ID EI3EB_DANRE Reviewed; 446 AA. AC Q1LUA8; Q1LUA7; DT 03-MAR-2009, integrated into UniProtKB/Swiss-Prot. DT 03-MAR-2009, sequence version 2. DT 27-MAR-2024, entry version 98. DE RecName: Full=Eukaryotic translation initiation factor 3 subunit E-B {ECO:0000255|HAMAP-Rule:MF_03004}; DE Short=eIF3e-B {ECO:0000255|HAMAP-Rule:MF_03004}; DE AltName: Full=Eukaryotic translation initiation factor 3 subunit 6-B {ECO:0000255|HAMAP-Rule:MF_03004}; GN Name=eif3eb; Synonyms=eif3s6b; ORFNames=si:ch211-129b17.1; OS Danio rerio (Zebrafish) (Brachydanio rerio). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; OC Danionidae; Danioninae; Danio. OX NCBI_TaxID=7955; RN [1] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=Tuebingen; RX PubMed=23594743; DOI=10.1038/nature12111; RA Howe K., Clark M.D., Torroja C.F., Torrance J., Berthelot C., Muffato M., RA Collins J.E., Humphray S., McLaren K., Matthews L., McLaren S., Sealy I., RA Caccamo M., Churcher C., Scott C., Barrett J.C., Koch R., Rauch G.J., RA White S., Chow W., Kilian B., Quintais L.T., Guerra-Assuncao J.A., Zhou Y., RA Gu Y., Yen J., Vogel J.H., Eyre T., Redmond S., Banerjee R., Chi J., Fu B., RA Langley E., Maguire S.F., Laird G.K., Lloyd D., Kenyon E., Donaldson S., RA Sehra H., Almeida-King J., Loveland J., Trevanion S., Jones M., Quail M., RA Willey D., Hunt A., Burton J., Sims S., McLay K., Plumb B., Davis J., RA Clee C., Oliver K., Clark R., Riddle C., Elliot D., Threadgold G., RA Harden G., Ware D., Begum S., Mortimore B., Kerry G., Heath P., RA Phillimore B., Tracey A., Corby N., Dunn M., Johnson C., Wood J., Clark S., RA Pelan S., Griffiths G., Smith M., Glithero R., Howden P., Barker N., RA Lloyd C., Stevens C., Harley J., Holt K., Panagiotidis G., Lovell J., RA Beasley H., Henderson C., Gordon D., Auger K., Wright D., Collins J., RA Raisen C., Dyer L., Leung K., Robertson L., Ambridge K., Leongamornlert D., RA McGuire S., Gilderthorp R., Griffiths C., Manthravadi D., Nichol S., RA Barker G., Whitehead S., Kay M., Brown J., Murnane C., Gray E., RA Humphries M., Sycamore N., Barker D., Saunders D., Wallis J., Babbage A., RA Hammond S., Mashreghi-Mohammadi M., Barr L., Martin S., Wray P., RA Ellington A., Matthews N., Ellwood M., Woodmansey R., Clark G., Cooper J., RA Tromans A., Grafham D., Skuce C., Pandian R., Andrews R., Harrison E., RA Kimberley A., Garnett J., Fosker N., Hall R., Garner P., Kelly D., Bird C., RA Palmer S., Gehring I., Berger A., Dooley C.M., Ersan-Urun Z., Eser C., RA Geiger H., Geisler M., Karotki L., Kirn A., Konantz J., Konantz M., RA Oberlander M., Rudolph-Geiger S., Teucke M., Lanz C., Raddatz G., RA Osoegawa K., Zhu B., Rapp A., Widaa S., Langford C., Yang F., RA Schuster S.C., Carter N.P., Harrow J., Ning Z., Herrero J., Searle S.M., RA Enright A., Geisler R., Plasterk R.H., Lee C., Westerfield M., RA de Jong P.J., Zon L.I., Postlethwait J.H., Nusslein-Volhard C., RA Hubbard T.J., Roest Crollius H., Rogers J., Stemple D.L.; RT "The zebrafish reference genome sequence and its relationship to the human RT genome."; RL Nature 496:498-503(2013). CC -!- FUNCTION: Component of the eukaryotic translation initiation factor 3 CC (eIF-3) complex, which is involved in protein synthesis of a CC specialized repertoire of mRNAs and, together with other initiation CC factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S CC ribosome. The eIF-3 complex specifically targets and initiates CC translation of a subset of mRNAs involved in cell proliferation. CC {ECO:0000255|HAMAP-Rule:MF_03004}. CC -!- SUBUNIT: Component of the eukaryotic translation initiation factor 3 CC (eIF-3) complex, which is composed of 13 subunits: eif3a, eif3b, eif3c, CC eif3d, eif3e, eif3f, eif3g, eif3h, eif3i, eif3j, eif3k, eif3l and CC eif3m. {ECO:0000255|HAMAP-Rule:MF_03004}. CC -!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_03004}. CC Nucleus {ECO:0000255|HAMAP-Rule:MF_03004}. CC -!- ALTERNATIVE PRODUCTS: CC Event=Alternative splicing; Named isoforms=2; CC Name=1; CC IsoId=Q1LUA8-1; Sequence=Displayed; CC Name=2; CC IsoId=Q1LUA8-2; Sequence=VSP_036544; CC -!- SIMILARITY: Belongs to the eIF-3 subunit E family. {ECO:0000255|HAMAP- CC Rule:MF_03004}. CC -!- SEQUENCE CAUTION: CC Sequence=CAK04060.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; CC Sequence=CAK04061.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; BX957242; CAK04060.1; ALT_SEQ; Genomic_DNA. DR EMBL; BX957242; CAK04061.1; ALT_SEQ; Genomic_DNA. DR AlphaFoldDB; Q1LUA8; -. DR SMR; Q1LUA8; -. DR PaxDb; 7955-ENSDARP00000003276; -. DR AGR; ZFIN:ZDB-GENE-050208-283; -. DR ZFIN; ZDB-GENE-050208-283; eif3eb. DR eggNOG; KOG2758; Eukaryota. DR InParanoid; Q1LUA8; -. DR PhylomeDB; Q1LUA8; -. DR PRO; PR:Q1LUA8; -. DR Proteomes; UP000000437; Genome assembly. DR GO; GO:0016282; C:eukaryotic 43S preinitiation complex; IEA:UniProtKB-UniRule. DR GO; GO:0033290; C:eukaryotic 48S preinitiation complex; IEA:UniProtKB-UniRule. DR GO; GO:0005852; C:eukaryotic translation initiation factor 3 complex; ISS:UniProtKB. DR GO; GO:0071540; C:eukaryotic translation initiation factor 3 complex, eIF3e; IEA:UniProtKB-UniRule. DR GO; GO:0005634; C:nucleus; IBA:GO_Central. DR GO; GO:0003743; F:translation initiation factor activity; IEA:UniProtKB-UniRule. DR GO; GO:0048856; P:anatomical structure development; IEA:UniProt. DR GO; GO:0001732; P:formation of cytoplasmic translation initiation complex; IEA:UniProtKB-UniRule. DR GO; GO:0006413; P:translational initiation; ISS:UniProtKB. DR CDD; cd21378; eIF3E; 1. DR HAMAP; MF_03004; eIF3e; 1. DR InterPro; IPR016650; eIF3e. DR InterPro; IPR019010; eIF3e_N. DR InterPro; IPR000717; PCI_dom. DR InterPro; IPR036390; WH_DNA-bd_sf. DR PANTHER; PTHR10317; EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT E; 1. DR PANTHER; PTHR10317:SF0; EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT E; 1. DR Pfam; PF09440; eIF3_N; 1. DR Pfam; PF21357; EIF3E_C; 1. DR Pfam; PF01399; PCI; 1. DR PIRSF; PIRSF016255; eIF3e_su6; 1. DR SMART; SM01186; eIF3_N; 1. DR SMART; SM00088; PINT; 1. DR SUPFAM; SSF46785; Winged helix' DNA-binding domain; 1. DR PROSITE; PS50250; PCI; 1. PE 3: Inferred from homology; KW Alternative splicing; Cytoplasm; Initiation factor; Nucleus; KW Protein biosynthesis; Reference proteome. FT CHAIN 1..446 FT /note="Eukaryotic translation initiation factor 3 subunit FT E-B" FT /id="PRO_0000365955" FT DOMAIN 222..399 FT /note="PCI" FT /evidence="ECO:0000255|PROSITE-ProRule:PRU01185" FT VAR_SEQ 390..446 FT /note="GHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKISHSNRNETPNWAAQ FT DTGFY -> QENWSVLQLPRYSRRNADL (in isoform 2)" FT /evidence="ECO:0000305" FT /id="VSP_036544" SQ SEQUENCE 446 AA; 52602 MW; 8E8CCD6B9C3317FD CRC64; MAEYDLTTRI AHFLDRHLVF PLLEFLSVKE IYNEKELLQG KLDLLSETNM VDFAMDVYKN LYPDKEIPHS LRDKRTTVVA QLKQLQSETE PIVKMFEDPE TQRQMQSTRD GRMLFEYLAD KHSFRQEYLD TLYRYAKFQY ECGNYSGAAE YLYFFRVLVP STDRNALSSL WGKLASEILM QNWEAAMEDL TRLRETIDNN TVSSPLQSLQ QRTWLIHWSL FVFFNHPKGR DNIIELFLYQ PQYLNAIQTM CPHILRYLST AVITNKDVRK RRQVLKDLVK VIQQESYTYK DPITEFVECL YVNFDFDSAQ RKLRECESVL VNDFFLVACL EDFIENARLF IFETFCRIHQ CISISMLADK LNMTPEEAER WIVNLIRNAR LDAKIDSKLG HVVMGNNAVS PYQQVIEKTK SLSFRSQMLA MNIEKKISHS NRNETPNWAA QDTGFY //