Q19981 (TAG53_CAEEL) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative protein tag-53 | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans [Reference proteome] | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis![]() |
Protein attributes
| Sequence length | 1329 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass type I membrane protein By similarity. |
| Sequence similarities | Contains 1 CUB domain. Contains 4 EGF-like domains. Contains 6 Kelch repeats. Contains 2 laminin EGF-like domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | EGF-like domain Kelch repeat Laminin EGF-like domain Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: Q19981-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform b (identifier: Q19981-2) The sequence of this isoform differs from the canonical sequence as follows: 753-790: SPAFFLVHSRRKGKNRDPNQYQAADMSRVPRAAAFNSL → I | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – ? | Potential | |||||||||
| Chain | ? – 1329 | Putative protein tag-53 | PRO_0000017101 | ||||||||
Regions | |||||||||||
| Topological domain | ? – 1175 | Extracellular Potential | |||||||||
| Transmembrane | 1176 – 1196 | 21 | Helical; Potential | ||||||||
| Topological domain | 1197 – 1329 | 133 | Cytoplasmic Potential | ||||||||
| Domain | 65 – 92 | 28 | EGF-like 1 | ||||||||
| Domain | 94 – 203 | 110 | CUB | ||||||||
| Domain | 204 – 232 | 29 | EGF-like 2 | ||||||||
| Domain | 235 – 270 | 36 | EGF-like 3 | ||||||||
| Repeat | 302 – 353 | 52 | Kelch 1 | ||||||||
| Repeat | 355 – 408 | 54 | Kelch 2 | ||||||||
| Repeat | 416 – 463 | 48 | Kelch 3 | ||||||||
| Repeat | 471 – 518 | 48 | Kelch 4 | ||||||||
| Repeat | 520 – 575 | 56 | Kelch 5 | ||||||||
| Repeat | 577 – 619 | 43 | Kelch 6 | ||||||||
| Domain | 945 – 999 | 55 | Laminin EGF-like 1 | ||||||||
| Domain | 952 – 998 | 47 | EGF-like 4 | ||||||||
| Domain | 1000 – 1047 | 48 | Laminin EGF-like 2 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Ref.3 | ||||||||
| Glycosylation | 197 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 208 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 324 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 395 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 447 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 481 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 529 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 555 | 1 | N-linked (GlcNAc...) Ref.3 | ||||||||
| Glycosylation | 820 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 832 | 1 | N-linked (GlcNAc...) Ref.3 | ||||||||
| Glycosylation | 833 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 934 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 973 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1066 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1102 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1147 | 1 | N-linked (GlcNAc...) Ref.3 | ||||||||
| Disulfide bond | 66 ↔ 75 | By similarity | |||||||||
| Disulfide bond | 70 ↔ 80 | By similarity | |||||||||
| Disulfide bond | 82 ↔ 91 | By similarity | |||||||||
| Disulfide bond | 94 ↔ 120 | By similarity | |||||||||
| Disulfide bond | 144 ↔ 166 | By similarity | |||||||||
| Disulfide bond | 205 ↔ 215 | By similarity | |||||||||
| Disulfide bond | 209 ↔ 220 | By similarity | |||||||||
| Disulfide bond | 222 ↔ 231 | By similarity | |||||||||
| Disulfide bond | 236 ↔ 252 | By similarity | |||||||||
| Disulfide bond | 247 ↔ 257 | By similarity | |||||||||
| Disulfide bond | 259 ↔ 269 | By similarity | |||||||||
| Disulfide bond | 945 ↔ 953 | By similarity | |||||||||
| Disulfide bond | 947 ↔ 968 | By similarity | |||||||||
| Disulfide bond | 971 ↔ 980 | By similarity | |||||||||
| Disulfide bond | 983 ↔ 997 | By similarity | |||||||||
| Disulfide bond | 1000 ↔ 1009 | By similarity | |||||||||
| Disulfide bond | 1002 ↔ 1016 | By similarity | |||||||||
| Disulfide bond | 1018 ↔ 1028 | By similarity | |||||||||
| Disulfide bond | 1031 ↔ 1045 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 753 – 790 | 38 | SPAFF…AFNSL → I in isoform b. | VSP_007250 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of the correct 3' exon sequence for Caenorhabditis elegans attractin." Duke-Cohan J.S., Ashrafi K., Ruvkun G. Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [2] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| [3] | "Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins." Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T. Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-555; ASN-832 AND ASN-1147, MASS SPECTROMETRY. Strain: Bristol N2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF339882 mRNA. Translation: AAK14396.1. Z69790 Genomic DNA. Translation: CAA93653.3. Z69790 Genomic DNA. Translation: CAD56579.2. |
| PIR | T21694. |
| RefSeq | NP_001024625.2. NM_001029454.4. NP_510443.4. NM_078042.4. |
| UniGene | Cel.8097. |
3D structure databases | |
| ProteinModelPortal | Q19981. |
| SMR | Q19981. Positions 92-201, 397-585, 942-1045. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1127971. |
Proteomic databases | |
| PaxDb | Q19981. |
| PRIDE | Q19981. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | F33C8.1a; F33C8.1a; F33C8.1. |
| GeneID | 181566. |
| KEGG | cel:CELE_F33C8.1. |
| UCSC | F33C8.1b. c. elegans. |
Organism-specific databases | |
| CTD | 181566. |
| WormBase | F33C8.1a; CE41898; WBGene00006432; tag-53. F33C8.1b; CE41899; WBGene00006432; tag-53. |
Phylogenomic databases | |
| eggNOG | NOG242225. |
| GeneTree | ENSGT00390000001118. |
| HOGENOM | HOG000018337. |
| InParanoid | Q19981. |
| OMA | MVVIFGH. |
Family and domain databases | |
| Gene3D | 2.120.10.80. 1 hit. 2.130.10.80. 1 hit. 2.60.120.290. 1 hit. |
| InterPro | IPR000859. CUB_dom. IPR000742. EG-like_dom. IPR013032. EGF-like_CS. IPR002049. EGF_laminin. IPR015916. Gal_Oxidase_b-propeller. IPR015915. Kelch-typ_b-propeller. IPR006652. Kelch_1. IPR003659. Plexin-like. IPR002165. Plexin_repeat. [Graphical view] |
| Pfam | PF00431. CUB. 1 hit. PF01344. Kelch_1. 2 hits. PF00053. Laminin_EGF. 2 hits. PF01437. PSI. 3 hits. [Graphical view] |
| SMART | SM00042. CUB. 1 hit. SM00181. EGF. 2 hits. SM00180. EGF_Lam. 2 hits. SM00423. PSI. 3 hits. [Graphical view] |
| SUPFAM | SSF49854. CUB. 1 hit. |
| PROSITE | PS01180. CUB. 1 hit. PS00022. EGF_1. 2 hits. PS01186. EGF_2. 2 hits. PS50026. EGF_3. 1 hit. PS01248. EGF_LAM_1. 1 hit. PS50027. EGF_LAM_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 914466. |
Entry information
| Entry name | TAG53_CAEEL | ||||||||
| Accession | Primary (citable) accession number: Q19981 Secondary accession number(s): Q8I4J9, Q9BMB0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
