Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q19981 (TAG53_CAEEL) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Putative protein tag-53
Gene names
Name:tag-53
ORF Names:F33C8.1
OrganismCaenorhabditis elegans [Reference proteome]
Taxonomic identifier6239 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis

Protein attributes

Sequence length1329 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Membrane; Single-pass type I membrane protein By similarity.

Sequence similarities

Contains 1 CUB domain.

Contains 4 EGF-like domains.

Contains 6 Kelch repeats.

Contains 2 laminin EGF-like domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform a (identifier: Q19981-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform b (identifier: Q19981-2)

The sequence of this isoform differs from the canonical sequence as follows:
     753-790: SPAFFLVHSRRKGKNRDPNQYQAADMSRVPRAAAFNSL → I
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – ? Potential
Chain? – 1329Putative protein tag-53PRO_0000017101

Regions

Topological domain? – 1175Extracellular Potential
Transmembrane1176 – 119621Helical; Potential
Topological domain1197 – 1329133Cytoplasmic Potential
Domain65 – 9228EGF-like 1
Domain94 – 203110CUB
Domain204 – 23229EGF-like 2
Domain235 – 27036EGF-like 3
Repeat302 – 35352Kelch 1
Repeat355 – 40854Kelch 2
Repeat416 – 46348Kelch 3
Repeat471 – 51848Kelch 4
Repeat520 – 57556Kelch 5
Repeat577 – 61943Kelch 6
Domain945 – 99955Laminin EGF-like 1
Domain952 – 99847EGF-like 4
Domain1000 – 104748Laminin EGF-like 2

Amino acid modifications

Glycosylation1031N-linked (GlcNAc...) Ref.3
Glycosylation1971N-linked (GlcNAc...) Potential
Glycosylation2081N-linked (GlcNAc...) Potential
Glycosylation3241N-linked (GlcNAc...) Potential
Glycosylation3951N-linked (GlcNAc...) Potential
Glycosylation4471N-linked (GlcNAc...) Potential
Glycosylation4811N-linked (GlcNAc...) Potential
Glycosylation5291N-linked (GlcNAc...) Potential
Glycosylation5551N-linked (GlcNAc...) Ref.3
Glycosylation8201N-linked (GlcNAc...) Potential
Glycosylation8321N-linked (GlcNAc...); atypical Ref.3
Glycosylation8331N-linked (GlcNAc...) Potential
Glycosylation9341N-linked (GlcNAc...) Potential
Glycosylation9731N-linked (GlcNAc...) Potential
Glycosylation10661N-linked (GlcNAc...) Potential
Glycosylation11021N-linked (GlcNAc...) Potential
Glycosylation11471N-linked (GlcNAc...) Ref.3
Disulfide bond66 ↔ 75 By similarity
Disulfide bond70 ↔ 80 By similarity
Disulfide bond82 ↔ 91 By similarity
Disulfide bond94 ↔ 120 By similarity
Disulfide bond144 ↔ 166 By similarity
Disulfide bond205 ↔ 215 By similarity
Disulfide bond209 ↔ 220 By similarity
Disulfide bond222 ↔ 231 By similarity
Disulfide bond236 ↔ 252 By similarity
Disulfide bond247 ↔ 257 By similarity
Disulfide bond259 ↔ 269 By similarity
Disulfide bond945 ↔ 953 By similarity
Disulfide bond947 ↔ 968 By similarity
Disulfide bond971 ↔ 980 By similarity
Disulfide bond983 ↔ 997 By similarity
Disulfide bond1000 ↔ 1009 By similarity
Disulfide bond1002 ↔ 1016 By similarity
Disulfide bond1018 ↔ 1028 By similarity
Disulfide bond1031 ↔ 1045 By similarity

Natural variations

Alternative sequence753 – 79038SPAFF…AFNSL → I in isoform b.
VSP_007250

Sequences

Sequence LengthMass (Da)Tools
Isoform a [UniParc].

Last modified April 8, 2008. Version 3.
Checksum: F06715D15481925B

FASTA1,329146,792
        10         20         30         40         50         60 
MLGNITPVSF FKTWVLKKTD VHVMISAREV FPCFIFRVFL LFQVFSRVHT LTNHANFEFE 

        70         80         90        100        110        120 
KSLSSCDKPC YNGVCLNKAC VCSKGWYGSQ CDHCFGRIRI SDNASYISDG PLDYSPSAKC 

       130        140        150        160        170        180 
TWLIEPENSA TPLKIRINSF FTECGWDYLY IYDGDSVYGK QLAALCGEQP SQEFTAASGK 

       190        200        210        220        230        240 
ALVHFFSDLA INLNGFNVSY ESNRCAYNCS NHGSCLNGKC DCEDGYKGLN CEYQVCQLSG 

       250        260        270        280        290        300 
KSTESPCHEG QCVDGRCECL SARVHGETCQ MPVSSSVWDL IHPTNNAPTG KASHASIAID 

       310        320        330        340        350        360 
DVVWSIGGEF FDGSSDPNNI DVYNVTSRIW SKVEVSGDMP KPRFDHTVVK YKNKLYMFGG 

       370        380        390        400        410        420 
VTKTQVRHQT TQAATNELWI FDMGSKKWAQ QIHKNETIIA APFAVAGHSA HVIRSEMFVI 

       430        440        450        460        470        480 
FGYNPLFGFM HHVQIYNFET EEWTVANTSD HVYGRFKHSA VEYTTPTGAT AILVYGGSMW 

       490        500        510        520        530        540 
NNTITDSLMQ FDTSTKKWSN LPQSGVQLYL HAAAYLNGLM VVVGGRGSNV TAGSKSECFS 

       550        560        570        580        590        600 
NMVQSYDVAC KQWSNMSTAP VDLKRFGHSV HVIGQKLYAL GGFNGKMKSD VWTLSPAKCS 

       610        620        630        640        650        660 
SATRPDECRL ITDGTKCVFV DSSCVPFDPT VSYKSSFASM IKSSTPKSFD ECTNTPLRLA 

       670        680        690        700        710        720 
LKTCEEQTDC VSCASKSGCG WCSSGEQCLP NEQECVDGPG MLTSWEKCPQ RNSVATMRPC 

       730        740        750        760        770        780 
NMENNCGSCR ISPHCTWYPI DKASPCVSKE DLSPAFFLVH SRRKGKNRDP NQYQAADMSR 

       790        800        810        820        830        840 
VPRAAAFNSL AVVYEYETKS VLADRNKFLS PSHFPSFFRN ATECPMPCAQ RNNCSDCTDL 

       850        860        870        880        890        900 
EQCMWCPSTN RCINLEAYTL SFAYGQCHSW VTSGSGSVIN RVCQAESVVC EEHKTCGECQ 

       910        920        930        940        950        960 
RDPGCGWLAD DSKTGLGLCI RGTSTGPLEP KPENSTWYFI DCPACQCNGH STCFTSVGSF 

       970        980        990       1000       1010       1020 
PPVTIEKCQS CQNHTTGAHC ERCAPGFYGD ARNGGVCSPC DCHHQADMCD PVSGQCFCKT 

      1030       1040       1050       1060       1070       1080 
KGVTGDRCDK CEAKYVGNPR NGTPCFYELA VDFIFTFKLR SDDKDNHTSE IYLYSVPYKK 

      1090       1100       1110       1120       1130       1140 
DTDVTFQISC ESPKGNALVA LNMTSSYVNG LADKSQAMMV DTICDSKGFR RVYVASDKGY 

      1150       1160       1170       1180       1190       1200 
PFGPDSNTTF FVRVYNFNTP VQIVVSFAQS PPINWVLFFV IFAACFIVLL VVAGLLWMIK 

      1210       1220       1230       1240       1250       1260 
VRIEAYRRNQ RRIDEIEHMA SRPFASTKME LSMLSQFSSA GGPTPLSIEP CSNYRAGVFT 

      1270       1280       1290       1300       1310       1320 
LAVRLPTGGK AVTPSGTSGL AVASSLCLLT PQQVGVLQAQ DNGESNSGRK SNFRNLLRLT 


IRQRPNNND 

« Hide

Isoform b [UniParc].

Checksum: 5F718BD3A331DEB1
Show »

FASTA1,292142,618

References

« Hide 'large scale' references
[1]"Identification of the correct 3' exon sequence for Caenorhabditis elegans attractin."
Duke-Cohan J.S., Ashrafi K., Ruvkun G.
Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
[2]"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
Strain: Bristol N2.
[3]"Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins."
Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T.
Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-555; ASN-832 AND ASN-1147, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: Bristol N2.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF339882 mRNA. Translation: AAK14396.1.
Z69790 Genomic DNA. Translation: CAA93653.3.
Z69790 Genomic DNA. Translation: CAD56579.2.
PIRT21694.
RefSeqNP_001024625.2. NM_001029454.4.
NP_510443.4. NM_078042.4.
UniGeneCel.8097.

3D structure databases

ProteinModelPortalQ19981.
SMRQ19981. Positions 63-270, 277-329, 397-585, 942-1045.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid46463. 4 interactions.
MINTMINT-1127971.

Proteomic databases

PaxDbQ19981.
PRIDEQ19981.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaF33C8.1a; F33C8.1a; F33C8.1. [Q19981-1]
GeneID181566.
KEGGcel:CELE_F33C8.1.
UCSCF33C8.1b. c. elegans. [Q19981-1]

Organism-specific databases

CTD181566.
WormBaseF33C8.1a; CE41898; WBGene00006432; tag-53.
F33C8.1b; CE41899; WBGene00006432; tag-53.

Phylogenomic databases

eggNOGNOG242225.
HOGENOMHOG000018337.
InParanoidQ19981.
OMAMVVIFGH.
OrthoDBEOG7D59MM.
PhylomeDBQ19981.

Family and domain databases

Gene3D2.120.10.80. 1 hit.
2.130.10.80. 1 hit.
2.60.120.290. 1 hit.
InterProIPR000859. CUB_dom.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR002049. EGF_laminin.
IPR015916. Gal_Oxidase_b-propeller.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
IPR016201. Plexin-like_fold.
IPR002165. Plexin_repeat.
[Graphical view]
PfamPF00431. CUB. 1 hit.
PF01344. Kelch_1. 2 hits.
PF00053. Laminin_EGF. 2 hits.
PF01437. PSI. 3 hits.
[Graphical view]
SMARTSM00042. CUB. 1 hit.
SM00181. EGF. 2 hits.
SM00180. EGF_Lam. 2 hits.
SM00423. PSI. 3 hits.
[Graphical view]
SUPFAMSSF49854. SSF49854. 1 hit.
PROSITEPS01180. CUB. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 1 hit.
PS01248. EGF_LAM_1. 1 hit.
PS50027. EGF_LAM_2. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio914466.

Entry information

Entry nameTAG53_CAEEL
AccessionPrimary (citable) accession number: Q19981
Secondary accession number(s): Q8I4J9, Q9BMB0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 8, 2008
Last modified: April 16, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Caenorhabditis elegans

Caenorhabditis elegans: entries, gene names and cross-references to WormBase