Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q20432

- CNEP1_CAEEL

UniProt

Q20432 - CNEP1_CAEEL

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

CTD nuclear envelope phosphatase 1 homolog

Gene

cnep-1

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 4 out of 5- Protein inferred from homologyi

Functioni

Serine/threonine protein phosphatase that may dephosphorylate and activate lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol.1 Publication

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

GO - Molecular functioni

  1. protein serine/threonine phosphatase activity Source: UniProtKB

GO - Biological processi

  1. nuclear envelope organization Source: UniProtKB
  2. positive regulation of triglyceride biosynthetic process Source: UniProtKB
  3. protein dephosphorylation Source: UniProtKB
  4. regulation of nuclear division Source: WormBase
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
CTD nuclear envelope phosphatase 1 homolog (EC:3.1.3.16)
Short name:
CTDNEP1
Alternative name(s):
Serine/threonine-protein phosphatase dullard homolog
Small C-terminal domain phosphatase-like phosphatase 21
Gene namesi
Name:cnep-1
Synonyms:scpl-2
ORF Names:F45E12.1
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome II

Organism-specific databases

WormBaseiF45E12.1a; CE02737; WBGene00018474; cnep-1.
F45E12.1b; CE46930; WBGene00018474; cnep-1.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. endoplasmic reticulum membrane Source: UniProtKB
  3. integral component of membrane Source: UniProtKB-KW
  4. Nem1-Spo7 phosphatase complex Source: UniProtKB
  5. nuclear envelope Source: UniProtKB
  6. nuclear membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 246246CTD nuclear envelope phosphatase 1 homologPRO_0000297975Add
BLAST

Proteomic databases

PaxDbiQ20432.

Expressioni

Gene expression databases

ExpressionAtlasiQ20432. baseline.

Interactioni

Protein-protein interaction databases

STRINGi6239.F45E12.1.

Structurei

3D structure databases

ProteinModelPortaliQ20432.
SMRiQ20432. Positions 58-232.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei3 – 2321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini53 – 220168FCP1 homologyPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the dullard family.Curated
Contains 1 FCP1 homology domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5190.
GeneTreeiENSGT00550000075053.
InParanoidiQ20432.
KOiK17617.
OMAiSTNIMIF.
PhylomeDBiQ20432.

Family and domain databases

Gene3Di3.40.50.1000. 1 hit.
InterProiIPR011948. Dullard_phosphatase.
IPR023214. HAD-like_dom.
IPR004274. NIF.
[Graphical view]
PfamiPF03031. NIF. 1 hit.
[Graphical view]
SMARTiSM00577. CPDc. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR02251. HIF-SF_euk. 1 hit.
PROSITEiPS50969. FCP1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform a (identifier: Q20432-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTIAQSVFC FLAGFFNFFL LYFRKTSRAY CKYQVVKYHS NIPMSPLTTH
60 70 80 90 100
RLLTVKRKIL VLDLDETLIH SHHDGVLRQT VKPGTPSDFT IRVVIDRHPV
110 120 130 140 150
KFSVHERPHV DYFLSVVSQW YELVVFTASM EVYGTSVADR LDRGRGILKR
160 170 180 190 200
RYFRQHCTME VGGYTKDLSA IHPDLSSICI LDNSPGAYRK FPHNAIPIPS
210 220 230 240
WFSDPNDTCL LNLLPFLDAL RFTSDVRSVL SRNMQALPET QSVQYY

Note: No experimental confirmation available.

Length:246
Mass (Da):28,414
Last modified:November 1, 1996 - v1
Checksum:i7D60A06A050EA3EA
GO
Isoform b (identifier: Q20432-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYVPNRQFGGGNPESHRRRDQKQASLVLRTM

Note: No experimental confirmation available.

Show »
Length:276
Mass (Da):31,895
Checksum:i1C1AE11E1C600915
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MYVPNRQFGGGNPESHRRRD QKQASLVLRTM in isoform b. CuratedVSP_056100

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
FO080734 Genomic DNA. Translation: CCD66263.1.
FO080734 Genomic DNA. Translation: CCF23398.1.
PIRiT16371.
RefSeqiNP_001254123.1. NM_001267194.1.
NP_001254124.1. NM_001267195.1.
UniGeneiCel.15079.

Genome annotation databases

EnsemblMetazoaiF45E12.1a; F45E12.1a; WBGene00018474. [Q20432-1]
F45E12.1b; F45E12.1b; WBGene00018474. [Q20432-2]
GeneIDi185802.
KEGGicel:CELE_F45E12.1.
UCSCiF45E12.1. c. elegans. [Q20432-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
FO080734 Genomic DNA. Translation: CCD66263.1 .
FO080734 Genomic DNA. Translation: CCF23398.1 .
PIRi T16371.
RefSeqi NP_001254123.1. NM_001267194.1.
NP_001254124.1. NM_001267195.1.
UniGenei Cel.15079.

3D structure databases

ProteinModelPortali Q20432.
SMRi Q20432. Positions 58-232.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 6239.F45E12.1.

Proteomic databases

PaxDbi Q20432.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai F45E12.1a ; F45E12.1a ; WBGene00018474 . [Q20432-1 ]
F45E12.1b ; F45E12.1b ; WBGene00018474 . [Q20432-2 ]
GeneIDi 185802.
KEGGi cel:CELE_F45E12.1.
UCSCi F45E12.1. c. elegans. [Q20432-1 ]

Organism-specific databases

CTDi 185802.
WormBasei F45E12.1a ; CE02737 ; WBGene00018474 ; cnep-1.
F45E12.1b ; CE46930 ; WBGene00018474 ; cnep-1.

Phylogenomic databases

eggNOGi COG5190.
GeneTreei ENSGT00550000075053.
InParanoidi Q20432.
KOi K17617.
OMAi STNIMIF.
PhylomeDBi Q20432.

Miscellaneous databases

NextBioi 929562.
PROi Q20432.

Gene expression databases

ExpressionAtlasi Q20432. baseline.

Family and domain databases

Gene3Di 3.40.50.1000. 1 hit.
InterProi IPR011948. Dullard_phosphatase.
IPR023214. HAD-like_dom.
IPR004274. NIF.
[Graphical view ]
Pfami PF03031. NIF. 1 hit.
[Graphical view ]
SMARTi SM00577. CPDc. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
TIGRFAMsi TIGR02251. HIF-SF_euk. 1 hit.
PROSITEi PS50969. FCP1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  2. "Molecular cloning and characterization of dullard: a novel gene required for neural development."
    Satow R., Chan T.C., Asashima M.
    Biochem. Biophys. Res. Commun. 295:85-91(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  3. "Nuclear envelope phosphatase-regulatory subunit 1 (formerly TMEM188) is the metazoan SPO7 ortholog and functions in the lipin activation pathway."
    Han S., Bahmanyar S., Zhang P., Grishin N., Oegema K., Crooke R., Graham M., Reue K., Dixon J.E., Goodman J.M.
    J. Biol. Chem. 287:3123-3137(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiCNEP1_CAEEL
AccessioniPrimary (citable) accession number: Q20432
Secondary accession number(s): H1ZUW4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: November 1, 1996
Last modified: October 29, 2014
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3