Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein inscuteable homolog

Gene

INSC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as an adapter linking the Par3 complex to the GPSM1/GPSM2 complex (PubMed:16458856). Involved in spindle orientation during mitosis. May regulate cell proliferation and differentiation in the developing nervous system. May play a role in the asymmetric division of fibroblasts and participate in the process of stratification of the squamous epithelium (By similarity).By similarity1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Neurogenesis

Enzyme and pathway databases

BioCyciZFISH:G66-33562-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein inscuteable homolog
Gene namesi
Name:INSC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:33116. INSC.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Cytoplasmcell cortex 1 Publication

  • Note: Uniformly distributed in the cytoplasm during interphase. During metaphase, detected in the cell cortex, adjacent to the mitotic spindle poles.1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi78W → A: Abolishes interaction with GPSM2. 1 Publication1
Mutagenesisi89E → R: Strongly reduces interaction with GPSM2. Abolishes interaction with GPSM2 and GPSM1; when associated with D-97. 1 Publication1
Mutagenesisi97K → D: Abolishes interaction with GPSM2 and GPSM1; when associated with R-89. 1 Publication1

Organism-specific databases

DisGeNETi387755.
OpenTargetsiENSG00000188487.
PharmGKBiPA162392191.

Polymorphism and mutation databases

DMDMi116248172.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002524051 – 579Protein inscuteable homologAdd BLAST579

Proteomic databases

PaxDbiQ1MX18.
PRIDEiQ1MX18.

PTM databases

iPTMnetiQ1MX18.
PhosphoSitePlusiQ1MX18.

Expressioni

Tissue specificityi

Isoform 1 is expressed in various tissues with stronger expression in liver, kidney and small intestine. Isoform 2 is abundantly expressed in small intestine and to a lower extent in lung and pancreas.2 Publications

Developmental stagei

Expressed in fetal cochlea.1 Publication

Gene expression databases

BgeeiENSG00000188487.
CleanExiHS_INSC.
ExpressionAtlasiQ1MX18. baseline and differential.
GenevisibleiQ1MX18. HS.

Organism-specific databases

HPAiHPA039769.

Interactioni

Subunit structurei

Interacts with ALS2CR19/PAR3-beta and F2RL2/PAR3 (PubMed:16458856). Interacts with GPSM1/AGS3 and GPSM2/LGN (via TPR repeat region) (PubMed:16458856, PubMed:22074847). Identified in a complex with GPSM2 and F2RL2 (PubMed:16458856).2 Publications

Protein-protein interaction databases

BioGridi132426. 1 interactor.
IntActiQ1MX18. 3 interactors.
STRINGi9606.ENSP00000368872.

Structurei

Secondary structure

1579
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi73 – 82Combined sources10
Beta strandi91 – 95Combined sources5
Helixi103 – 105Combined sources3
Beta strandi109 – 112Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3SF4X-ray2.60D/E/F70-116[»]
ProteinModelPortaliQ1MX18.
SMRiQ1MX18.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni74 – 89Important for interaction with GPSM21 PublicationAdd BLAST16

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi576 – 579PDZ-binding4

Phylogenomic databases

eggNOGiENOG410IHN9. Eukaryota.
ENOG410XSNH. LUCA.
GeneTreeiENSGT00390000001511.
HOGENOMiHOG000060207.
HOVERGENiHBG079606.
InParanoidiQ1MX18.
OMAiTCHARSM.
OrthoDBiEOG091G0DWB.
PhylomeDBiQ1MX18.
TreeFamiTF323559.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR031938. INSC_LBD.
[Graphical view]
PfamiPF16748. INSC_LBD. 1 hit.
[Graphical view]
SMARTiSM00185. ARM. 3 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q1MX18-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRPPGNGEA ASEGPGGWGL WGVQESRRLC CAGHDRCKQA LLQIGINMMA
60 70 80 90 100
LPGGRHLDSV TLPGQRLHLM QVDSVQRWME DLKLMTECEC MCVLQAKPIS
110 120 130 140 150
LEEDAQGDLI LAGGPGPGDP LQLLLKRGWV ISTELRRIGQ KLAQDRWARV
160 170 180 190 200
HSMSVRLTCH ARSMVSEYSA VSRNSLKEMG EIEKLLMEKC SELSAVTERC
210 220 230 240 250
LQVENEHVLK SMKACVSETL SMLGQHFGQL LELALTREVQ ALVRKIDASD
260 270 280 290 300
NIYTTESTTG NLFSLTQEGA PLCRIIAKEG GVVALFKVCR QDSFRCLYPQ
310 320 330 340 350
ALRTLASICC VEEGVHQLEK VDGVLCLADI LTDNSHSEAT RAEAAAVVAQ
360 370 380 390 400
VTSPHLPVTQ HLSSFLESME EIVTALVKLC QEASSGEVFL LASAALANIT
410 420 430 440 450
FFDTMACEML LQLNAIRVLL EACSDKQRVD TPYTRDQIVT ILANMSVLEQ
460 470 480 490 500
CASDIIQENG VQLIMGMLSE KPRSGTPAEV AACERVQQKA AVTLARLSRD
510 520 530 540 550
PDVAREAVRL SCMSRLIELC RSPSERNSSD AVLVACLAAL RRLAGVCPEG
560 570
LQDSDFQQLV QPRLVDSFLL CSNMEESFV
Length:579
Mass (Da):63,469
Last modified:May 30, 2006 - v1
Checksum:i7CD8D19409FC3266
GO
Isoform 2 (identifier: Q1MX18-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.

Show »
Length:532
Mass (Da):58,454
Checksum:i46C413794E504E42
GO
Isoform 3 (identifier: Q1MX18-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
     204-238: ENEHVLKSMKACVSETLSMLGQHFGQLLELALTRE → MRREWEARMETHSPIWQNLLMRLDNCLALRLQSPL
     278-319: Missing.

Note: No experimental confirmation available.
Show »
Length:334
Mass (Da):36,669
Checksum:i1B97112A17E1ADE4
GO
Isoform 4 (identifier: Q1MX18-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     278-319: Missing.

Note: No experimental confirmation available.
Show »
Length:490
Mass (Da):53,774
Checksum:i00FB28A1F62B99FA
GO
Isoform 5 (identifier: Q1MX18-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     239-239: V → VQVESHSVTRLECSGAISAQCNLRLPGSSDSPASAS

Note: No experimental confirmation available.
Show »
Length:567
Mass (Da):61,981
Checksum:i33D225D70DCD9A67
GO
Isoform 6 (identifier: Q1MX18-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     539-579: ALRRLAGVCPEGLQDSDFQQLVQPRLVDSFLLCSNMEESFV → MGIQLQVKKTNISALLLWFLFWHIQGCSA

Note: No experimental confirmation available.
Show »
Length:520
Mass (Da):57,188
Checksum:i73DB667C8BEE3113
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti212M → T in BAE17134 (Ref. 2) Curated1
Sequence conflicti216V → M in BAE17135 (Ref. 2) Curated1
Sequence conflicti226H → R in BAE17133 (Ref. 2) Curated1
Sequence conflicti251N → D in BAE17134 (Ref. 2) Curated1
Sequence conflicti513M → T in BAE17135 (Ref. 2) Curated1
Sequence conflicti577 – 578SF → GS in BAE17136 (Ref. 2) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051073333D → N.Corresponds to variant rs17507577dbSNPEnsembl.1
Natural variantiVAR_027852450Q → R.Corresponds to variant rs7123855dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0209461 – 203Missing in isoform 3. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_0209471 – 47Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST47
Alternative sequenceiVSP_020948204 – 238ENEHV…ALTRE → MRREWEARMETHSPIWQNLL MRLDNCLALRLQSPL in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020949239V → VQVESHSVTRLECSGAISAQ CNLRLPGSSDSPASAS in isoform 5. 1 Publication1
Alternative sequenceiVSP_020950278 – 319Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_054159539 – 579ALRRL…EESFV → MGIQLQVKKTNISALLLWFL FWHIQGCSA in isoform 6. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB236158 mRNA. Translation: BAE93463.1.
AB236159 mRNA. Translation: BAE93464.1.
AB231744 mRNA. Translation: BAE46891.1.
AB231745 mRNA. Translation: BAE17133.1.
AB231746 mRNA. Translation: BAE17134.1.
AB231747 mRNA. Translation: BAE17135.1.
AB231748 mRNA. Translation: BAE17136.1.
AC090744 Genomic DNA. No translation available.
BC127700 mRNA. Translation: AAI27701.1.
CCDSiCCDS41621.1. [Q1MX18-1]
CCDS41622.1. [Q1MX18-2]
CCDS60735.1. [Q1MX18-6]
CCDS60736.1. [Q1MX18-4]
RefSeqiNP_001027024.3. NM_001031853.4. [Q1MX18-1]
NP_001036001.1. NM_001042536.2. [Q1MX18-2]
NP_001265242.1. NM_001278313.1. [Q1MX18-2]
NP_001265243.1. NM_001278314.1.
NP_001265244.1. NM_001278315.1. [Q1MX18-6]
NP_001265245.1. NM_001278316.1. [Q1MX18-4]
XP_006718290.1. XM_006718227.3. [Q1MX18-2]
XP_011518388.1. XM_011520086.1. [Q1MX18-6]
XP_016873186.1. XM_017017697.1. [Q1MX18-2]
UniGeneiHs.591997.

Genome annotation databases

EnsembliENST00000379554; ENSP00000368872; ENSG00000188487. [Q1MX18-1]
ENST00000379556; ENSP00000368874; ENSG00000188487. [Q1MX18-2]
ENST00000525218; ENSP00000436113; ENSG00000188487. [Q1MX18-4]
ENST00000528567; ENSP00000435022; ENSG00000188487. [Q1MX18-6]
ENST00000530161; ENSP00000436194; ENSG00000188487. [Q1MX18-2]
GeneIDi387755.
KEGGihsa:387755.
UCSCiuc001mly.5. human. [Q1MX18-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB236158 mRNA. Translation: BAE93463.1.
AB236159 mRNA. Translation: BAE93464.1.
AB231744 mRNA. Translation: BAE46891.1.
AB231745 mRNA. Translation: BAE17133.1.
AB231746 mRNA. Translation: BAE17134.1.
AB231747 mRNA. Translation: BAE17135.1.
AB231748 mRNA. Translation: BAE17136.1.
AC090744 Genomic DNA. No translation available.
BC127700 mRNA. Translation: AAI27701.1.
CCDSiCCDS41621.1. [Q1MX18-1]
CCDS41622.1. [Q1MX18-2]
CCDS60735.1. [Q1MX18-6]
CCDS60736.1. [Q1MX18-4]
RefSeqiNP_001027024.3. NM_001031853.4. [Q1MX18-1]
NP_001036001.1. NM_001042536.2. [Q1MX18-2]
NP_001265242.1. NM_001278313.1. [Q1MX18-2]
NP_001265243.1. NM_001278314.1.
NP_001265244.1. NM_001278315.1. [Q1MX18-6]
NP_001265245.1. NM_001278316.1. [Q1MX18-4]
XP_006718290.1. XM_006718227.3. [Q1MX18-2]
XP_011518388.1. XM_011520086.1. [Q1MX18-6]
XP_016873186.1. XM_017017697.1. [Q1MX18-2]
UniGeneiHs.591997.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3SF4X-ray2.60D/E/F70-116[»]
ProteinModelPortaliQ1MX18.
SMRiQ1MX18.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi132426. 1 interactor.
IntActiQ1MX18. 3 interactors.
STRINGi9606.ENSP00000368872.

PTM databases

iPTMnetiQ1MX18.
PhosphoSitePlusiQ1MX18.

Polymorphism and mutation databases

DMDMi116248172.

Proteomic databases

PaxDbiQ1MX18.
PRIDEiQ1MX18.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379554; ENSP00000368872; ENSG00000188487. [Q1MX18-1]
ENST00000379556; ENSP00000368874; ENSG00000188487. [Q1MX18-2]
ENST00000525218; ENSP00000436113; ENSG00000188487. [Q1MX18-4]
ENST00000528567; ENSP00000435022; ENSG00000188487. [Q1MX18-6]
ENST00000530161; ENSP00000436194; ENSG00000188487. [Q1MX18-2]
GeneIDi387755.
KEGGihsa:387755.
UCSCiuc001mly.5. human. [Q1MX18-1]

Organism-specific databases

CTDi387755.
DisGeNETi387755.
GeneCardsiINSC.
HGNCiHGNC:33116. INSC.
HPAiHPA039769.
MIMi610668. gene.
neXtProtiNX_Q1MX18.
OpenTargetsiENSG00000188487.
PharmGKBiPA162392191.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHN9. Eukaryota.
ENOG410XSNH. LUCA.
GeneTreeiENSGT00390000001511.
HOGENOMiHOG000060207.
HOVERGENiHBG079606.
InParanoidiQ1MX18.
OMAiTCHARSM.
OrthoDBiEOG091G0DWB.
PhylomeDBiQ1MX18.
TreeFamiTF323559.

Enzyme and pathway databases

BioCyciZFISH:G66-33562-MONOMER.

Miscellaneous databases

GenomeRNAii387755.
PROiQ1MX18.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000188487.
CleanExiHS_INSC.
ExpressionAtlasiQ1MX18. baseline and differential.
GenevisibleiQ1MX18. HS.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR031938. INSC_LBD.
[Graphical view]
PfamiPF16748. INSC_LBD. 1 hit.
[Graphical view]
SMARTiSM00185. ARM. 3 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiINSC_HUMAN
AccessioniPrimary (citable) accession number: Q1MX18
Secondary accession number(s): A0PJX5
, Q1MX19, Q3C1V6, Q4AC95, Q4AC96, Q4AC97, Q4AC98
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: May 30, 2006
Last modified: November 30, 2016
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.