Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q19289

- IFB1_CAEEL

UniProt

Q19289 - IFB1_CAEEL

Protein

Intermediate filament protein ifb-1

Gene

ifb-1

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cytoplasmic intermediate filaments provide mechanical strength to cells. Essential protein, involved in attachment structures in epidermal cells that connect muscles to the external cuticle. Required in morphogenesis and epidermal integrity. Probable component of embryonic epidermal attachment structures. Functions in larval muscle attachment independently of ifa-2.3 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. structural molecule activity Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Intermediate filament protein ifb-1
    Alternative name(s):
    Cel IF B1
    Intermediate filament protein B1
    Short name:
    IF-B1
    Gene namesi
    Name:ifb-1
    ORF Names:F10C1.2
    OrganismiCaenorhabditis elegans
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome II

    Organism-specific databases

    WormBaseiF10C1.2a; CE02618; WBGene00002053; ifb-1.
    F10C1.2b; CE02619; WBGene00002053; ifb-1.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. intermediate filament Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cytoplasm, Intermediate filament

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 589589Intermediate filament protein ifb-1PRO_0000063838Add
    BLAST

    Proteomic databases

    PaxDbiQ19289.
    PRIDEiQ19289.

    2D gel databases

    World-2DPAGE0020:Q19289.

    Expressioni

    Tissue specificityi

    Expressed in epidermal cells. Expressed in amphid sensory neurons, the excretory cells, the vulva, the uterus, the rectum and some neurons of the tail. Isoform a and isoform b display a similar pattern of expression. Isoform a is predominant in pharyngeal tonofilaments.2 Publications

    Interactioni

    Subunit structurei

    Forms some heteropolymeric filaments with ifa-1, ifa-2, ifa-3 and probably ifa-4.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CELE_Y56A3A.7A7DTF54EBI-316236,EBI-2413939
    T04C9.1Q8MPT25EBI-316236,EBI-2315635

    Protein-protein interaction databases

    BioGridi39317. 6 interactions.
    DIPiDIP-26309N.
    IntActiQ19289. 9 interactions.
    MINTiMINT-1053724.

    Structurei

    3D structure databases

    ProteinModelPortaliQ19289.
    SMRiQ19289. Positions 473-583.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini467 – 584118LTDAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni8 – 8477HeadAdd
    BLAST
    Regioni85 – 433349RodAdd
    BLAST
    Regioni85 – 11632Coil 1AAdd
    BLAST
    Regioni117 – 13014Linker 1Add
    BLAST
    Regioni131 – 268138Coil 1BAdd
    BLAST
    Regioni269 – 28517Linker 12Add
    BLAST
    Regioni286 – 433148Coil 2Add
    BLAST
    Regioni434 – 588155TailAdd
    BLAST

    Sequence similaritiesi

    Belongs to the intermediate filament family.Curated
    Contains 1 LTD domain.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG315022.
    GeneTreeiENSGT00750000117244.
    HOGENOMiHOG000017007.
    InParanoidiQ19289.
    OMAiRRMREEC.
    OrthoDBiEOG7FV3Q8.
    PhylomeDBiQ19289.

    Family and domain databases

    Gene3Di2.60.40.1260. 1 hit.
    InterProiIPR001664. IF.
    IPR016451. Intermed_filament_ifa/ifb.
    IPR018039. Intermediate_filament_CS.
    IPR001322. Lamin_tail_dom.
    [Graphical view]
    PANTHERiPTHR23239. PTHR23239. 1 hit.
    PfamiPF00038. Filament. 1 hit.
    PF00932. LTD. 1 hit.
    [Graphical view]
    PIRSFiPIRSF005546. Intermed_filamnt_Ifb-2. 1 hit.
    SUPFAMiSSF74853. SSF74853. 1 hit.
    PROSITEiPS00226. IF. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform a (identifier: Q19289-1) [UniParc]FASTAAdd to Basket

    Also known as: B1b, IFB-1B

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSHKESSEY EMQYRSTIQP RTAVRSQSRQ SGNYVSGGNG AGSGGRVLKM    50
    VTEMGSATVG GISPALSANA AKSFLEATDK EKKTLQGLND RLGNYIDRVK 100
    KLEEQNRKLV ADLDELRGKW GKDTSEIKIK YSESLSTARK DIDDAARRKA 150
    EVDVKVARHR DDLAEYRSRY EDIQQRRESD REKISQWTNA IADAQSEVEM 200
    LRARFKQLTD EEKRVTADNS RIWEELQKAR SDLDDETIGR IDFQNQVQTL 250
    MEELEFLRRV HEQEVKELQA LLAQAPADTR EFFKNELALA IRDIKDEYDI 300
    IAKQGKQDME SWYKLKVSEV QGSANRANME STYQRDEVKR MRDNIGDLRG 350
    KLGDLENKNS LLEKEVQNLN YQLTDDQRQY EAALNDRDAT LRRMREECQT 400
    LVAELQALLD TKQMLDAEIA IYRKMLEGEE TRVGLTQMVE QAVKTHSLQQ 450
    QENTDSTRSV RGEVSTKTTF QRSAKGNVTI SECDPNGKFI KLENSHRNKD 500
    ENVGEHKIRR KLDGRREIVY SIPANVVIKP GKNLTIYARD QGGINNPPES 550
    LVFDGENTWG IGANVVTSLV NKDGEERATH TQKTIQSGQ 589
    Length:589
    Mass (Da):67,149
    Last modified:November 1, 1996 - v1
    Checksum:iC4B6231224ED9AB0
    GO
    Isoform b (identifier: Q19289-2) [UniParc]FASTAAdd to Basket

    Also known as: B1a IFB-1A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: MSSHKESSEYEMQYRSTIQPRTAVRSQSRQSGNYVSGGNGAG → MEAESAPQAPM

    Show »
    Length:558
    Mass (Da):63,700
    Checksum:iA25DFFAE9DAD7AAF
    GO

    Sequence cautioni

    The sequence CAA50178.1 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4242MSSHK…GNGAG → MEAESAPQAPM in isoform b. CuratedVSP_010147Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X70830 Genomic DNA. Translation: CAA50178.1. Sequence problems.
    FO080600 Genomic DNA. Translation: CCD65029.1.
    FO080600 Genomic DNA. Translation: CCD65030.1.
    PIRiD88163.
    T16018. S46326.
    RefSeqiNP_495136.1. NM_062735.4. [Q19289-1]
    NP_495137.1. NM_062736.3. [Q19289-2]
    UniGeneiCel.7922.

    Genome annotation databases

    EnsemblMetazoaiF10C1.2b; F10C1.2b; WBGene00002053. [Q19289-1]
    GeneIDi173976.
    KEGGicel:CELE_F10C1.2.
    UCSCiF10C1.2b. c. elegans. [Q19289-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X70830 Genomic DNA. Translation: CAA50178.1 . Sequence problems.
    FO080600 Genomic DNA. Translation: CCD65029.1 .
    FO080600 Genomic DNA. Translation: CCD65030.1 .
    PIRi D88163.
    T16018. S46326.
    RefSeqi NP_495136.1. NM_062735.4. [Q19289-1 ]
    NP_495137.1. NM_062736.3. [Q19289-2 ]
    UniGenei Cel.7922.

    3D structure databases

    ProteinModelPortali Q19289.
    SMRi Q19289. Positions 473-583.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 39317. 6 interactions.
    DIPi DIP-26309N.
    IntActi Q19289. 9 interactions.
    MINTi MINT-1053724.

    2D gel databases

    World-2DPAGE 0020:Q19289.

    Proteomic databases

    PaxDbi Q19289.
    PRIDEi Q19289.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai F10C1.2b ; F10C1.2b ; WBGene00002053 . [Q19289-1 ]
    GeneIDi 173976.
    KEGGi cel:CELE_F10C1.2.
    UCSCi F10C1.2b. c. elegans. [Q19289-1 ]

    Organism-specific databases

    CTDi 173976.
    WormBasei F10C1.2a ; CE02618 ; WBGene00002053 ; ifb-1.
    F10C1.2b ; CE02619 ; WBGene00002053 ; ifb-1.

    Phylogenomic databases

    eggNOGi NOG315022.
    GeneTreei ENSGT00750000117244.
    HOGENOMi HOG000017007.
    InParanoidi Q19289.
    OMAi RRMREEC.
    OrthoDBi EOG7FV3Q8.
    PhylomeDBi Q19289.

    Miscellaneous databases

    NextBioi 881937.

    Family and domain databases

    Gene3Di 2.60.40.1260. 1 hit.
    InterProi IPR001664. IF.
    IPR016451. Intermed_filament_ifa/ifb.
    IPR018039. Intermediate_filament_CS.
    IPR001322. Lamin_tail_dom.
    [Graphical view ]
    PANTHERi PTHR23239. PTHR23239. 1 hit.
    Pfami PF00038. Filament. 1 hit.
    PF00932. LTD. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF005546. Intermed_filamnt_Ifb-2. 1 hit.
    SUPFAMi SSF74853. SSF74853. 1 hit.
    PROSITEi PS00226. IF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Eight genes and alternative RNA processing pathways generate an unexpectedly large diversity of cytoplasmic intermediate filament proteins in the nematode Caenorhabditis elegans."
      Dodemont H., Riemer D., Ledger T.N., Weber K.
      EMBO J. 13:2625-2638(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM B).
      Strain: Bristol N2.
    2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
      Strain: Bristol N2.
    3. "Essential roles for four cytoplasmic intermediate filament proteins in Caenorhabditis elegans development."
      Karabinos A., Schmidt H., Harborth J., Schnabel R., Weber K.
      Proc. Natl. Acad. Sci. U.S.A. 98:7863-7868(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    4. "In vivo and in vitro evidence that the four essential intermediate filament (IF) proteins A1, A2, A3 and B1 of the nematode Caenorhabditis elegans form an obligate heteropolymeric IF system."
      Karabinos A., Schulze E., Schuenemann J., Parry D.A.D., Weber K.
      J. Mol. Biol. 333:307-319(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH IFA-1; IFA-2; IFA-3 AND IFA-4.
    5. "Intermediate filaments are required for C. elegans epidermal elongation."
      Woo W.-M., Goncharov A., Jin Y., Chisholm A.D.
      Dev. Biol. 267:216-229(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiIFB1_CAEEL
    AccessioniPrimary (citable) accession number: Q19289
    Secondary accession number(s): Q19290, Q21063
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 26, 2004
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 110 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3