Q24246 (DYIN_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 138.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytoplasmic dynein 1 intermediate chain Short name=DH IC Alternative name(s): Dynein intermediate chain, cytosolic Protein short wing | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 663 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the help dynein bind to dynactin 150 kDa component By similarity. Ref.2 |
| Subunit structure | Homodimer By similarity. The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs) By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton Ref.1. Isoform 2c: Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Aggregates in cytoplasm around lysosomes. Ref.1 Isoform 2a: Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Note: Aggregates in cytoplasm around the nucleus. Ref.1 Isoform 2b: Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Note: Aggregates in cytoplasm around the nucleus. Ref.1 |
| Tissue specificity | High levels of isoform 1b, isoform 1c, isoform 3a and isoform 4 accumulate in early egg chambers and at stage 9 become concentrated at the posterior of the oocyte. Isoform 5a and isoform 5b are highly expressed in adult head and to a lesser extent in adult torso. Isoform 1a, isoform 2a and isoform 2b are found in all tissues examined, including ovaries, midgut, torso and head. Ref.1 Ref.2 |
| Developmental stage | Expressed both maternally and zygotically. Abundant in embryos and adults, low levels in larva and pupae. Isoform 1a, isoform 2a and isoform 2b are constitutively expressed at high levels and isoform 2c at low levels in embryos and adults. Ref.1 |
| Sequence similarities | Belongs to the dynein intermediate chain family. Contains 7 WD repeats. |
| Sequence caution | The sequence AAC70942.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAC78306.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 5a (identifier: Q24246-11) Also known as: J; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1a (identifier: Q24246-2) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYVLAFDAQG | ||||||
| Isoform 1b (identifier: Q24246-3) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYG | ||||||
| Isoform 1c (identifier: Q24246-4) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYY | ||||||
| Isoform 2a (identifier: Q24246-5) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 144-164: Missing. 187-187: T → TG | ||||||
| Isoform 2b (identifier: Q24246-6) Also known as: E; The sequence of this isoform differs from the canonical sequence as follows: 144-164: Missing. | ||||||
| Isoform 2c (identifier: Q24246-7) Also known as: F; The sequence of this isoform differs from the canonical sequence as follows: 144-164: Missing. 187-187: T → TVLAFDAQG | ||||||
| Isoform 3a (identifier: Q24246-8) Also known as: G; The sequence of this isoform differs from the canonical sequence as follows: 144-171: Missing. 187-187: T → TG | ||||||
| Isoform 3b (identifier: Q24246-9) Also known as: H; The sequence of this isoform differs from the canonical sequence as follows: 144-171: Missing. | ||||||
| Isoform 4 (identifier: Q24246-10) Also known as: I; The sequence of this isoform differs from the canonical sequence as follows: 146-187: SCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AFDAQG | ||||||
| Isoform 5b (identifier: Q24246-12) Also known as: K; The sequence of this isoform differs from the canonical sequence as follows: 144-153: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 663 | 663 | Cytoplasmic dynein 1 intermediate chain | PRO_0000114661 | |||||||||||||
Regions | |||||||||||||||||
| Repeat | 311 – 360 | 50 | WD 1 | ||||||||||||||
| Repeat | 364 – 404 | 41 | WD 2 | ||||||||||||||
| Repeat | 413 – 454 | 42 | WD 3 | ||||||||||||||
| Repeat | 463 – 503 | 41 | WD 4 | ||||||||||||||
| Repeat | 508 – 553 | 46 | WD 5 | ||||||||||||||
| Repeat | 556 – 596 | 41 | WD 6 | ||||||||||||||
| Repeat | 602 – 641 | 40 | WD 7 | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 144 – 187 | 44 | VLSCH…EDEFT → AHATDYYVLAFDAQG in isoform 1a. | VSP_001345 | |||||||||||||
| Alternative sequence | 144 – 187 | 44 | VLSCH…EDEFT → AHATDYYG in isoform 1b. | VSP_001346 | |||||||||||||
| Alternative sequence | 144 – 187 | 44 | VLSCH…EDEFT → AHATDYY in isoform 1c. | VSP_001347 | |||||||||||||
| Alternative sequence | 144 – 171 | 28 | Missing in isoform 3a and isoform 3b. | VSP_001342 | |||||||||||||
| Alternative sequence | 144 – 164 | 21 | Missing in isoform 2a, isoform 2b and isoform 2c. | VSP_007686 | |||||||||||||
| Alternative sequence | 144 – 153 | 10 | Missing in isoform 5b. | VSP_007685 | |||||||||||||
| Alternative sequence | 146 – 187 | 42 | SCHSS…EDEFT → AFDAQG in isoform 4. | VSP_001343 | |||||||||||||
| Alternative sequence | 187 | 1 | T → TG in isoform 2a and isoform 3a. | VSP_001348 | |||||||||||||
| Alternative sequence | 187 | 1 | T → TVLAFDAQG in isoform 2c. | VSP_007687 | |||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC78306. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70933. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70934. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70935. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70936. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70937. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70938. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70939. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70940. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70941. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70942. Ref.1 | ||||||||||||||
| Sequence conflict | 47 | 1 | D → G in AAC70943. Ref.1 | ||||||||||||||
| Sequence conflict | 139 – 145 | 7 | GGNGDVL → AETAMV in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 235 | 1 | V → L in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 296 – 297 | 2 | HA → SM in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 521 – 522 | 2 | NQ → KP in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 537 – 548 | 12 | DWTIK…SLKDT → KIWSLKLPISSCQFSVVSGI NSN in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 579 | 1 | G → A in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 593 | 1 | E → K in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 628 | 1 | L → Q in AAB51185. Ref.6 | ||||||||||||||
| Sequence conflict | 645 – 663 | 19 | WSRFN…QSDEV → IKMNQSVRSRTI in AAB51185. Ref.6 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Beta strand | 110 – 112 | 3 | |||||||||||||||
| Beta strand | 128 – 133 | 6 | |||||||||||||||
| Helix | 244 – 251 | 8 | |||||||||||||||
| Helix | 254 – 273 | 20 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cytoplasmic dynein intermediate-chain isoforms with different targeting properties created by tissue-specific alternative splicing." Nurminsky D.I., Nurminskaya M.V., Benevolenskaya E.V., Shevelyov Y.Y., Hartl D.L., Gvozdev V.A. Mol. Cell. Biol. 18:6816-6825(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1A; 1B; 1C; 2A; 2B; 2C; 3A; 3B; 4; 5A AND 5B), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Ovary. |
| [2] | "A molecular genetic analysis of the interaction between the cytoplasmic dynein intermediate chain and the glued (Dynactin) complex." Boylan K., Serr M., Hays T.S. Mol. Biol. Cell 11:3791-3803(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2B), FUNCTION, TISSUE SPECIFICITY. Tissue: Ovary. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A., Pacleb J.M., Park S., Wan K.H., Yu C., Rubin G.M., Celniker S.E. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1B). Strain: Berkeley. Tissue: Embryo. |
| [6] | "Cluster of tandem repeats in Drosophila genome comprising putative genes encoding cytoplasmic dynein intermediate chain and 3'-part of annexin X." Benevolenskaya E.V., Gvozdev V.A. Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 101-663 (ISOFORM 4). Strain: GT WA. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF070687 Genomic DNA. Translation: AAC78306.1. Sequence problems. AF070689 mRNA. Translation: AAC70933.1. AF070690 mRNA. Translation: AAC70934.1. AF070691 mRNA. Translation: AAC70935.1. AF070692 mRNA. Translation: AAC70936.1. AF070693 mRNA. Translation: AAC70937.1. AF070694 mRNA. Translation: AAC70938.1. AF070695 mRNA. Translation: AAC70939.1. AF070696 mRNA. Translation: AAC70940.1. AF070697 mRNA. Translation: AAC70941.1. AF070698 mRNA. Translation: AAC70942.1. Sequence problems. AF070699 mRNA. Translation: AAC70943.1. AF263371 mRNA. Translation: AAF73046.1. AE014298 Genomic DNA. Translation: AAF50928.2. AE014298 Genomic DNA. Translation: AAN09553.1. AE014298 Genomic DNA. Translation: AAN09554.1. AE014298 Genomic DNA. Translation: AAN09555.1. AE014298 Genomic DNA. Translation: AAN09556.1. AE014298 Genomic DNA. Translation: AAN09557.1. AE014298 Genomic DNA. Translation: AAN09558.1. AE014298 Genomic DNA. Translation: AAN09559.1. AE014298 Genomic DNA. Translation: AAN09560.1. AE014298 Genomic DNA. Translation: AAN09561.1. AE014298 Genomic DNA. Translation: AAN09562.1. BT016101 mRNA. Translation: AAV36986.1. L41945 Genomic DNA. Translation: AAB51185.1. | ||||||||||||||||||||||||
| RefSeq | NP_477069.1. NM_057721.3. NP_477070.1. NM_057722.3. NP_477071.1. NM_057723.3. NP_477072.1. NM_057724.3. NP_477073.1. NM_057725.3. NP_477074.1. NM_057726.3. NP_477075.2. NM_057727.4. NP_477076.1. NM_057728.3. NP_477077.1. NM_057729.3. NP_477078.1. NM_057730.4. NP_477079.1. NM_057731.3. NP_996521.1. NM_206798.1. NP_996522.1. NM_206799.1. | ||||||||||||||||||||||||
| UniGene | Dm.20780. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q24246. | ||||||||||||||||||||||||
| SMR | Q24246. Positions 109-135, 242-279, 320-637. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-19664N. | ||||||||||||||||||||||||
| IntAct | Q24246. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-1717948. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q24246. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| EnsemblMetazoa | FBtr0089406; FBpp0088428; FBgn0003654. | ||||||||||||||||||||||||
| GeneID | 44160. | ||||||||||||||||||||||||
| KEGG | dme:Dmel_CG18000. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 44160. | ||||||||||||||||||||||||
| FlyBase | FBgn0003654. sw. | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG308180. | ||||||||||||||||||||||||
| GeneTree | ENSGT00690000101848. | ||||||||||||||||||||||||
| InParanoid | Q24246. | ||||||||||||||||||||||||
| KO | K10415. | ||||||||||||||||||||||||
| OMA | SAGHEDS. | ||||||||||||||||||||||||
| OrthoDB | EOG4WWQ0J. | ||||||||||||||||||||||||
| PhylomeDB | Q24246. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| Bgee | Q24246. | ||||||||||||||||||||||||
| GermOnline | CG18000. Drosophila melanogaster. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 2.130.10.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR025956. Dynein_IC_1/2. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR017986. WD40_repeat_dom. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF11540. Dynein_IC2. 1 hit. PF00400. WD40. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00320. WD40. 6 hits. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF50978. WD40_like. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. 1 hit. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | SLC4A1. drosophila. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q24246. | ||||||||||||||||||||||||
| GenomeRNAi | 44160. | ||||||||||||||||||||||||
| NextBio | 836907. | ||||||||||||||||||||||||
Entry information
| Entry name | DYIN_DROME | ||||||||
| Accession | Primary (citable) accession number: Q24246 Secondary accession number(s): O96508 Q9VR78 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
