Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoplasmic dynein 1 intermediate chain

Gene

sw

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the help dynein bind to dynactin 150 kDa component (By similarity).By similarity1 Publication

GO - Molecular functioni

  • dynein complex binding Source: FlyBase
  • dynein heavy chain binding Source: FlyBase
  • dynein light chain binding Source: FlyBase
  • microtubule motor activity Source: FlyBase

GO - Biological processi

  • axo-dendritic transport Source: FlyBase
  • cellularization Source: FlyBase
  • centrosome localization Source: FlyBase
  • eye photoreceptor cell differentiation Source: FlyBase
  • microtubule-based movement Source: FlyBase
  • microtubule cytoskeleton organization Source: FlyBase
  • protein localization to kinetochore Source: FlyBase
  • sperm individualization Source: FlyBase
  • spindle organization Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiR-DME-6807878. COPI-mediated anterograde transport.
R-DME-6811436. COPI-independent Golgi-to-ER retrograde traffic.
SignaLinkiQ24246.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoplasmic dynein 1 intermediate chain
Short name:
DH IC
Alternative name(s):
Dynein intermediate chain, cytosolic
Protein short wing
Gene namesi
Name:sw
Synonyms:Cdic, Dic19B
ORF Names:CG18000
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0003654. sw.

Subcellular locationi

  • Cytoplasmcytoskeleton 1 Publication
Isoform 2c :
Isoform 2a :
Isoform 2b :

GO - Cellular componenti

  • cytoplasmic dynein complex Source: FlyBase
  • lysosomal membrane Source: UniProtKB-SubCell
  • microtubule Source: UniProtKB-KW
  • microtubule associated complex Source: FlyBase
  • neuron projection Source: GOC
  • nuclear membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Dynein, Lysosome, Membrane, Microtubule, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 663663Cytoplasmic dynein 1 intermediate chainPRO_0000114661Add
BLAST

Proteomic databases

PaxDbiQ24246.
PRIDEiQ24246.

Expressioni

Tissue specificityi

High levels of isoform 1b, isoform 1c, isoform 3a and isoform 4 accumulate in early egg chambers and at stage 9 become concentrated at the posterior of the oocyte. Isoform 5a and isoform 5b are highly expressed in adult head and to a lesser extent in adult torso. Isoform 1a, isoform 2a and isoform 2b are found in all tissues examined, including ovaries, midgut, torso and head.2 Publications

Developmental stagei

Expressed both maternally and zygotically. Abundant in embryos and adults, low levels in larva and pupae. Isoform 1a, isoform 2a and isoform 2b are constitutively expressed at high levels and isoform 2c at low levels in embryos and adults.1 Publication

Gene expression databases

BgeeiQ24246.
GenevisibleiQ24246. DM.

Interactioni

Subunit structurei

Homodimer. The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs).By similarity

GO - Molecular functioni

  • dynein complex binding Source: FlyBase
  • dynein heavy chain binding Source: FlyBase
  • dynein light chain binding Source: FlyBase

Protein-protein interaction databases

BioGridi68871. 5 interactions.
DIPiDIP-19664N.
IntActiQ24246. 6 interactions.
MINTiMINT-1717948.
STRINGi7227.FBpp0088428.

Structurei

Secondary structure

1
663
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi110 – 1123Combined sources
Beta strandi128 – 1336Combined sources
Helixi244 – 2518Combined sources
Helixi254 – 27320Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2P2TX-ray3.00C123-138[»]
3FM7X-ray3.50C/D109-135[»]
3L9KX-ray3.00W/X/Y/Z242-279[»]
DisProtiDP00605.
ProteinModelPortaliQ24246.
SMRiQ24246. Positions 109-135, 242-279, 320-637.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ24246.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati311 – 36050WD 1Add
BLAST
Repeati364 – 40441WD 2Add
BLAST
Repeati413 – 45442WD 3Add
BLAST
Repeati463 – 50341WD 4Add
BLAST
Repeati508 – 55346WD 5Add
BLAST
Repeati556 – 59641WD 6Add
BLAST
Repeati602 – 64140WD 7Add
BLAST

Sequence similaritiesi

Belongs to the dynein intermediate chain family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1587. Eukaryota.
ENOG410XQ99. LUCA.
GeneTreeiENSGT00730000110228.
InParanoidiQ24246.
KOiK10415.
OMAiADEWTRF.
OrthoDBiEOG7FR7FX.
PhylomeDBiQ24246.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR025956. DYNC1I1/DYNC1I2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF11540. Dynein_IC2. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (11)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 5a (identifier: Q24246-11) [UniParc]FASTAAdd to basket

Also known as: J

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRKAELERK KAKLAALREE KDRRRREKEI KDMEEAAGRI GGGAGIDKDQ
60 70 80 90 100
RKDLDEMLSS LGVAPVSEVL SSLSSVNSMT SDNSNTQTPD ASLQATVNGQ
110 120 130 140 150
SGGKKQPLNL SVYNVQATNI PPKETLVYTK QTQTTSTGGG NGDVLSCHSS
160 170 180 190 200
PLSGYMEDWW RPRKAHATDY YDEYNLNPGL EWEDEFTDDE ESSLQNLGNG
210 220 230 240 250
FTSKLPPGYL THGLPTVKDV APAITPLEIK KETEVKKEVN ELSEEQKQMI
260 270 280 290 300
ILSENFQRFV VRAGRVIERA LSENVDIYTD YIGGGDSEEA NDERSHARLS
310 320 330 340 350
LNRVFYDERW SKNRCITSMD WSTHFPELVV GSYHNNEESP NEPDGVVMVW
360 370 380 390 400
NTKFKKSTPE DVFHCQSAVM STCFAKFNPN LILGGTYSGQ IVLWDNRVQK
410 420 430 440 450
RTPIQRTPLS AAAHTHPVYC LQMVGTQNAH NVISISSDGK LCSWSLDMLS
460 470 480 490 500
QPQDTLELQQ RQSKAIAITS MAFPANEINS LVMGSEDGYV YSASRHGLRS
510 520 530 540 550
GVNEVYERHL GPITGISTHY NQLSPDFGHL FLTSSIDWTI KLWSLKDTKP
560 570 580 590 600
LYSFEDNSDY VMDVAWSPVH PALFAAVDGS GRLDLWNLNQ DTEVPTASIV
610 620 630 640 650
VAGAPALNRV SWTPSGLHVC IGDEAGKLYV YDVAENLAQP SRDEWSRFNT
660
HLSEIKMNQS DEV
Length:663
Mass (Da):73,917
Last modified:July 3, 2003 - v3
Checksum:i4C726D4C5F47FAF7
GO
Isoform 1a (identifier: Q24246-2) [UniParc]FASTAAdd to basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYVLAFDAQG

Show »
Length:634
Mass (Da):70,249
Checksum:iF3267D4090F25E05
GO
Isoform 1b (identifier: Q24246-3) [UniParc]FASTAAdd to basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYG

Show »
Length:627
Mass (Da):69,505
Checksum:iAB436F70A431915B
GO
Isoform 1c (identifier: Q24246-4) [UniParc]FASTAAdd to basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYY

Show »
Length:626
Mass (Da):69,447
Checksum:iD96D9CD9AA89814A
GO
Isoform 2a (identifier: Q24246-5) [UniParc]FASTAAdd to basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.
     187-187: T → TG

Show »
Length:643
Mass (Da):71,458
Checksum:i900A25F62B24A451
GO
Isoform 2b (identifier: Q24246-6) [UniParc]FASTAAdd to basket

Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.

Show »
Length:642
Mass (Da):71,400
Checksum:i10271A56BFBC8B62
GO
Isoform 2c (identifier: Q24246-7) [UniParc]FASTAAdd to basket

Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.
     187-187: T → TVLAFDAQG

Show »
Length:650
Mass (Da):72,202
Checksum:i937440311CA820DE
GO
Isoform 3a (identifier: Q24246-8) [UniParc]FASTAAdd to basket

Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     144-171: Missing.
     187-187: T → TG

Show »
Length:636
Mass (Da):70,636
Checksum:i10882999594FBDD9
GO
Isoform 3b (identifier: Q24246-9) [UniParc]FASTAAdd to basket

Also known as: H

The sequence of this isoform differs from the canonical sequence as follows:
     144-171: Missing.

Show »
Length:635
Mass (Da):70,579
Checksum:i422B7524D4A50381
GO
Isoform 4 (identifier: Q24246-10) [UniParc]FASTAAdd to basket

Also known as: I

The sequence of this isoform differs from the canonical sequence as follows:
     146-187: SCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AFDAQG

Show »
Length:627
Mass (Da):69,428
Checksum:i6D17F8435B8C8BF8
GO
Isoform 5b (identifier: Q24246-12) [UniParc]FASTAAdd to basket

Also known as: K

The sequence of this isoform differs from the canonical sequence as follows:
     144-153: Missing.

Show »
Length:653
Mass (Da):72,906
Checksum:i3073C8F8F3B2FB59
GO

Sequence cautioni

The sequence AAC70942.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence AAC78306.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti47 – 471D → G in AAC78306 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70933 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70934 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70935 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70936 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70937 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70938 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70939 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70940 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70941 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70942 (PubMed:9774695).Curated
Sequence conflicti47 – 471D → G in AAC70943 (PubMed:9774695).Curated
Sequence conflicti139 – 1457GGNGDVL → AETAMV in AAB51185 (Ref. 6) Curated
Sequence conflicti235 – 2351V → L in AAB51185 (Ref. 6) Curated
Sequence conflicti296 – 2972HA → SM in AAB51185 (Ref. 6) Curated
Sequence conflicti521 – 5222NQ → KP in AAB51185 (Ref. 6) Curated
Sequence conflicti537 – 54812DWTIK…SLKDT → KIWSLKLPISSCQFSVVSGI NSN in AAB51185 (Ref. 6) CuratedAdd
BLAST
Sequence conflicti579 – 5791G → A in AAB51185 (Ref. 6) Curated
Sequence conflicti593 – 5931E → K in AAB51185 (Ref. 6) Curated
Sequence conflicti628 – 6281L → Q in AAB51185 (Ref. 6) Curated
Sequence conflicti645 – 66319WSRFN…QSDEV → IKMNQSVRSRTI in AAB51185 (Ref. 6) CuratedAdd
BLAST

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei144 – 18744VLSCH…EDEFT → AHATDYYVLAFDAQG in isoform 1a. 1 PublicationVSP_001345Add
BLAST
Alternative sequencei144 – 18744VLSCH…EDEFT → AHATDYYG in isoform 1b. 2 PublicationsVSP_001346Add
BLAST
Alternative sequencei144 – 18744VLSCH…EDEFT → AHATDYY in isoform 1c. 1 PublicationVSP_001347Add
BLAST
Alternative sequencei144 – 17128Missing in isoform 3a and isoform 3b. 1 PublicationVSP_001342Add
BLAST
Alternative sequencei144 – 16421Missing in isoform 2a, isoform 2b and isoform 2c. 2 PublicationsVSP_007686Add
BLAST
Alternative sequencei144 – 15310Missing in isoform 5b. 1 PublicationVSP_007685
Alternative sequencei146 – 18742SCHSS…EDEFT → AFDAQG in isoform 4. 1 PublicationVSP_001343Add
BLAST
Alternative sequencei187 – 1871T → TG in isoform 2a and isoform 3a. 1 PublicationVSP_001348
Alternative sequencei187 – 1871T → TVLAFDAQG in isoform 2c. 1 PublicationVSP_007687

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF070687 Genomic DNA. Translation: AAC78306.1. Sequence problems.
AF070689 mRNA. Translation: AAC70933.1.
AF070690 mRNA. Translation: AAC70934.1.
AF070691 mRNA. Translation: AAC70935.1.
AF070692 mRNA. Translation: AAC70936.1.
AF070693 mRNA. Translation: AAC70937.1.
AF070694 mRNA. Translation: AAC70938.1.
AF070695 mRNA. Translation: AAC70939.1.
AF070696 mRNA. Translation: AAC70940.1.
AF070697 mRNA. Translation: AAC70941.1.
AF070698 mRNA. Translation: AAC70942.1. Sequence problems.
AF070699 mRNA. Translation: AAC70943.1.
AF263371 mRNA. Translation: AAF73046.1.
AE014298 Genomic DNA. Translation: AAF50928.2.
AE014298 Genomic DNA. Translation: AAN09553.1.
AE014298 Genomic DNA. Translation: AAN09554.1.
AE014298 Genomic DNA. Translation: AAN09555.1.
AE014298 Genomic DNA. Translation: AAN09556.1.
AE014298 Genomic DNA. Translation: AAN09557.1.
AE014298 Genomic DNA. Translation: AAN09558.1.
AE014298 Genomic DNA. Translation: AAN09559.1.
AE014298 Genomic DNA. Translation: AAN09560.1.
AE014298 Genomic DNA. Translation: AAN09561.1.
AE014298 Genomic DNA. Translation: AAN09562.1.
BT016101 mRNA. Translation: AAV36986.1.
L41945 Genomic DNA. Translation: AAB51185.1.
RefSeqiNP_001285486.1. NM_001298557.1. [Q24246-2]
NP_477069.1. NM_057721.4. [Q24246-5]
NP_477070.1. NM_057722.4. [Q24246-8]
NP_477071.1. NM_057723.4. [Q24246-9]
NP_477072.1. NM_057724.4. [Q24246-10]
NP_477073.1. NM_057725.4. [Q24246-12]
NP_477074.1. NM_057726.4. [Q24246-2]
NP_477075.2. NM_057727.5. [Q24246-11]
NP_477076.1. NM_057728.4. [Q24246-4]
NP_477077.1. NM_057729.4. [Q24246-3]
NP_477078.1. NM_057730.5. [Q24246-6]
NP_477079.1. NM_057731.4. [Q24246-7]
NP_996521.1. NM_206798.2. [Q24246-5]
NP_996522.1. NM_206799.2. [Q24246-5]
UniGeneiDm.20780.

Genome annotation databases

EnsemblMetazoaiFBtr0089406; FBpp0088428; FBgn0003654. [Q24246-11]
GeneIDi44160.
KEGGidme:Dmel_CG18000.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF070687 Genomic DNA. Translation: AAC78306.1. Sequence problems.
AF070689 mRNA. Translation: AAC70933.1.
AF070690 mRNA. Translation: AAC70934.1.
AF070691 mRNA. Translation: AAC70935.1.
AF070692 mRNA. Translation: AAC70936.1.
AF070693 mRNA. Translation: AAC70937.1.
AF070694 mRNA. Translation: AAC70938.1.
AF070695 mRNA. Translation: AAC70939.1.
AF070696 mRNA. Translation: AAC70940.1.
AF070697 mRNA. Translation: AAC70941.1.
AF070698 mRNA. Translation: AAC70942.1. Sequence problems.
AF070699 mRNA. Translation: AAC70943.1.
AF263371 mRNA. Translation: AAF73046.1.
AE014298 Genomic DNA. Translation: AAF50928.2.
AE014298 Genomic DNA. Translation: AAN09553.1.
AE014298 Genomic DNA. Translation: AAN09554.1.
AE014298 Genomic DNA. Translation: AAN09555.1.
AE014298 Genomic DNA. Translation: AAN09556.1.
AE014298 Genomic DNA. Translation: AAN09557.1.
AE014298 Genomic DNA. Translation: AAN09558.1.
AE014298 Genomic DNA. Translation: AAN09559.1.
AE014298 Genomic DNA. Translation: AAN09560.1.
AE014298 Genomic DNA. Translation: AAN09561.1.
AE014298 Genomic DNA. Translation: AAN09562.1.
BT016101 mRNA. Translation: AAV36986.1.
L41945 Genomic DNA. Translation: AAB51185.1.
RefSeqiNP_001285486.1. NM_001298557.1. [Q24246-2]
NP_477069.1. NM_057721.4. [Q24246-5]
NP_477070.1. NM_057722.4. [Q24246-8]
NP_477071.1. NM_057723.4. [Q24246-9]
NP_477072.1. NM_057724.4. [Q24246-10]
NP_477073.1. NM_057725.4. [Q24246-12]
NP_477074.1. NM_057726.4. [Q24246-2]
NP_477075.2. NM_057727.5. [Q24246-11]
NP_477076.1. NM_057728.4. [Q24246-4]
NP_477077.1. NM_057729.4. [Q24246-3]
NP_477078.1. NM_057730.5. [Q24246-6]
NP_477079.1. NM_057731.4. [Q24246-7]
NP_996521.1. NM_206798.2. [Q24246-5]
NP_996522.1. NM_206799.2. [Q24246-5]
UniGeneiDm.20780.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2P2TX-ray3.00C123-138[»]
3FM7X-ray3.50C/D109-135[»]
3L9KX-ray3.00W/X/Y/Z242-279[»]
DisProtiDP00605.
ProteinModelPortaliQ24246.
SMRiQ24246. Positions 109-135, 242-279, 320-637.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi68871. 5 interactions.
DIPiDIP-19664N.
IntActiQ24246. 6 interactions.
MINTiMINT-1717948.
STRINGi7227.FBpp0088428.

Proteomic databases

PaxDbiQ24246.
PRIDEiQ24246.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0089406; FBpp0088428; FBgn0003654. [Q24246-11]
GeneIDi44160.
KEGGidme:Dmel_CG18000.

Organism-specific databases

CTDi44160.
FlyBaseiFBgn0003654. sw.

Phylogenomic databases

eggNOGiKOG1587. Eukaryota.
ENOG410XQ99. LUCA.
GeneTreeiENSGT00730000110228.
InParanoidiQ24246.
KOiK10415.
OMAiADEWTRF.
OrthoDBiEOG7FR7FX.
PhylomeDBiQ24246.

Enzyme and pathway databases

ReactomeiR-DME-6807878. COPI-mediated anterograde transport.
R-DME-6811436. COPI-independent Golgi-to-ER retrograde traffic.
SignaLinkiQ24246.

Miscellaneous databases

EvolutionaryTraceiQ24246.
GenomeRNAii44160.
PROiQ24246.

Gene expression databases

BgeeiQ24246.
GenevisibleiQ24246. DM.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR025956. DYNC1I1/DYNC1I2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF11540. Dynein_IC2. 1 hit.
[Graphical view]
SMARTiSM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cytoplasmic dynein intermediate-chain isoforms with different targeting properties created by tissue-specific alternative splicing."
    Nurminsky D.I., Nurminskaya M.V., Benevolenskaya E.V., Shevelyov Y.Y., Hartl D.L., Gvozdev V.A.
    Mol. Cell. Biol. 18:6816-6825(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1A; 1B; 1C; 2A; 2B; 2C; 3A; 3B; 4; 5A AND 5B), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Ovary.
  2. "A molecular genetic analysis of the interaction between the cytoplasmic dynein intermediate chain and the glued (Dynactin) complex."
    Boylan K., Serr M., Hays T.S.
    Mol. Biol. Cell 11:3791-3803(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2B), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Ovary.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A., Pacleb J.M., Park S., Wan K.H., Yu C., Rubin G.M., Celniker S.E.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1B).
    Strain: Berkeley.
    Tissue: Embryo.
  6. "Cluster of tandem repeats in Drosophila genome comprising putative genes encoding cytoplasmic dynein intermediate chain and 3'-part of annexin X."
    Benevolenskaya E.V., Gvozdev V.A.
    Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 101-663 (ISOFORM 4).
    Strain: GT WA.

Entry informationi

Entry nameiDYIN_DROME
AccessioniPrimary (citable) accession number: Q24246
Secondary accession number(s): O96508
, O96510, O96511, O96512, O96513, O96514, O96515, O96516, Q5U0Z1, Q86BQ5, Q9NG49, Q9TZR7, Q9TZR8, Q9TZR9, Q9TZS0, Q9VR78
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 3, 2003
Last modified: July 6, 2016
This is version 167 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.