Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q20375 (SPTC2_CAEEL) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Serine palmitoyltransferase 2

EC=2.3.1.50
Alternative name(s):
Long chain base biosynthesis protein 2
Short name=LCB 2
Serine-palmitoyl-CoA transferase 2
Short name=SPT 2
Short name=SPT2
Gene names
Name:sptl-2
ORF Names:F43H9.2
OrganismCaenorhabditis elegans [Reference proteome]
Taxonomic identifier6239 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis

Protein attributes

Sequence length558 AA.
Sequence statusComplete.
Protein existenceInferred from homology

General annotation (Comments)

Function

Component of the serine palmitoyltransferase (SPT) that catalyzes the first committed step in sphingolipid biosynthesis, which is the condensation of an acyl-CoA species and L-serine. The catalytic core is composed of a heterodimer of sptl-1 and sptl-2 or sptl-1 and sptl-3 By similarity. Required for the specification of abicobasal polarity and development of the gut lumen. Ref.2

Catalytic activity

Palmitoyl-CoA + L-serine = CoA + 3-dehydro-D-sphinganine + CO2.

Cofactor

Pyridoxal phosphate By similarity.

Pathway

Lipid metabolism; sphingolipid metabolism.

Subunit structure

Heterodimer of sptl-1/sptl-2 By similarity.

Sequence similarities

Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform a (identifier: Q20375-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform b (identifier: Q20375-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MSRRTDSLCLDEYLSS → MTSEVAKRNSPFRFLHKLPIRLTFTEKKSPLLISDLAKQREEND

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 558558Serine palmitoyltransferase 2
PRO_0000421272

Amino acid modifications

Modified residue3841N6-(pyridoxal phosphate)lysine By similarity

Natural variations

Alternative sequence1 – 1616MSRRT…EYLSS → MTSEVAKRNSPFRFLHKLPI RLTFTEKKSPLLISDLAKQR EEND in isoform b.
VSP_045379

Sequences

Sequence LengthMass (Da)Tools
Isoform a [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 2896A1C20966CB25

FASTA55862,704
        10         20         30         40         50         60 
MSRRTDSLCL DEYLSSELKK RTHILECAWN QEHDDDEEEE EVKVDQGSEE TTSSHDIYGD 

        70         80         90        100        110        120 
VGKRAPNEFE KIDRLTTIKV YIAWLALFVF AHIREYVTRF GFVKDLSSKE NAKMKDFVPL 

       130        140        150        160        170        180 
FSDFEAFYQR NCYIKVRDVF ERPICSVPGA TVDLVDRVSH DGNWTYEYPG TRTNVINVGS 

       190        200        210        220        230        240 
YNYLGFAQSA GPCAEQSASS IDREGLSCCT TVHERGRSVS QAKLEKLVAE FLGVEDAICF 

       250        260        270        280        290        300 
SMGFATNSMN APCLVDKHSL IISDKYNHAS LILGCRLSGA STKVFEHNDM ESLERILRDA 

       310        320        330        340        350        360 
IAYGNPKTHR PYKKILIIVE GIYSMEGSIC NLPGIIALKK KYQAYLYLDE AHSIGAMGKT 

       370        380        390        400        410        420 
GKGVVEYWGC DPKDVDILMG TFTKSFGAAG GYIAGSKRTV DHLRAASPTG YYSSPMSPPI 

       430        440        450        460        470        480 
AQQIYTSMSI IMGKDGTKDG AQRIERLARN SHYFRMKLKQ NGFIVYGSND SPVVPMLIYF 

       490        500        510        520        530        540 
PTMCGFYGRE MLARNIGCVV VSFPATHMTE GRVRFCISAA HTKEQLDEVL ETVNLLGSMS 

       550 
RSKFSKRSHL YKNQKIEW 

« Hide

Isoform b [UniParc].

Checksum: 9878E62F8E434CE7
Show »

FASTA58666,014

References

« Hide 'large scale' references
[1]"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
Strain: Bristol N2.
[2]"Apicobasal domain identities of expanding tubular membranes depend on glycosphingolipid biosynthesis."
Zhang H., Abraham N., Khan L.A., Hall D.H., Fleming J.T., Gobel V.
Nat. Cell Biol. 13:1189-1201(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
FO081377 Genomic DNA. Translation: CCD71173.1.
FO081377 Genomic DNA. Translation: CCD71174.1.
PIRT29503.
RefSeqNP_505064.1. NM_072663.4. [Q20375-2]
NP_505065.1. NM_072664.4. [Q20375-1]
UniGeneCel.3598.

3D structure databases

ProteinModelPortalQ20375.
SMRQ20375. Positions 173-537.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-26394N.
MINTMINT-1096418.
STRING6239.F43H9.2b.

Proteomic databases

PaxDbQ20375.
PRIDEQ20375.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaF43H9.2a; F43H9.2a; WBGene00018398. [Q20375-1]
GeneID266646.
KEGGcel:CELE_F43H9.2.
UCSCF43H9.2b. c. elegans. [Q20375-1]

Organism-specific databases

CTD266646.
WormBaseF43H9.2a; CE07246; WBGene00018398; sptl-2.
F43H9.2b; CE27380; WBGene00018398; sptl-2.

Phylogenomic databases

eggNOGCOG0156.
GeneTreeENSGT00550000074678.
HOGENOMHOG000206826.
KOK00654.
OMASLKLIMG.
OrthoDBEOG73RBB0.

Enzyme and pathway databases

UniPathwayUPA00222.

Family and domain databases

Gene3D3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProIPR001917. Aminotrans_II_pyridoxalP_BS.
IPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view]
PfamPF00155. Aminotran_1_2. 1 hit.
[Graphical view]
SUPFAMSSF53383. SSF53383. 1 hit.
PROSITEPS00599. AA_TRANSFER_CLASS_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio953104.
PROQ20375.

Entry information

Entry nameSPTC2_CAEEL
AccessionPrimary (citable) accession number: Q20375
Secondary accession number(s): Q95ZT7
Entry history
Integrated into UniProtKB/Swiss-Prot: March 6, 2013
Last sequence update: November 1, 1996
Last modified: June 11, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

Caenorhabditis elegans

Caenorhabditis elegans: entries, gene names and cross-references to WormBase