Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q19289 (IFB1_CAEEL) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Intermediate filament protein ifb-1
Alternative name(s):
Cel IF B1
Intermediate filament protein B1
Short name=IF-B1
Gene names
Name:ifb-1
ORF Names:F10C1.2
OrganismCaenorhabditis elegans [Reference proteome]
Taxonomic identifier6239 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis

Protein attributes

Sequence length589 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Cytoplasmic intermediate filaments provide mechanical strength to cells. Essential protein, involved in attachment structures in epidermal cells that connect muscles to the external cuticle. Required in morphogenesis and epidermal integrity. Probable component of embryonic epidermal attachment structures. Functions in larval muscle attachment independently of ifa-2. Ref.3 Ref.4 Ref.5

Subunit structure

Forms some heteropolymeric filaments with ifa-1, ifa-2, ifa-3 and probably ifa-4.

Subcellular location

Cytoplasm By similarity Ref.5.

Tissue specificity

Expressed in epidermal cells. Expressed in amphid sensory neurons, the excretory cells, the vulva, the uterus, the rectum and some neurons of the tail. Isoform a and isoform b display a similar pattern of expression. Isoform a is predominant in pharyngeal tonofilaments. Ref.3 Ref.5

Sequence similarities

Belongs to the intermediate filament family.

Sequence caution

The sequence CAA50178.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Binary interactions

With

Entry

#Exp.

IntAct

Notes

CELE_Y56A3A.7A7DTF54EBI-316236,EBI-2413939
T04C9.1Q8MPT25EBI-316236,EBI-2315635

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform a (identifier: Q19289-1)

Also known as: B1b; IFB-1B;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform b (identifier: Q19289-2)

Also known as: B1a IFB-1A;

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MSSHKESSEYEMQYRSTIQPRTAVRSQSRQSGNYVSGGNGAG → MEAESAPQAPM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 589589Intermediate filament protein ifb-1
PRO_0000063838

Regions

Region8 – 8477Head
Region85 – 433349Rod
Region85 – 11632Coil 1A
Region117 – 13014Linker 1
Region131 – 268138Coil 1B
Region269 – 28517Linker 12
Region286 – 433148Coil 2
Region434 – 588155Tail

Natural variations

Alternative sequence1 – 4242MSSHK…GNGAG → MEAESAPQAPM in isoform b.
VSP_010147

Sequences

Sequence LengthMass (Da)Tools
Isoform a (B1b) (IFB-1B) [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: C4B6231224ED9AB0

FASTA58967,149
        10         20         30         40         50         60 
MSSHKESSEY EMQYRSTIQP RTAVRSQSRQ SGNYVSGGNG AGSGGRVLKM VTEMGSATVG 

        70         80         90        100        110        120 
GISPALSANA AKSFLEATDK EKKTLQGLND RLGNYIDRVK KLEEQNRKLV ADLDELRGKW 

       130        140        150        160        170        180 
GKDTSEIKIK YSESLSTARK DIDDAARRKA EVDVKVARHR DDLAEYRSRY EDIQQRRESD 

       190        200        210        220        230        240 
REKISQWTNA IADAQSEVEM LRARFKQLTD EEKRVTADNS RIWEELQKAR SDLDDETIGR 

       250        260        270        280        290        300 
IDFQNQVQTL MEELEFLRRV HEQEVKELQA LLAQAPADTR EFFKNELALA IRDIKDEYDI 

       310        320        330        340        350        360 
IAKQGKQDME SWYKLKVSEV QGSANRANME STYQRDEVKR MRDNIGDLRG KLGDLENKNS 

       370        380        390        400        410        420 
LLEKEVQNLN YQLTDDQRQY EAALNDRDAT LRRMREECQT LVAELQALLD TKQMLDAEIA 

       430        440        450        460        470        480 
IYRKMLEGEE TRVGLTQMVE QAVKTHSLQQ QENTDSTRSV RGEVSTKTTF QRSAKGNVTI 

       490        500        510        520        530        540 
SECDPNGKFI KLENSHRNKD ENVGEHKIRR KLDGRREIVY SIPANVVIKP GKNLTIYARD 

       550        560        570        580 
QGGINNPPES LVFDGENTWG IGANVVTSLV NKDGEERATH TQKTIQSGQ 

« Hide

Isoform b (B1a IFB-1A) [UniParc].

Checksum: A25DFFAE9DAD7AAF
Show »

FASTA55863,700

References

« Hide 'large scale' references
[1]"Eight genes and alternative RNA processing pathways generate an unexpectedly large diversity of cytoplasmic intermediate filament proteins in the nematode Caenorhabditis elegans."
Dodemont H., Riemer D., Ledger T.N., Weber K.
EMBO J. 13:2625-2638(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM B).
Strain: Bristol N2.
[2]"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
Strain: Bristol N2.
[3]"Essential roles for four cytoplasmic intermediate filament proteins in Caenorhabditis elegans development."
Karabinos A., Schmidt H., Harborth J., Schnabel R., Weber K.
Proc. Natl. Acad. Sci. U.S.A. 98:7863-7868(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[4]"In vivo and in vitro evidence that the four essential intermediate filament (IF) proteins A1, A2, A3 and B1 of the nematode Caenorhabditis elegans form an obligate heteropolymeric IF system."
Karabinos A., Schulze E., Schuenemann J., Parry D.A.D., Weber K.
J. Mol. Biol. 333:307-319(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH IFA-1; IFA-2; IFA-3 AND IFA-4.
[5]"Intermediate filaments are required for C. elegans epidermal elongation."
Woo W.-M., Goncharov A., Jin Y., Chisholm A.D.
Dev. Biol. 267:216-229(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X70830 Genomic DNA. Translation: CAA50178.1. Sequence problems.
FO080600 Genomic DNA. Translation: CCD65029.1.
FO080600 Genomic DNA. Translation: CCD65030.1.
PIRD88163.
S46326. T16018.
RefSeqNP_495136.1. NM_062735.4. [Q19289-1]
NP_495137.1. NM_062736.3. [Q19289-2]
UniGeneCel.7922.

3D structure databases

ProteinModelPortalQ19289.
SMRQ19289. Positions 473-583.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid39317. 6 interactions.
DIPDIP-26309N.
IntActQ19289. 9 interactions.
MINTMINT-1053724.

2D gel databases

World-2DPAGE0020:Q19289.

Proteomic databases

PaxDbQ19289.
PRIDEQ19289.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaF10C1.2b; F10C1.2b; WBGene00002053. [Q19289-1]
GeneID173976.
KEGGcel:CELE_F10C1.2.
UCSCF10C1.2b. c. elegans. [Q19289-1]

Organism-specific databases

CTD173976.
WormBaseF10C1.2a; CE02618; WBGene00002053; ifb-1.
F10C1.2b; CE02619; WBGene00002053; ifb-1.

Phylogenomic databases

eggNOGNOG315022.
GeneTreeENSGT00750000117244.
HOGENOMHOG000017007.
InParanoidQ19289.
OMARRMREEC.
OrthoDBEOG7FV3Q8.
PhylomeDBQ19289.

Family and domain databases

Gene3D2.60.40.1260. 1 hit.
InterProIPR001664. IF.
IPR016451. Intermed_filament_ifa/ifb.
IPR018039. Intermediate_filament_CS.
IPR001322. Lamin_tail_dom.
[Graphical view]
PANTHERPTHR23239. PTHR23239. 1 hit.
PfamPF00038. Filament. 1 hit.
PF00932. LTD. 1 hit.
[Graphical view]
PIRSFPIRSF005546. Intermed_filamnt_Ifb-2. 1 hit.
SUPFAMSSF74853. SSF74853. 1 hit.
PROSITEPS00226. IF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio881937.

Entry information

Entry nameIFB1_CAEEL
AccessionPrimary (citable) accession number: Q19289
Secondary accession number(s): Q19290, Q21063
Entry history
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: November 1, 1996
Last modified: June 11, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Caenorhabditis elegans

Caenorhabditis elegans: entries, gene names and cross-references to WormBase