Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q20375

- SPTC2_CAEEL

UniProt

Q20375 - SPTC2_CAEEL

Protein

Serine palmitoyltransferase 2

Gene

sptl-2

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 3 out of 5- Protein inferred from homologyi
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the serine palmitoyltransferase (SPT) that catalyzes the first committed step in sphingolipid biosynthesis, which is the condensation of an acyl-CoA species and L-serine. The catalytic core is composed of a heterodimer of sptl-1 and sptl-2 or sptl-1 and sptl-3 By similarity. Required for the specification of abicobasal polarity and development of the gut lumen.By similarity1 Publication

    Catalytic activityi

    Palmitoyl-CoA + L-serine = CoA + 3-dehydro-D-sphinganine + CO2.

    Cofactori

    Pyridoxal phosphate.By similarity

    Pathwayi

    GO - Molecular functioni

    1. pyridoxal phosphate binding Source: InterPro
    2. serine C-palmitoyltransferase activity Source: UniProtKB-EC

    GO - Biological processi

    1. biosynthetic process Source: InterPro
    2. sphingolipid metabolic process Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Acyltransferase, Transferase

    Keywords - Biological processi

    Lipid metabolism, Sphingolipid metabolism

    Keywords - Ligandi

    Pyridoxal phosphate

    Enzyme and pathway databases

    ReactomeiREACT_183003. Sphingolipid de novo biosynthesis.
    UniPathwayiUPA00222.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Serine palmitoyltransferase 2 (EC:2.3.1.50)
    Alternative name(s):
    Long chain base biosynthesis protein 2
    Short name:
    LCB 2
    Serine-palmitoyl-CoA transferase 2
    Short name:
    SPT 2
    Short name:
    SPT2
    Gene namesi
    Name:sptl-2
    ORF Names:F43H9.2
    OrganismiCaenorhabditis elegans
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome V

    Organism-specific databases

    WormBaseiF43H9.2a; CE07246; WBGene00018398; sptl-2.
    F43H9.2b; CE27380; WBGene00018398; sptl-2.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 558558Serine palmitoyltransferase 2PRO_0000421272Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei384 – 3841N6-(pyridoxal phosphate)lysineBy similarity

    Proteomic databases

    PaxDbiQ20375.
    PRIDEiQ20375.

    Interactioni

    Subunit structurei

    Heterodimer of sptl-1/sptl-2.By similarity

    Protein-protein interaction databases

    DIPiDIP-26394N.
    MINTiMINT-1096418.
    STRINGi6239.F43H9.2b.

    Structurei

    3D structure databases

    ProteinModelPortaliQ20375.
    SMRiQ20375. Positions 173-537.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG0156.
    GeneTreeiENSGT00550000074678.
    HOGENOMiHOG000206826.
    KOiK00654.
    OMAiSLKLIMG.
    OrthoDBiEOG73RBB0.

    Family and domain databases

    Gene3Di3.40.640.10. 1 hit.
    3.90.1150.10. 1 hit.
    InterProiIPR001917. Aminotrans_II_pyridoxalP_BS.
    IPR004839. Aminotransferase_I/II.
    IPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR015422. PyrdxlP-dep_Trfase_major_sub2.
    [Graphical view]
    PfamiPF00155. Aminotran_1_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF53383. SSF53383. 1 hit.
    PROSITEiPS00599. AA_TRANSFER_CLASS_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform a (identifier: Q20375-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSRRTDSLCL DEYLSSELKK RTHILECAWN QEHDDDEEEE EVKVDQGSEE    50
    TTSSHDIYGD VGKRAPNEFE KIDRLTTIKV YIAWLALFVF AHIREYVTRF 100
    GFVKDLSSKE NAKMKDFVPL FSDFEAFYQR NCYIKVRDVF ERPICSVPGA 150
    TVDLVDRVSH DGNWTYEYPG TRTNVINVGS YNYLGFAQSA GPCAEQSASS 200
    IDREGLSCCT TVHERGRSVS QAKLEKLVAE FLGVEDAICF SMGFATNSMN 250
    APCLVDKHSL IISDKYNHAS LILGCRLSGA STKVFEHNDM ESLERILRDA 300
    IAYGNPKTHR PYKKILIIVE GIYSMEGSIC NLPGIIALKK KYQAYLYLDE 350
    AHSIGAMGKT GKGVVEYWGC DPKDVDILMG TFTKSFGAAG GYIAGSKRTV 400
    DHLRAASPTG YYSSPMSPPI AQQIYTSMSI IMGKDGTKDG AQRIERLARN 450
    SHYFRMKLKQ NGFIVYGSND SPVVPMLIYF PTMCGFYGRE MLARNIGCVV 500
    VSFPATHMTE GRVRFCISAA HTKEQLDEVL ETVNLLGSMS RSKFSKRSHL 550
    YKNQKIEW 558
    Length:558
    Mass (Da):62,704
    Last modified:November 1, 1996 - v1
    Checksum:i2896A1C20966CB25
    GO
    Isoform b (identifier: Q20375-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-16: MSRRTDSLCLDEYLSS → MTSEVAKRNSPFRFLHKLPIRLTFTEKKSPLLISDLAKQREEND

    Show »
    Length:586
    Mass (Da):66,014
    Checksum:i9878E62F8E434CE7
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1616MSRRT…EYLSS → MTSEVAKRNSPFRFLHKLPI RLTFTEKKSPLLISDLAKQR EEND in isoform b. CuratedVSP_045379Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FO081377 Genomic DNA. Translation: CCD71173.1.
    FO081377 Genomic DNA. Translation: CCD71174.1.
    PIRiT29503.
    RefSeqiNP_505064.1. NM_072663.4. [Q20375-2]
    NP_505065.1. NM_072664.4. [Q20375-1]
    UniGeneiCel.3598.

    Genome annotation databases

    EnsemblMetazoaiF43H9.2a; F43H9.2a; WBGene00018398. [Q20375-1]
    GeneIDi266646.
    KEGGicel:CELE_F43H9.2.
    UCSCiF43H9.2b. c. elegans. [Q20375-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FO081377 Genomic DNA. Translation: CCD71173.1 .
    FO081377 Genomic DNA. Translation: CCD71174.1 .
    PIRi T29503.
    RefSeqi NP_505064.1. NM_072663.4. [Q20375-2 ]
    NP_505065.1. NM_072664.4. [Q20375-1 ]
    UniGenei Cel.3598.

    3D structure databases

    ProteinModelPortali Q20375.
    SMRi Q20375. Positions 173-537.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-26394N.
    MINTi MINT-1096418.
    STRINGi 6239.F43H9.2b.

    Proteomic databases

    PaxDbi Q20375.
    PRIDEi Q20375.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai F43H9.2a ; F43H9.2a ; WBGene00018398 . [Q20375-1 ]
    GeneIDi 266646.
    KEGGi cel:CELE_F43H9.2.
    UCSCi F43H9.2b. c. elegans. [Q20375-1 ]

    Organism-specific databases

    CTDi 266646.
    WormBasei F43H9.2a ; CE07246 ; WBGene00018398 ; sptl-2.
    F43H9.2b ; CE27380 ; WBGene00018398 ; sptl-2.

    Phylogenomic databases

    eggNOGi COG0156.
    GeneTreei ENSGT00550000074678.
    HOGENOMi HOG000206826.
    KOi K00654.
    OMAi SLKLIMG.
    OrthoDBi EOG73RBB0.

    Enzyme and pathway databases

    UniPathwayi UPA00222 .
    Reactomei REACT_183003. Sphingolipid de novo biosynthesis.

    Miscellaneous databases

    NextBioi 953104.
    PROi Q20375.

    Family and domain databases

    Gene3Di 3.40.640.10. 1 hit.
    3.90.1150.10. 1 hit.
    InterProi IPR001917. Aminotrans_II_pyridoxalP_BS.
    IPR004839. Aminotransferase_I/II.
    IPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR015422. PyrdxlP-dep_Trfase_major_sub2.
    [Graphical view ]
    Pfami PF00155. Aminotran_1_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53383. SSF53383. 1 hit.
    PROSITEi PS00599. AA_TRANSFER_CLASS_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
      Strain: Bristol N2.
    2. "Apicobasal domain identities of expanding tubular membranes depend on glycosphingolipid biosynthesis."
      Zhang H., Abraham N., Khan L.A., Hall D.H., Fleming J.T., Gobel V.
      Nat. Cell Biol. 13:1189-1201(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiSPTC2_CAEEL
    AccessioniPrimary (citable) accession number: Q20375
    Secondary accession number(s): Q95ZT7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 6, 2013
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3