  2. "An exploration of the sequence of a 2.9-Mb region of the genome of Drosophila melanogaster: the Adh region."
    Ashburner M., Misra S., Roote J., Lewis S.E., Blazej R.G., Davis T., Doyle C., Galle R.F., George R.A., Harris N.L., Hartzell G., Harvey D.A., Hong L., Houston K.A., Hoskins R.A., Johnson G., Martin C., Moshrefi A.R.
    , Palazzolo M., Reese M.G., Spradling A.C., Tsang G., Wan K.H., Whitelaw K., Celniker S.E., Rubin G.M.
    Genetics 153:179-219(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1895-2300 (ISOFORM D).
    Strain: Berkeley.
    Tissue: Head.
  6. "A mutation affecting dihydropyridine-sensitive current levels and activation kinetics in Drosophila muscle and mammalian heart calcium channels."
    Ren D., Xu H., Eberl D.F., Chopra M., Hall L.M.
    J. Neurosci. 18:2335-2341(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS OF CYS-629.
  7. "Genetic and developmental characterization of Dmca1D, a calcium channel alpha-1 subunit gene in Drosophila melanogaster."
    Eberl D.F., Ren D., Feng G., Lorenz L.J., van Vactor D., Hall L.M.
    Genetics 148:1159-1169(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS OF CYS-629.

Entry informationi

Entry nameiCAC1D_DROME
AccessioniPrimary (citable) accession number: Q24270
Secondary accession number(s): Q8IP23
, Q8IP24, Q8IP25, Q95U73, Q9V3P7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 20, 2003
Last modified: July 9, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi