Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic dynein 1 intermediate chain

Gene

sw

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the help dynein bind to dynactin 150 kDa component (By similarity).By similarity1 Publication

GO - Molecular functioni

  • dynactin binding Source: FlyBase
  • dynein heavy chain binding Source: FlyBase
  • dynein light chain binding Source: CAFA
  • motor activity Source: UniProtKB-KW

GO - Biological processi

  • axo-dendritic transport Source: FlyBase
  • cellularization Source: FlyBase
  • centrosome localization Source: FlyBase
  • eye photoreceptor cell differentiation Source: FlyBase
  • microtubule-based movement Source: FlyBase
  • microtubule cytoskeleton organization Source: FlyBase
  • positive regulation of ATP-dependent microtubule motor activity, plus-end-directed Source: GO_Central
  • protein localization to kinetochore Source: FlyBase
  • sperm individualization Source: FlyBase
  • spindle organization Source: FlyBase

Keywordsi

Molecular functionMotor protein
Biological processTransport

Enzyme and pathway databases

ReactomeiR-DME-6807878 COPI-mediated anterograde transport
R-DME-6811436 COPI-independent Golgi-to-ER retrograde traffic
SignaLinkiQ24246

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic dynein 1 intermediate chain
Short name:
DH IC
Alternative name(s):
Dynein intermediate chain, cytosolic
Protein short wing
Gene namesi
Name:sw
Synonyms:Cdic, Dic19B
ORF Names:CG18000
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0003654 sw

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Dynein, Lysosome, Membrane, Microtubule, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001146611 – 663Cytoplasmic dynein 1 intermediate chainAdd BLAST663

Proteomic databases

PaxDbiQ24246
PRIDEiQ24246

Expressioni

Tissue specificityi

High levels of isoform 1b, isoform 1c, isoform 3a and isoform 4 accumulate in early egg chambers and at stage 9 become concentrated at the posterior of the oocyte. Isoform 5a and isoform 5b are highly expressed in adult head and to a lesser extent in adult torso. Isoform 1a, isoform 2a and isoform 2b are found in all tissues examined, including ovaries, midgut, torso and head.2 Publications

Developmental stagei

Expressed both maternally and zygotically. Abundant in embryos and adults, low levels in larva and pupae. Isoform 1a, isoform 2a and isoform 2b are constitutively expressed at high levels and isoform 2c at low levels in embryos and adults.1 Publication

Gene expression databases

BgeeiFBgn0003654
ExpressionAtlasiQ24246 baseline and differential
GenevisibleiQ24246 DM

Interactioni

Subunit structurei

Homodimer. The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs).By similarity

GO - Molecular functioni

  • dynactin binding Source: FlyBase
  • dynein heavy chain binding Source: FlyBase
  • dynein light chain binding Source: CAFA

Protein-protein interaction databases

BioGridi68871, 23 interactors
DIPiDIP-19664N
ELMiQ24246
IntActiQ24246, 6 interactors
STRINGi7227.FBpp0088428

Structurei

Secondary structure

1663
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi110 – 112Combined sources3
Beta strandi128 – 133Combined sources6
Helixi244 – 251Combined sources8
Helixi254 – 273Combined sources20

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2P2TX-ray3.00C123-138[»]
3FM7X-ray3.50C/D109-135[»]
3L9KX-ray3.00W/X/Y/Z242-279[»]
DisProtiDP00605
ProteinModelPortaliQ24246
SMRiQ24246
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ24246

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati311 – 360WD 1Add BLAST50
Repeati364 – 404WD 2Add BLAST41
Repeati413 – 454WD 3Add BLAST42
Repeati463 – 503WD 4Add BLAST41
Repeati508 – 553WD 5Add BLAST46
Repeati556 – 596WD 6Add BLAST41
Repeati602 – 641WD 7Add BLAST40

Sequence similaritiesi

Belongs to the dynein intermediate chain family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1587 Eukaryota
ENOG410XQ99 LUCA
GeneTreeiENSGT00730000110228
InParanoidiQ24246
KOiK10415
OMAiQFYDERW
OrthoDBiEOG091G038G
PhylomeDBiQ24246

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR025956 DYNC1I1/DYNC1I2
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF11540 Dynein_IC2, 1 hit
SMARTiView protein in SMART
SM00320 WD40, 6 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (11)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 5a (identifier: Q24246-11) [UniParc]FASTAAdd to basket
Also known as: J

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRKAELERK KAKLAALREE KDRRRREKEI KDMEEAAGRI GGGAGIDKDQ
60 70 80 90 100
RKDLDEMLSS LGVAPVSEVL SSLSSVNSMT SDNSNTQTPD ASLQATVNGQ
110 120 130 140 150
SGGKKQPLNL SVYNVQATNI PPKETLVYTK QTQTTSTGGG NGDVLSCHSS
160 170 180 190 200
PLSGYMEDWW RPRKAHATDY YDEYNLNPGL EWEDEFTDDE ESSLQNLGNG
210 220 230 240 250
FTSKLPPGYL THGLPTVKDV APAITPLEIK KETEVKKEVN ELSEEQKQMI
260 270 280 290 300
ILSENFQRFV VRAGRVIERA LSENVDIYTD YIGGGDSEEA NDERSHARLS
310 320 330 340 350
LNRVFYDERW SKNRCITSMD WSTHFPELVV GSYHNNEESP NEPDGVVMVW
360 370 380 390 400
NTKFKKSTPE DVFHCQSAVM STCFAKFNPN LILGGTYSGQ IVLWDNRVQK
410 420 430 440 450
RTPIQRTPLS AAAHTHPVYC LQMVGTQNAH NVISISSDGK LCSWSLDMLS
460 470 480 490 500
QPQDTLELQQ RQSKAIAITS MAFPANEINS LVMGSEDGYV YSASRHGLRS
510 520 530 540 550
GVNEVYERHL GPITGISTHY NQLSPDFGHL FLTSSIDWTI KLWSLKDTKP
560 570 580 590 600
LYSFEDNSDY VMDVAWSPVH PALFAAVDGS GRLDLWNLNQ DTEVPTASIV
610 620 630 640 650
VAGAPALNRV SWTPSGLHVC IGDEAGKLYV YDVAENLAQP SRDEWSRFNT
660
HLSEIKMNQS DEV
Length:663
Mass (Da):73,917
Last modified:July 3, 2003 - v3
Checksum:i4C726D4C5F47FAF7
GO
Isoform 1a (identifier: Q24246-2) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYVLAFDAQG

Show »
Length:634
Mass (Da):70,249
Checksum:iF3267D4090F25E05
GO
Isoform 1b (identifier: Q24246-3) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYG

Show »
Length:627
Mass (Da):69,505
Checksum:iAB436F70A431915B
GO
Isoform 1c (identifier: Q24246-4) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYY

Show »
Length:626
Mass (Da):69,447
Checksum:iD96D9CD9AA89814A
GO
Isoform 2a (identifier: Q24246-5) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.
     187-187: T → TG

Show »
Length:643
Mass (Da):71,458
Checksum:i900A25F62B24A451
GO
Isoform 2b (identifier: Q24246-6) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.

Show »
Length:642
Mass (Da):71,400
Checksum:i10271A56BFBC8B62
GO
Isoform 2c (identifier: Q24246-7) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.
     187-187: T → TVLAFDAQG

Show »
Length:650
Mass (Da):72,202
Checksum:i937440311CA820DE
GO
Isoform 3a (identifier: Q24246-8) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     144-171: Missing.
     187-187: T → TG

Show »
Length:636
Mass (Da):70,636
Checksum:i10882999594FBDD9
GO
Isoform 3b (identifier: Q24246-9) [UniParc]FASTAAdd to basket
Also known as: H

The sequence of this isoform differs from the canonical sequence as follows:
     144-171: Missing.

Show »
Length:635
Mass (Da):70,579
Checksum:i422B7524D4A50381
GO
Isoform 4 (identifier: Q24246-10) [UniParc]FASTAAdd to basket
Also known as: I

The sequence of this isoform differs from the canonical sequence as follows:
     146-187: SCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AFDAQG

Show »
Length:627
Mass (Da):69,428
Checksum:i6D17F8435B8C8BF8
GO
Isoform 5b (identifier: Q24246-12) [UniParc]FASTAAdd to basket
Also known as: K

The sequence of this isoform differs from the canonical sequence as follows:
     144-153: Missing.

Show »
Length:653
Mass (Da):72,906
Checksum:i3073C8F8F3B2FB59
GO

Sequence cautioni

The sequence AAC70942 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC78306 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti47D → G in AAC78306 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70933 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70934 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70935 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70936 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70937 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70938 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70939 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70940 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70941 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70942 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70943 (PubMed:9774695).Curated1
Sequence conflicti139 – 145GGNGDVL → AETAMV in AAB51185 (Ref. 6) Curated7
Sequence conflicti235V → L in AAB51185 (Ref. 6) Curated1
Sequence conflicti296 – 297HA → SM in AAB51185 (Ref. 6) Curated2
Sequence conflicti521 – 522NQ → KP in AAB51185 (Ref. 6) Curated2
Sequence conflicti537 – 548DWTIK…SLKDT → KIWSLKLPISSCQFSVVSGI NSN in AAB51185 (Ref. 6) CuratedAdd BLAST12
Sequence conflicti579G → A in AAB51185 (Ref. 6) Curated1
Sequence conflicti593E → K in AAB51185 (Ref. 6) Curated1
Sequence conflicti628L → Q in AAB51185 (Ref. 6) Curated1
Sequence conflicti645 – 663WSRFN…QSDEV → IKMNQSVRSRTI in AAB51185 (Ref. 6) CuratedAdd BLAST19

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001345144 – 187VLSCH…EDEFT → AHATDYYVLAFDAQG in isoform 1a. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_001346144 – 187VLSCH…EDEFT → AHATDYYG in isoform 1b. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_001347144 – 187VLSCH…EDEFT → AHATDYY in isoform 1c. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_001342144 – 171Missing in isoform 3a and isoform 3b. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_007686144 – 164Missing in isoform 2a, isoform 2b and isoform 2c. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_007685144 – 153Missing in isoform 5b. 1 Publication10
Alternative sequenceiVSP_001343146 – 187SCHSS…EDEFT → AFDAQG in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_001348187T → TG in isoform 2a and isoform 3a. 1 Publication1
Alternative sequenceiVSP_007687187T → TVLAFDAQG in isoform 2c. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF070687 Genomic DNA Translation: AAC78306.1 Sequence problems.
AF070689 mRNA Translation: AAC70933.1
AF070690 mRNA Translation: AAC70934.1
AF070691 mRNA Translation: AAC70935.1
AF070692 mRNA Translation: AAC70936.1
AF070693 mRNA Translation: AAC70937.1
AF070694 mRNA Translation: AAC70938.1
AF070695 mRNA Translation: AAC70939.1
AF070696 mRNA Translation: AAC70940.1
AF070697 mRNA Translation: AAC70941.1
AF070698 mRNA Translation: AAC70942.1 Sequence problems.
AF070699 mRNA Translation: AAC70943.1
AF263371 mRNA Translation: AAF73046.1
AE014298 Genomic DNA Translation: AAF50928.2
AE014298 Genomic DNA Translation: AAN09553.1
AE014298 Genomic DNA Translation: AAN09554.1
AE014298 Genomic DNA Translation: AAN09555.1
AE014298 Genomic DNA Translation: AAN09556.1
AE014298 Genomic DNA Translation: AAN09557.1
AE014298 Genomic DNA Translation: AAN09558.1
AE014298 Genomic DNA Translation: AAN09559.1
AE014298 Genomic DNA Translation: AAN09560.1
AE014298 Genomic DNA Translation: AAN09561.1
AE014298 Genomic DNA Translation: AAN09562.1
BT016101 mRNA Translation: AAV36986.1
L41945 Genomic DNA Translation: AAB51185.1
RefSeqiNP_001285486.1, NM_001298557.1 [Q24246-2]
NP_477069.1, NM_057721.4 [Q24246-5]
NP_477070.1, NM_057722.4 [Q24246-8]
NP_477071.1, NM_057723.4 [Q24246-9]
NP_477072.1, NM_057724.4 [Q24246-10]
NP_477073.1, NM_057725.4 [Q24246-12]
NP_477074.1, NM_057726.4 [Q24246-2]
NP_477075.2, NM_057727.5 [Q24246-11]
NP_477076.1, NM_057728.4 [Q24246-4]
NP_477077.1, NM_057729.4 [Q24246-3]
NP_477078.1, NM_057730.5 [Q24246-6]
NP_477079.1, NM_057731.4 [Q24246-7]
NP_996521.1, NM_206798.2 [Q24246-5]
NP_996522.1, NM_206799.2 [Q24246-5]
UniGeneiDm.20780

Genome annotation databases

EnsemblMetazoaiFBtr0089397; FBpp0088419; FBgn0003654 [Q24246-2]
FBtr0089398; FBpp0088420; FBgn0003654 [Q24246-3]
FBtr0089399; FBpp0088421; FBgn0003654 [Q24246-4]
FBtr0089400; FBpp0088422; FBgn0003654 [Q24246-5]
FBtr0089401; FBpp0088423; FBgn0003654 [Q24246-6]
FBtr0089402; FBpp0088424; FBgn0003654 [Q24246-7]
FBtr0089403; FBpp0088425; FBgn0003654 [Q24246-8]
FBtr0089404; FBpp0088426; FBgn0003654 [Q24246-9]
FBtr0089405; FBpp0088427; FBgn0003654 [Q24246-10]
FBtr0089406; FBpp0088428; FBgn0003654 [Q24246-11]
FBtr0089407; FBpp0088429; FBgn0003654 [Q24246-12]
FBtr0089408; FBpp0089020; FBgn0003654 [Q24246-5]
FBtr0089409; FBpp0089021; FBgn0003654 [Q24246-5]
FBtr0340360; FBpp0309318; FBgn0003654 [Q24246-2]
GeneIDi44160
KEGGidme:Dmel_CG18000

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDYIN_DROME
AccessioniPrimary (citable) accession number: Q24246
Secondary accession number(s): O96508
, O96510, O96511, O96512, O96513, O96514, O96515, O96516, Q5U0Z1, Q86BQ5, Q9NG49, Q9TZR7, Q9TZR8, Q9TZR9, Q9TZS0, Q9VR78
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 3, 2003
Last modified: May 23, 2018
This is version 184 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health