SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q19981

- TAG53_CAEEL

UniProt

Q19981 - TAG53_CAEEL

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Putative protein tag-53

Gene
tag-53, F33C8.1
Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. receptor activity Source: InterPro

GO - Biological processi

  1. multicellular organismal development Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Putative protein tag-53
Gene namesi
Name:tag-53
ORF Names:F33C8.1
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome X

Organism-specific databases

WormBaseiF33C8.1a; CE41898; WBGene00006432; tag-53.
F33C8.1b; CE41899; WBGene00006432; tag-53.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini? – 1175Extracellular Reviewed prediction
Transmembranei1176 – 119621Helical; Reviewed predictionAdd
BLAST
Topological domaini1197 – 1329133Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini? – 1329Putative protein tag-53PRO_0000017101
Signal peptidei1 – ? Reviewed prediction

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi66 ↔ 75 By similarity
Disulfide bondi70 ↔ 80 By similarity
Disulfide bondi82 ↔ 91 By similarity
Disulfide bondi94 ↔ 120 By similarity
Glycosylationi103 – 1031N-linked (GlcNAc...)1 Publication
Disulfide bondi144 ↔ 166 By similarity
Glycosylationi197 – 1971N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi205 ↔ 215 By similarity
Glycosylationi208 – 2081N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi209 ↔ 220 By similarity
Disulfide bondi222 ↔ 231 By similarity
Disulfide bondi236 ↔ 252 By similarity
Disulfide bondi247 ↔ 257 By similarity
Disulfide bondi259 ↔ 269 By similarity
Glycosylationi324 – 3241N-linked (GlcNAc...) Reviewed prediction
Glycosylationi395 – 3951N-linked (GlcNAc...) Reviewed prediction
Glycosylationi447 – 4471N-linked (GlcNAc...) Reviewed prediction
Glycosylationi481 – 4811N-linked (GlcNAc...) Reviewed prediction
Glycosylationi529 – 5291N-linked (GlcNAc...) Reviewed prediction
Glycosylationi555 – 5551N-linked (GlcNAc...)1 Publication
Glycosylationi820 – 8201N-linked (GlcNAc...) Reviewed prediction
Glycosylationi832 – 8321N-linked (GlcNAc...); atypical1 Publication
Glycosylationi833 – 8331N-linked (GlcNAc...) Reviewed prediction
Glycosylationi934 – 9341N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi945 ↔ 953 By similarity
Disulfide bondi947 ↔ 968 By similarity
Disulfide bondi971 ↔ 980 By similarity
Glycosylationi973 – 9731N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi983 ↔ 997 By similarity
Disulfide bondi1000 ↔ 1009 By similarity
Disulfide bondi1002 ↔ 1016 By similarity
Disulfide bondi1018 ↔ 1028 By similarity
Disulfide bondi1031 ↔ 1045 By similarity
Glycosylationi1066 – 10661N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1102 – 11021N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1147 – 11471N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ19981.
PRIDEiQ19981.

Interactioni

Protein-protein interaction databases

BioGridi46463. 4 interactions.
MINTiMINT-1127971.

Structurei

3D structure databases

ProteinModelPortaliQ19981.
SMRiQ19981. Positions 92-201, 205-272, 397-585, 942-1045.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini65 – 9228EGF-like 1Add
BLAST
Domaini94 – 203110CUBAdd
BLAST
Domaini204 – 23229EGF-like 2Add
BLAST
Domaini235 – 27036EGF-like 3Add
BLAST
Repeati302 – 35352Kelch 1Add
BLAST
Repeati355 – 40854Kelch 2Add
BLAST
Repeati416 – 46348Kelch 3Add
BLAST
Repeati471 – 51848Kelch 4Add
BLAST
Repeati520 – 57556Kelch 5Add
BLAST
Repeati577 – 61943Kelch 6Add
BLAST
Domaini945 – 99955Laminin EGF-like 1Add
BLAST
Domaini952 – 99847EGF-like 4Add
BLAST
Domaini1000 – 104748Laminin EGF-like 2Add
BLAST

Sequence similaritiesi

Contains 1 CUB domain.
Contains 4 EGF-like domains.
Contains 6 Kelch repeats.

Keywords - Domaini

EGF-like domain, Kelch repeat, Laminin EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG242225.
GeneTreeiENSGT00390000001118.
HOGENOMiHOG000018337.
InParanoidiQ19981.
OMAiMVVIFGH.
OrthoDBiEOG7D59MM.
PhylomeDBiQ19981.

Family and domain databases

Gene3Di2.120.10.80. 1 hit.
2.130.10.80. 1 hit.
2.60.120.290. 1 hit.
InterProiIPR000859. CUB_dom.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR002049. EGF_laminin.
IPR015916. Gal_Oxidase_b-propeller.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
IPR016201. Plexin-like_fold.
IPR002165. Plexin_repeat.
[Graphical view]
PfamiPF00431. CUB. 1 hit.
PF01344. Kelch_1. 2 hits.
PF00053. Laminin_EGF. 2 hits.
PF01437. PSI. 3 hits.
[Graphical view]
SMARTiSM00042. CUB. 1 hit.
SM00181. EGF. 2 hits.
SM00180. EGF_Lam. 2 hits.
SM00423. PSI. 3 hits.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 1 hit.
PROSITEiPS01180. CUB. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 1 hit.
PS01248. EGF_LAM_1. 1 hit.
PS50027. EGF_LAM_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform a (identifier: Q19981-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLGNITPVSF FKTWVLKKTD VHVMISAREV FPCFIFRVFL LFQVFSRVHT     50
LTNHANFEFE KSLSSCDKPC YNGVCLNKAC VCSKGWYGSQ CDHCFGRIRI 100
SDNASYISDG PLDYSPSAKC TWLIEPENSA TPLKIRINSF FTECGWDYLY 150
IYDGDSVYGK QLAALCGEQP SQEFTAASGK ALVHFFSDLA INLNGFNVSY 200
ESNRCAYNCS NHGSCLNGKC DCEDGYKGLN CEYQVCQLSG KSTESPCHEG 250
QCVDGRCECL SARVHGETCQ MPVSSSVWDL IHPTNNAPTG KASHASIAID 300
DVVWSIGGEF FDGSSDPNNI DVYNVTSRIW SKVEVSGDMP KPRFDHTVVK 350
YKNKLYMFGG VTKTQVRHQT TQAATNELWI FDMGSKKWAQ QIHKNETIIA 400
APFAVAGHSA HVIRSEMFVI FGYNPLFGFM HHVQIYNFET EEWTVANTSD 450
HVYGRFKHSA VEYTTPTGAT AILVYGGSMW NNTITDSLMQ FDTSTKKWSN 500
LPQSGVQLYL HAAAYLNGLM VVVGGRGSNV TAGSKSECFS NMVQSYDVAC 550
KQWSNMSTAP VDLKRFGHSV HVIGQKLYAL GGFNGKMKSD VWTLSPAKCS 600
SATRPDECRL ITDGTKCVFV DSSCVPFDPT VSYKSSFASM IKSSTPKSFD 650
ECTNTPLRLA LKTCEEQTDC VSCASKSGCG WCSSGEQCLP NEQECVDGPG 700
MLTSWEKCPQ RNSVATMRPC NMENNCGSCR ISPHCTWYPI DKASPCVSKE 750
DLSPAFFLVH SRRKGKNRDP NQYQAADMSR VPRAAAFNSL AVVYEYETKS 800
VLADRNKFLS PSHFPSFFRN ATECPMPCAQ RNNCSDCTDL EQCMWCPSTN 850
RCINLEAYTL SFAYGQCHSW VTSGSGSVIN RVCQAESVVC EEHKTCGECQ 900
RDPGCGWLAD DSKTGLGLCI RGTSTGPLEP KPENSTWYFI DCPACQCNGH 950
STCFTSVGSF PPVTIEKCQS CQNHTTGAHC ERCAPGFYGD ARNGGVCSPC 1000
DCHHQADMCD PVSGQCFCKT KGVTGDRCDK CEAKYVGNPR NGTPCFYELA 1050
VDFIFTFKLR SDDKDNHTSE IYLYSVPYKK DTDVTFQISC ESPKGNALVA 1100
LNMTSSYVNG LADKSQAMMV DTICDSKGFR RVYVASDKGY PFGPDSNTTF 1150
FVRVYNFNTP VQIVVSFAQS PPINWVLFFV IFAACFIVLL VVAGLLWMIK 1200
VRIEAYRRNQ RRIDEIEHMA SRPFASTKME LSMLSQFSSA GGPTPLSIEP 1250
CSNYRAGVFT LAVRLPTGGK AVTPSGTSGL AVASSLCLLT PQQVGVLQAQ 1300
DNGESNSGRK SNFRNLLRLT IRQRPNNND 1329
Length:1,329
Mass (Da):146,792
Last modified:April 8, 2008 - v3
Checksum:iF06715D15481925B
GO
Isoform b (identifier: Q19981-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     753-790: SPAFFLVHSRRKGKNRDPNQYQAADMSRVPRAAAFNSL → I

Note: No experimental confirmation available.

Show »
Length:1,292
Mass (Da):142,618
Checksum:i5F718BD3A331DEB1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei753 – 79038SPAFF…AFNSL → I in isoform b. VSP_007250Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF339882 mRNA. Translation: AAK14396.1.
Z69790 Genomic DNA. Translation: CAA93653.3.
Z69790 Genomic DNA. Translation: CAD56579.2.
PIRiT21694.
RefSeqiNP_001024625.2. NM_001029454.4. [Q19981-1]
NP_510443.4. NM_078042.4. [Q19981-2]
UniGeneiCel.8097.

Genome annotation databases

EnsemblMetazoaiF33C8.1a; F33C8.1a; WBGene00006432. [Q19981-1]
GeneIDi181566.
KEGGicel:CELE_F33C8.1.
UCSCiF33C8.1b. c. elegans. [Q19981-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF339882 mRNA. Translation: AAK14396.1 .
Z69790 Genomic DNA. Translation: CAA93653.3 .
Z69790 Genomic DNA. Translation: CAD56579.2 .
PIRi T21694.
RefSeqi NP_001024625.2. NM_001029454.4. [Q19981-1 ]
NP_510443.4. NM_078042.4. [Q19981-2 ]
UniGenei Cel.8097.

3D structure databases

ProteinModelPortali Q19981.
SMRi Q19981. Positions 92-201, 205-272, 397-585, 942-1045.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 46463. 4 interactions.
MINTi MINT-1127971.

Proteomic databases

PaxDbi Q19981.
PRIDEi Q19981.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai F33C8.1a ; F33C8.1a ; WBGene00006432 . [Q19981-1 ]
GeneIDi 181566.
KEGGi cel:CELE_F33C8.1.
UCSCi F33C8.1b. c. elegans. [Q19981-1 ]

Organism-specific databases

CTDi 181566.
WormBasei F33C8.1a ; CE41898 ; WBGene00006432 ; tag-53.
F33C8.1b ; CE41899 ; WBGene00006432 ; tag-53.

Phylogenomic databases

eggNOGi NOG242225.
GeneTreei ENSGT00390000001118.
HOGENOMi HOG000018337.
InParanoidi Q19981.
OMAi MVVIFGH.
OrthoDBi EOG7D59MM.
PhylomeDBi Q19981.

Miscellaneous databases

NextBioi 914466.

Family and domain databases

Gene3Di 2.120.10.80. 1 hit.
2.130.10.80. 1 hit.
2.60.120.290. 1 hit.
InterProi IPR000859. CUB_dom.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR002049. EGF_laminin.
IPR015916. Gal_Oxidase_b-propeller.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
IPR016201. Plexin-like_fold.
IPR002165. Plexin_repeat.
[Graphical view ]
Pfami PF00431. CUB. 1 hit.
PF01344. Kelch_1. 2 hits.
PF00053. Laminin_EGF. 2 hits.
PF01437. PSI. 3 hits.
[Graphical view ]
SMARTi SM00042. CUB. 1 hit.
SM00181. EGF. 2 hits.
SM00180. EGF_Lam. 2 hits.
SM00423. PSI. 3 hits.
[Graphical view ]
SUPFAMi SSF49854. SSF49854. 1 hit.
PROSITEi PS01180. CUB. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 1 hit.
PS01248. EGF_LAM_1. 1 hit.
PS50027. EGF_LAM_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of the correct 3' exon sequence for Caenorhabditis elegans attractin."
    Duke-Cohan J.S., Ashrafi K., Ruvkun G.
    Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
  2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  3. "Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins."
    Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T.
    Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-555; ASN-832 AND ASN-1147, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Bristol N2.

Entry informationi

Entry nameiTAG53_CAEEL
AccessioniPrimary (citable) accession number: Q19981
Secondary accession number(s): Q8I4J9, Q9BMB0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 8, 2008
Last modified: June 11, 2014
This is version 117 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi