Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q20375

- SPTC2_CAEEL

UniProt

Q20375 - SPTC2_CAEEL

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Serine palmitoyltransferase 2

Gene

sptl-2

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 3 out of 5- Protein inferred from homologyi

Functioni

Component of the serine palmitoyltransferase (SPT) that catalyzes the first committed step in sphingolipid biosynthesis, which is the condensation of an acyl-CoA species and L-serine. The catalytic core is composed of a heterodimer of sptl-1 and sptl-2 or sptl-1 and sptl-3 (By similarity). Required for the specification of abicobasal polarity and development of the gut lumen.By similarity1 Publication

Catalytic activityi

Palmitoyl-CoA + L-serine = CoA + 3-dehydro-D-sphinganine + CO2.

Cofactori

Pathwayi

GO - Molecular functioni

  1. pyridoxal phosphate binding Source: InterPro
  2. serine C-palmitoyltransferase activity Source: UniProtKB-EC

GO - Biological processi

  1. biosynthetic process Source: InterPro
  2. sphingolipid metabolic process Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Transferase

Keywords - Biological processi

Lipid metabolism, Sphingolipid metabolism

Keywords - Ligandi

Pyridoxal phosphate

Enzyme and pathway databases

ReactomeiREACT_183003. Sphingolipid de novo biosynthesis.
UniPathwayiUPA00222.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine palmitoyltransferase 2 (EC:2.3.1.50)
Alternative name(s):
Long chain base biosynthesis protein 2
Short name:
LCB 2
Serine-palmitoyl-CoA transferase 2
Short name:
SPT 2
Short name:
SPT2
Gene namesi
Name:sptl-2
ORF Names:F43H9.2
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome V

Organism-specific databases

WormBaseiF43H9.2a; CE07246; WBGene00018398; sptl-2.
F43H9.2b; CE27380; WBGene00018398; sptl-2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 558558Serine palmitoyltransferase 2PRO_0000421272Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei384 – 3841N6-(pyridoxal phosphate)lysineBy similarity

Proteomic databases

PaxDbiQ20375.
PRIDEiQ20375.

Interactioni

Subunit structurei

Heterodimer of sptl-1/sptl-2.By similarity

Protein-protein interaction databases

DIPiDIP-26394N.
MINTiMINT-1096418.
STRINGi6239.F43H9.2b.

Structurei

3D structure databases

ProteinModelPortaliQ20375.
SMRiQ20375. Positions 173-537.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0156.
GeneTreeiENSGT00550000074678.
HOGENOMiHOG000206826.
InParanoidiQ20375.
KOiK00654.
OMAiSLKLIMG.
OrthoDBiEOG73RBB0.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProiIPR001917. Aminotrans_II_pyridoxalP_BS.
IPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view]
PfamiPF00155. Aminotran_1_2. 1 hit.
[Graphical view]
SUPFAMiSSF53383. SSF53383. 1 hit.
PROSITEiPS00599. AA_TRANSFER_CLASS_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform a (identifier: Q20375-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRRTDSLCL DEYLSSELKK RTHILECAWN QEHDDDEEEE EVKVDQGSEE
60 70 80 90 100
TTSSHDIYGD VGKRAPNEFE KIDRLTTIKV YIAWLALFVF AHIREYVTRF
110 120 130 140 150
GFVKDLSSKE NAKMKDFVPL FSDFEAFYQR NCYIKVRDVF ERPICSVPGA
160 170 180 190 200
TVDLVDRVSH DGNWTYEYPG TRTNVINVGS YNYLGFAQSA GPCAEQSASS
210 220 230 240 250
IDREGLSCCT TVHERGRSVS QAKLEKLVAE FLGVEDAICF SMGFATNSMN
260 270 280 290 300
APCLVDKHSL IISDKYNHAS LILGCRLSGA STKVFEHNDM ESLERILRDA
310 320 330 340 350
IAYGNPKTHR PYKKILIIVE GIYSMEGSIC NLPGIIALKK KYQAYLYLDE
360 370 380 390 400
AHSIGAMGKT GKGVVEYWGC DPKDVDILMG TFTKSFGAAG GYIAGSKRTV
410 420 430 440 450
DHLRAASPTG YYSSPMSPPI AQQIYTSMSI IMGKDGTKDG AQRIERLARN
460 470 480 490 500
SHYFRMKLKQ NGFIVYGSND SPVVPMLIYF PTMCGFYGRE MLARNIGCVV
510 520 530 540 550
VSFPATHMTE GRVRFCISAA HTKEQLDEVL ETVNLLGSMS RSKFSKRSHL

YKNQKIEW
Length:558
Mass (Da):62,704
Last modified:November 1, 1996 - v1
Checksum:i2896A1C20966CB25
GO
Isoform b (identifier: Q20375-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MSRRTDSLCLDEYLSS → MTSEVAKRNSPFRFLHKLPIRLTFTEKKSPLLISDLAKQREEND

Show »
Length:586
Mass (Da):66,014
Checksum:i9878E62F8E434CE7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1616MSRRT…EYLSS → MTSEVAKRNSPFRFLHKLPI RLTFTEKKSPLLISDLAKQR EEND in isoform b. CuratedVSP_045379Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO081377 Genomic DNA. Translation: CCD71173.1.
FO081377 Genomic DNA. Translation: CCD71174.1.
PIRiT29503.
RefSeqiNP_505064.1. NM_072663.4. [Q20375-2]
NP_505065.1. NM_072664.4. [Q20375-1]
UniGeneiCel.3598.

Genome annotation databases

EnsemblMetazoaiF43H9.2a; F43H9.2a; WBGene00018398. [Q20375-1]
GeneIDi266646.
KEGGicel:CELE_F43H9.2.
UCSCiF43H9.2b. c. elegans. [Q20375-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO081377 Genomic DNA. Translation: CCD71173.1 .
FO081377 Genomic DNA. Translation: CCD71174.1 .
PIRi T29503.
RefSeqi NP_505064.1. NM_072663.4. [Q20375-2 ]
NP_505065.1. NM_072664.4. [Q20375-1 ]
UniGenei Cel.3598.

3D structure databases

ProteinModelPortali Q20375.
SMRi Q20375. Positions 173-537.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-26394N.
MINTi MINT-1096418.
STRINGi 6239.F43H9.2b.

Proteomic databases

PaxDbi Q20375.
PRIDEi Q20375.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai F43H9.2a ; F43H9.2a ; WBGene00018398 . [Q20375-1 ]
GeneIDi 266646.
KEGGi cel:CELE_F43H9.2.
UCSCi F43H9.2b. c. elegans. [Q20375-1 ]

Organism-specific databases

CTDi 266646.
WormBasei F43H9.2a ; CE07246 ; WBGene00018398 ; sptl-2.
F43H9.2b ; CE27380 ; WBGene00018398 ; sptl-2.

Phylogenomic databases

eggNOGi COG0156.
GeneTreei ENSGT00550000074678.
HOGENOMi HOG000206826.
InParanoidi Q20375.
KOi K00654.
OMAi SLKLIMG.
OrthoDBi EOG73RBB0.

Enzyme and pathway databases

UniPathwayi UPA00222 .
Reactomei REACT_183003. Sphingolipid de novo biosynthesis.

Miscellaneous databases

NextBioi 953104.
PROi Q20375.

Family and domain databases

Gene3Di 3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProi IPR001917. Aminotrans_II_pyridoxalP_BS.
IPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view ]
Pfami PF00155. Aminotran_1_2. 1 hit.
[Graphical view ]
SUPFAMi SSF53383. SSF53383. 1 hit.
PROSITEi PS00599. AA_TRANSFER_CLASS_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  2. "Apicobasal domain identities of expanding tubular membranes depend on glycosphingolipid biosynthesis."
    Zhang H., Abraham N., Khan L.A., Hall D.H., Fleming J.T., Gobel V.
    Nat. Cell Biol. 13:1189-1201(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiSPTC2_CAEEL
AccessioniPrimary (citable) accession number: Q20375
Secondary accession number(s): Q95ZT7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 6, 2013
Last sequence update: November 1, 1996
Last modified: November 26, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3