Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear hormone receptor family member nhr-34

Gene

nhr-34

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Orphan nuclear receptor.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi148 – 22376Nuclear receptorPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri151 – 17121NR C4-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri187 – 20620NR C4-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear hormone receptor family member nhr-34
Gene namesi
Name:nhr-34
ORF Names:F58G6.5
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome IV

Organism-specific databases

WormBaseiF58G6.5a; CE27764; WBGene00003627; nhr-34.
F58G6.5b; CE35564; WBGene00003627; nhr-34.
F58G6.5c; CE35565; WBGene00003627; nhr-34.
F58G6.5d; CE42612; WBGene00003627; nhr-34.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 631631Nuclear hormone receptor family member nhr-34PRO_0000053777Add
BLAST

Proteomic databases

PaxDbiQ21006.
PRIDEiQ21006.

PTM databases

iPTMnetiQ21006.

Expressioni

Gene expression databases

BgeeiWBGene00003627.

Interactioni

Protein-protein interaction databases

BioGridi42905. 3 interactions.
IntActiQ21006. 1 interaction.
MINTiMINT-1097384.
STRINGi6239.F58G6.5c.

Structurei

3D structure databases

ProteinModelPortaliQ21006.
SMRiQ21006. Positions 151-243, 368-577.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the nuclear hormone receptor family.Curated
Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri151 – 17121NR C4-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri187 – 20620NR C4-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00840000130053.
HOGENOMiHOG000022311.
InParanoidiQ21006.
OMAiDDTQVNE.
OrthoDBiEOG091G074R.
PhylomeDBiQ21006.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform c (identifier: Q21006-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTDYCIFNIS WMSDRFGCET GNEDVQECID KSPNGSPTTS TTHRRQNSSS
60 70 80 90 100
GLEPARKRPK LSPPVLTAMP LDLTDAVSPN ESQACTSSLK GVVTAAGAAQ
110 120 130 140 150
MSVADRMTSS SVAPPLCIVP RSVEFINPKT EDMSMDIPMG NVQSEFTGLK
160 170 180 190 200
CRVCGDSRAG RHYGTIACNG CKGFFRRSIW EQRDYVCRFG GKCLVVQEYR
210 220 230 240 250
NRCRACRLRK CFTVGMDARA VQSERDKHKK NPKDSNNEGS TSPQYPTAST
260 270 280 290 300
PISIPSTSTS QTPTSSVNSY NFQNIPGIVS RSFSENLIMR DNSVPVMETS
310 320 330 340 350
QSAALSHVPL VRYLIDLEKA TDNLIDENCD FMSMEFDQLC RVDVTIEAAF
360 370 380 390 400
RQPGVVAKRT PPRWLALERL TTLEDVHIAW CRSFVLCIDY AKIMKDYQEL
410 420 430 440 450
SPTDQFTLLR NRVISVNWLC HTYKTFKAGC DGVALVNGSW YPRDKELQKQ
460 470 480 490 500
LDPGCNHYFR ILSEHLMEDL VIPMREMDMD EGEFVILKAL ILFRAHRRLS
510 520 530 540 550
EEGRAHIKRV RDKYIEALYQ HVQHQHRHFS SVQTSMRISK ILLLLPSIEH
560 570 580 590 600
LSQQEDDNVQ FLALFNLANL NGLPYELHSS IKQHIPNGDD SDDTQVNEVT
610 620 630
SNNDGPRSSE SSHTPQSVST SQFLEFKPSL H
Note: No experimental confirmation available.
Length:631
Mass (Da):71,163
Last modified:September 5, 2006 - v3
Checksum:iF3865DF71DC4D9ED
GO
Isoform a (identifier: Q21006-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MTDYCIFNISWM → MAESKFSILKGE
     13-144: Missing.

Show »
Length:499
Mass (Da):57,088
Checksum:i2E13343C94AE11D8
GO
Isoform b (identifier: Q21006-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MTDYCIFNISWMSDRFGCETGNEDVQECIDKS → MDDLHQQLHQNYN

Note: No experimental confirmation available.
Show »
Length:612
Mass (Da):69,080
Checksum:i81A6D3377C258855
GO
Isoform d (identifier: Q21006-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.

Note: No experimental confirmation available.
Show »
Length:563
Mass (Da):63,633
Checksum:i5F0B487DC9529DA4
GO

Sequence cautioni

The sequence AAG15129 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868Missing in isoform d. CuratedVSP_053631Add
BLAST
Alternative sequencei1 – 3232MTDYC…CIDKS → MDDLHQQLHQNYN in isoform b. CuratedVSP_020155Add
BLAST
Alternative sequencei1 – 1212MTDYC…NISWM → MAESKFSILKGE in isoform a. 1 PublicationVSP_003725Add
BLAST
Alternative sequencei13 – 144132Missing in isoform a. 1 PublicationVSP_020156Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF273780 mRNA. Translation: AAG15129.1. Different initiation.
Z68217 Genomic DNA. Translation: CAA92467.2.
Z68217 Genomic DNA. Translation: CAC70099.2.
Z68217, Z68222 Genomic DNA. Translation: CAE46673.1.
Z68217 Genomic DNA. Translation: CAQ58113.1.
PIRiT22948.
RefSeqiNP_001023245.1. NM_001028074.3. [Q21006-3]
NP_001129859.1. NM_001136387.2. [Q21006-4]
NP_501716.2. NM_069315.4.
NP_741480.1. NM_171412.3. [Q21006-2]
UniGeneiCel.12785.

Genome annotation databases

EnsemblMetazoaiF58G6.5c; F58G6.5c; WBGene00003627. [Q21006-3]
GeneIDi177800.
KEGGicel:CELE_F58G6.5.
UCSCiF58G6.5a. c. elegans. [Q21006-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF273780 mRNA. Translation: AAG15129.1. Different initiation.
Z68217 Genomic DNA. Translation: CAA92467.2.
Z68217 Genomic DNA. Translation: CAC70099.2.
Z68217, Z68222 Genomic DNA. Translation: CAE46673.1.
Z68217 Genomic DNA. Translation: CAQ58113.1.
PIRiT22948.
RefSeqiNP_001023245.1. NM_001028074.3. [Q21006-3]
NP_001129859.1. NM_001136387.2. [Q21006-4]
NP_501716.2. NM_069315.4.
NP_741480.1. NM_171412.3. [Q21006-2]
UniGeneiCel.12785.

3D structure databases

ProteinModelPortaliQ21006.
SMRiQ21006. Positions 151-243, 368-577.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi42905. 3 interactions.
IntActiQ21006. 1 interaction.
MINTiMINT-1097384.
STRINGi6239.F58G6.5c.

PTM databases

iPTMnetiQ21006.

Proteomic databases

PaxDbiQ21006.
PRIDEiQ21006.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiF58G6.5c; F58G6.5c; WBGene00003627. [Q21006-3]
GeneIDi177800.
KEGGicel:CELE_F58G6.5.
UCSCiF58G6.5a. c. elegans. [Q21006-1]

Organism-specific databases

CTDi177800.
WormBaseiF58G6.5a; CE27764; WBGene00003627; nhr-34.
F58G6.5b; CE35564; WBGene00003627; nhr-34.
F58G6.5c; CE35565; WBGene00003627; nhr-34.
F58G6.5d; CE42612; WBGene00003627; nhr-34.

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00840000130053.
HOGENOMiHOG000022311.
InParanoidiQ21006.
OMAiDDTQVNE.
OrthoDBiEOG091G074R.
PhylomeDBiQ21006.

Miscellaneous databases

PROiQ21006.

Gene expression databases

BgeeiWBGene00003627.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNHR34_CAEEL
AccessioniPrimary (citable) accession number: Q21006
Secondary accession number(s): B3GWB8
, Q7JM21, Q95NU3, Q9GTH8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 5, 2006
Last modified: September 7, 2016
This is version 142 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.