Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Intermediate filament protein ifb-1

Gene

ifb-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytoplasmic intermediate filaments provide mechanical strength to cells. Essential protein, involved in attachment structures in epidermal cells that connect muscles to the external cuticle. Required in morphogenesis and epidermal integrity. Probable component of embryonic epidermal attachment structures. Functions in larval muscle attachment independently of ifa-2.3 Publications

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Intermediate filament protein ifb-1
Alternative name(s):
Cel IF B1
Intermediate filament protein B1
Short name:
IF-B1
Gene namesi
Name:ifb-1
ORF Names:F10C1.2
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome II

Organism-specific databases

WormBaseiF10C1.2a; CE02618; WBGene00002053; ifb-1.
F10C1.2b; CE02619; WBGene00002053; ifb-1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Intermediate filament

Pathology & Biotechi

Disruption phenotypei

RNAi-mediated knockdown results in 79% embryonic lethality and 19% larval lethality. Abnormal localization of epidermal structural protein pat-12 during embryogenesis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000638381 – 589Intermediate filament protein ifb-1Add BLAST589

Proteomic databases

EPDiQ19289.
PaxDbiQ19289.
PeptideAtlasiQ19289.
PRIDEiQ19289.

2D gel databases

World-2DPAGEi0020:Q19289.

Expressioni

Tissue specificityi

Expressed in epidermal cells. Expressed in amphid sensory neurons, the excretory cells, the vulva, the uterus, the rectum and some neurons of the tail. Isoform a and isoform b display a similar pattern of expression. Isoform a is predominant in pharyngeal tonofilaments.2 Publications

Gene expression databases

BgeeiWBGene00002053.

Interactioni

Subunit structurei

Forms some heteropolymeric filaments with ifa-1, ifa-2, ifa-3 and probably ifa-4.

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi39317. 6 interactors.
DIPiDIP-26309N.
IntActiQ19289. 9 interactors.
MINTiMINT-1053724.
STRINGi6239.F10C1.2b.

Structurei

3D structure databases

ProteinModelPortaliQ19289.
SMRiQ19289.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini81 – 433IF rodPROSITE-ProRule annotationAdd BLAST353
Domaini466 – 584LTDPROSITE-ProRule annotationAdd BLAST119

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni8 – 84HeadAdd BLAST77
Regioni85 – 116Coil 1AAdd BLAST32
Regioni117 – 130Linker 1Add BLAST14
Regioni131 – 268Coil 1BAdd BLAST138
Regioni269 – 285Linker 12Add BLAST17
Regioni286 – 433Coil 2Add BLAST148
Regioni434 – 588TailAdd BLAST155

Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0977. Eukaryota.
ENOG410Y2H6. LUCA.
GeneTreeiENSGT00830000128282.
HOGENOMiHOG000017007.
InParanoidiQ19289.
KOiK18585.
OMAiRMREECQ.
OrthoDBiEOG091G05LK.
PhylomeDBiQ19289.

Family and domain databases

Gene3Di2.60.40.1260. 1 hit.
InterProiView protein in InterPro
IPR001664. IF.
IPR016451. Intermed_filament_ifa/ifb.
IPR018039. Intermediate_filament_CS.
IPR001322. Lamin_tail_dom.
IPR036415. Lamin_tail_dom_sf.
PANTHERiPTHR23239. PTHR23239. 1 hit.
PfamiView protein in Pfam
PF00038. Filament. 1 hit.
PF00932. LTD. 1 hit.
PIRSFiPIRSF005546. Intermed_filamnt_Ifb-2. 1 hit.
SMARTiView protein in SMART
SM01391. Filament. 1 hit.
SUPFAMiSSF74853. SSF74853. 1 hit.
PROSITEiView protein in PROSITE
PS00226. IF_ROD_1. 1 hit.
PS51842. IF_ROD_2. 1 hit.
PS51841. LTD. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a (identifier: Q19289-1) [UniParc]FASTAAdd to basket
Also known as: B1b, IFB-1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSHKESSEY EMQYRSTIQP RTAVRSQSRQ SGNYVSGGNG AGSGGRVLKM
60 70 80 90 100
VTEMGSATVG GISPALSANA AKSFLEATDK EKKTLQGLND RLGNYIDRVK
110 120 130 140 150
KLEEQNRKLV ADLDELRGKW GKDTSEIKIK YSESLSTARK DIDDAARRKA
160 170 180 190 200
EVDVKVARHR DDLAEYRSRY EDIQQRRESD REKISQWTNA IADAQSEVEM
210 220 230 240 250
LRARFKQLTD EEKRVTADNS RIWEELQKAR SDLDDETIGR IDFQNQVQTL
260 270 280 290 300
MEELEFLRRV HEQEVKELQA LLAQAPADTR EFFKNELALA IRDIKDEYDI
310 320 330 340 350
IAKQGKQDME SWYKLKVSEV QGSANRANME STYQRDEVKR MRDNIGDLRG
360 370 380 390 400
KLGDLENKNS LLEKEVQNLN YQLTDDQRQY EAALNDRDAT LRRMREECQT
410 420 430 440 450
LVAELQALLD TKQMLDAEIA IYRKMLEGEE TRVGLTQMVE QAVKTHSLQQ
460 470 480 490 500
QENTDSTRSV RGEVSTKTTF QRSAKGNVTI SECDPNGKFI KLENSHRNKD
510 520 530 540 550
ENVGEHKIRR KLDGRREIVY SIPANVVIKP GKNLTIYARD QGGINNPPES
560 570 580
LVFDGENTWG IGANVVTSLV NKDGEERATH TQKTIQSGQ
Length:589
Mass (Da):67,149
Last modified:November 1, 1996 - v1
Checksum:iC4B6231224ED9AB0
GO
Isoform b (identifier: Q19289-2) [UniParc]FASTAAdd to basket
Also known as: B1a IFB-1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MSSHKESSEYEMQYRSTIQPRTAVRSQSRQSGNYVSGGNGAG → MEAESAPQAPM

Show »
Length:558
Mass (Da):63,700
Checksum:iA25DFFAE9DAD7AAF
GO

Sequence cautioni

The sequence CAA50178 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0101471 – 42MSSHK…GNGAG → MEAESAPQAPM in isoform b. CuratedAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X70830 Genomic DNA. Translation: CAA50178.1. Sequence problems.
FO080600 Genomic DNA. Translation: CCD65029.1.
FO080600 Genomic DNA. Translation: CCD65030.1.
PIRiD88163.
T16018. S46326.
RefSeqiNP_495136.1. NM_062735.4. [Q19289-1]
NP_495137.1. NM_062736.3. [Q19289-2]
UniGeneiCel.7922.

Genome annotation databases

EnsemblMetazoaiF10C1.2b; F10C1.2b; WBGene00002053. [Q19289-1]
GeneIDi173976.
KEGGicel:CELE_F10C1.2.
UCSCiF10C1.2b. c. elegans. [Q19289-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiIFB1_CAEEL
AccessioniPrimary (citable) accession number: Q19289
Secondary accession number(s): Q19290, Q21063
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: November 1, 1996
Last modified: October 25, 2017
This is version 136 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families