Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Isopentenyl-diphosphate Delta-isomerase 1

Gene

IDI1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).By similarity

Catalytic activityi

Isopentenyl diphosphate = dimethylallyl diphosphate.

Cofactori

Mg2+By similarityNote: Binds 1 Mg2+ ion per subunit.By similarity

Pathwayi: dimethylallyl diphosphate biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes dimethylallyl diphosphate from isopentenyl diphosphate.
Proteins known to be involved in this subpathway in this organism are:
  1. Isopentenyl-diphosphate Delta-isomerase 1 (IDI1)
This subpathway is part of the pathway dimethylallyl diphosphate biosynthesis, which is itself part of Isoprenoid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes dimethylallyl diphosphate from isopentenyl diphosphate, the pathway dimethylallyl diphosphate biosynthesis and in Isoprenoid biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei36SubstrateBy similarity1
Metal bindingi40MagnesiumBy similarity1
Metal bindingi51MagnesiumBy similarity1
Binding sitei70SubstrateBy similarity1
Binding sitei74SubstrateBy similarity1
Active sitei86Proton acceptorBy similarity1
Binding sitei87SubstrateBy similarity1
Metal bindingi146MagnesiumBy similarity1
Active sitei1481
Metal bindingi148MagnesiumBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionIsomerase
Biological processCholesterol biosynthesis, Cholesterol metabolism, Isoprene biosynthesis, Lipid biosynthesis, Lipid metabolism, Steroid biosynthesis, Steroid metabolism, Sterol biosynthesis, Sterol metabolism
LigandMagnesium, Metal-binding

Enzyme and pathway databases

UniPathwayiUPA00059; UER00104.

Names & Taxonomyi

Protein namesi
Recommended name:
Isopentenyl-diphosphate Delta-isomerase 1 (EC:5.3.3.2)
Alternative name(s):
Isopentenyl pyrophosphate isomerase 1
Short name:
IPP isomerase 1
Short name:
IPPI1
Gene namesi
Name:IDI1
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Unplaced

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Peroxisome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002872791 – 227Isopentenyl-diphosphate Delta-isomerase 1Add BLAST227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei176N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ1LZ95.
PeptideAtlasiQ1LZ95.
PRIDEiQ1LZ95.

Interactioni

Subunit structurei

Monomer.By similarity

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000005323.

Structurei

3D structure databases

ProteinModelPortaliQ1LZ95.
SMRiQ1LZ95.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini49 – 199Nudix hydrolasePROSITE-ProRule annotationAdd BLAST151

Sequence similaritiesi

Belongs to the IPP isomerase type 1 family.Curated

Phylogenomic databases

eggNOGiKOG0142. Eukaryota.
COG1443. LUCA.
HOGENOMiHOG000274106.
HOVERGENiHBG002995.
InParanoidiQ1LZ95.
KOiK01823.
TreeFamiTF300129.

Family and domain databases

CDDicd02885. IPP_Isomerase. 1 hit.
InterProiView protein in InterPro
IPR011876. IsopentenylPP_isomerase_typ1.
IPR000086. NUDIX_hydrolase_dom.
IPR015797. NUDIX_hydrolase_dom-like.
PANTHERiPTHR10885. PTHR10885. 1 hit.
PfamiView protein in Pfam
PF00293. NUDIX. 1 hit.
PIRSFiPIRSF018427. Isopntndiph_ism. 1 hit.
SUPFAMiSSF55811. SSF55811. 1 hit.
TIGRFAMsiTIGR02150. IPP_isom_1. 1 hit.
PROSITEiView protein in PROSITE
PS51462. NUDIX. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q1LZ95-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPEVSTDDLD ERQVQLMAEM CILVDENDRR IGAETKKNCH LNENIERGLL
60 70 80 90 100
HRAFSVFLFN TENKLLLQQR SDAKITFPGC FTNTCCSHPL SNPSELEEND
110 120 130 140 150
AIGVRRAAQR RLKAELGIPM EEVPPEEINY LTRIHYKAQS DSIWGEHEID
160 170 180 190 200
YILLVKKNVT LNPDPNEIKS YCYVTKEELE ELIGKAAHGE IKITPWFQII
210 220
ADTFLFKWWD NLNRLNLFVD HEKIHRM
Length:227
Mass (Da):26,467
Last modified:May 15, 2007 - v2
Checksum:iDFD065798697F520
GO
Isoform 2 (identifier: Q1LZ95-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMWRALAPARAIGRAASGGGARIGGGARALGRSLKDTPPAVQPTVDGSCLRFPGRRGGWAA

Show »
Length:287
Mass (Da):32,477
Checksum:iABEEB4F8E27DF905
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0378881M → MMWRALAPARAIGRAASGGG ARIGGGARALGRSLKDTPPA VQPTVDGSCLRFPGRRGGWA A in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AAFC03067960 Genomic DNA. No translation available.
BC116133 mRNA. Translation: AAI16134.1.
RefSeqiNP_001069127.1. NM_001075659.1.
UniGeneiBt.3764.

Genome annotation databases

GeneIDi514293.
KEGGibta:514293.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiIDI1_BOVIN
AccessioniPrimary (citable) accession number: Q1LZ95
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: August 30, 2017
This is version 86 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families