Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q20432

- CNEP1_CAEEL

UniProt

Q20432 - CNEP1_CAEEL

Protein

CTD nuclear envelope phosphatase 1 homolog

Gene

cnep-1

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 4 out of 5- Protein inferred from homologyi
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Serine/threonine protein phosphatase that may dephosphorylate and activate lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol.1 Publication

    Catalytic activityi

    [a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

    GO - Molecular functioni

    1. protein serine/threonine phosphatase activity Source: UniProtKB

    GO - Biological processi

    1. nuclear envelope organization Source: UniProtKB
    2. positive regulation of triglyceride biosynthetic process Source: UniProtKB
    3. protein dephosphorylation Source: UniProtKB
    4. regulation of nuclear division Source: WormBase

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    CTD nuclear envelope phosphatase 1 homolog (EC:3.1.3.16)
    Short name:
    CTDNEP1
    Alternative name(s):
    Serine/threonine-protein phosphatase dullard homolog
    Small C-terminal domain phosphatase-like phosphatase 21
    Gene namesi
    Name:cnep-1
    Synonyms:scpl-2
    ORF Names:F45E12.1
    OrganismiCaenorhabditis elegans
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome II

    Organism-specific databases

    WormBaseiF45E12.1a; CE02737; WBGene00018474; cnep-1.
    F45E12.1b; CE46930; WBGene00018474; cnep-1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. endoplasmic reticulum membrane Source: UniProtKB
    3. integral component of membrane Source: UniProtKB-KW
    4. Nem1-Spo7 phosphatase complex Source: UniProtKB
    5. nuclear envelope Source: UniProtKB
    6. nuclear membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 246246CTD nuclear envelope phosphatase 1 homologPRO_0000297975Add
    BLAST

    Proteomic databases

    PaxDbiQ20432.

    Interactioni

    Protein-protein interaction databases

    STRINGi6239.F45E12.1.

    Structurei

    3D structure databases

    ProteinModelPortaliQ20432.
    SMRiQ20432. Positions 58-232.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei3 – 2321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini53 – 220168FCP1 homologyPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the dullard family.Curated
    Contains 1 FCP1 homology domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5190.
    GeneTreeiENSGT00550000075053.
    InParanoidiQ20432.
    KOiK17617.
    OMAiSTNIMIF.
    PhylomeDBiQ20432.

    Family and domain databases

    Gene3Di3.40.50.1000. 1 hit.
    InterProiIPR011948. Dullard_phosphatase.
    IPR023214. HAD-like_dom.
    IPR004274. NIF.
    [Graphical view]
    PfamiPF03031. NIF. 1 hit.
    [Graphical view]
    SMARTiSM00577. CPDc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    TIGRFAMsiTIGR02251. HIF-SF_euk. 1 hit.
    PROSITEiPS50969. FCP1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform a (identifier: Q20432-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTTIAQSVFC FLAGFFNFFL LYFRKTSRAY CKYQVVKYHS NIPMSPLTTH    50
    RLLTVKRKIL VLDLDETLIH SHHDGVLRQT VKPGTPSDFT IRVVIDRHPV 100
    KFSVHERPHV DYFLSVVSQW YELVVFTASM EVYGTSVADR LDRGRGILKR 150
    RYFRQHCTME VGGYTKDLSA IHPDLSSICI LDNSPGAYRK FPHNAIPIPS 200
    WFSDPNDTCL LNLLPFLDAL RFTSDVRSVL SRNMQALPET QSVQYY 246

    Note: No experimental confirmation available.

    Length:246
    Mass (Da):28,414
    Last modified:November 1, 1996 - v1
    Checksum:i7D60A06A050EA3EA
    GO
    Isoform b (identifier: Q20432-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MYVPNRQFGGGNPESHRRRDQKQASLVLRTM

    Note: No experimental confirmation available.

    Show »
    Length:276
    Mass (Da):31,895
    Checksum:i1C1AE11E1C600915
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MYVPNRQFGGGNPESHRRRD QKQASLVLRTM in isoform b. CuratedVSP_056100

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FO080734 Genomic DNA. Translation: CCD66263.1.
    FO080734 Genomic DNA. Translation: CCF23398.1.
    PIRiT16371.
    RefSeqiNP_001254123.1. NM_001267194.1.
    NP_001254124.1. NM_001267195.1.
    UniGeneiCel.15079.

    Genome annotation databases

    EnsemblMetazoaiF45E12.1a; F45E12.1a; WBGene00018474.
    F45E12.1b; F45E12.1b; WBGene00018474.
    GeneIDi185802.
    KEGGicel:CELE_F45E12.1.
    UCSCiF45E12.1. c. elegans.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FO080734 Genomic DNA. Translation: CCD66263.1 .
    FO080734 Genomic DNA. Translation: CCF23398.1 .
    PIRi T16371.
    RefSeqi NP_001254123.1. NM_001267194.1.
    NP_001254124.1. NM_001267195.1.
    UniGenei Cel.15079.

    3D structure databases

    ProteinModelPortali Q20432.
    SMRi Q20432. Positions 58-232.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 6239.F45E12.1.

    Proteomic databases

    PaxDbi Q20432.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai F45E12.1a ; F45E12.1a ; WBGene00018474 .
    F45E12.1b ; F45E12.1b ; WBGene00018474 .
    GeneIDi 185802.
    KEGGi cel:CELE_F45E12.1.
    UCSCi F45E12.1. c. elegans.

    Organism-specific databases

    CTDi 185802.
    WormBasei F45E12.1a ; CE02737 ; WBGene00018474 ; cnep-1.
    F45E12.1b ; CE46930 ; WBGene00018474 ; cnep-1.

    Phylogenomic databases

    eggNOGi COG5190.
    GeneTreei ENSGT00550000075053.
    InParanoidi Q20432.
    KOi K17617.
    OMAi STNIMIF.
    PhylomeDBi Q20432.

    Miscellaneous databases

    NextBioi 929562.
    PROi Q20432.

    Family and domain databases

    Gene3Di 3.40.50.1000. 1 hit.
    InterProi IPR011948. Dullard_phosphatase.
    IPR023214. HAD-like_dom.
    IPR004274. NIF.
    [Graphical view ]
    Pfami PF03031. NIF. 1 hit.
    [Graphical view ]
    SMARTi SM00577. CPDc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    TIGRFAMsi TIGR02251. HIF-SF_euk. 1 hit.
    PROSITEi PS50969. FCP1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
      Strain: Bristol N2.
    2. "Molecular cloning and characterization of dullard: a novel gene required for neural development."
      Satow R., Chan T.C., Asashima M.
      Biochem. Biophys. Res. Commun. 295:85-91(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    3. "Nuclear envelope phosphatase-regulatory subunit 1 (formerly TMEM188) is the metazoan SPO7 ortholog and functions in the lipin activation pathway."
      Han S., Bahmanyar S., Zhang P., Grishin N., Oegema K., Crooke R., Graham M., Reue K., Dixon J.E., Goodman J.M.
      J. Biol. Chem. 287:3123-3137(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiCNEP1_CAEEL
    AccessioniPrimary (citable) accession number: Q20432
    Secondary accession number(s): H1ZUW4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 21, 2007
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 86 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3