Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q18953 (SPCS_CAEEL) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 88. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
O-phosphoseryl-tRNA(Sec) selenium transferase

EC=2.9.1.2
Alternative name(s):
Selenocysteine synthase
Short name=Sec synthase
Selenocysteinyl-tRNA(Sec) synthase
Sep-tRNA:Sec-tRNA synthase
Short name=SepSecS
UGA suppressor tRNA-associated protein homolog
Gene names
Name:secs-1
ORF Names:D1054.13
OrganismCaenorhabditis elegans [Reference proteome]
Taxonomic identifier6239 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis

Protein attributes

Sequence length481 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis By similarity.

Catalytic activity

O-phospho-L-seryl-tRNA(Sec) + selenophosphate = L-selenocysteinyl-tRNA(Sec) + phosphate.

Cofactor

Pyridoxal phosphate By similarity.

Pathway

Aminoacyl-tRNA biosynthesis; selenocysteinyl-tRNA(Sec) biosynthesis; selenocysteinyl-tRNA(Sec) from L-seryl-tRNA(Sec) (archaeal/eukaryal route): step 2/2.

Subunit structure

Homotetramer By similarity.

Subcellular location

Cytoplasm By similarity.

Sequence similarities

Belongs to the SepSecS family.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

itself3EBI-318539,EBI-318539
abl-1P039497EBI-318539,EBI-2315883

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform a (identifier: Q18953-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform b (identifier: Q18953-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSFEKLLMNLPGHTECACLPLCVDCQSRVDDCVSGRTARSEDM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 481481O-phosphoseryl-tRNA(Sec) selenium transferase
PRO_0000219880

Regions

Region1 – 3636Tetramerization By similarity
Region90 – 10011Phosphate loop (P-loop) By similarity

Sites

Binding site691PLP By similarity
Binding site911Substrate By similarity
Binding site921Substrate By similarity
Binding site991Substrate By similarity
Binding site3061Substrate By similarity
Site681May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylate By similarity

Amino acid modifications

Modified residue2771N6-(pyridoxal phosphate)lysine By similarity

Natural variations

Alternative sequence11M → MSFEKLLMNLPGHTECACLP LCVDCQSRVDDCVSGRTARS EDM in isoform b.
VSP_038162

Sequences

Sequence LengthMass (Da)Tools
Isoform a [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 1EFFCD6F6B989FE6

FASTA48153,408
        10         20         30         40         50         60 
MKANFGKKEG EYSRLVSKSS NKLLNSLWEK KQIPEEGWSE HTLDLFLSWL SSHDTNNRVD 

        70         80         90        100        110        120 
MIPVGAGERE GRVLTPLVQR LHSNLTHGIG RSGNLLEIQP KALGSSMLAC LSNEFAKHAL 

       130        140        150        160        170        180 
HLLGLHAVKS CIVVPLCTGM SLSLCMTSWR RRRPKAKYVV WLRIDQKSSL KSIYHAGFEP 

       190        200        210        220        230        240 
IIVEPIRDRD SLITDVETVN RIIEQRGEEI LCVMTTTSCF APRSPDNVEA ISAICAAHDV 

       250        260        270        280        290        300 
PHLVNNAYGL QSEETIRKIA AAHECGRVDA VVQSLDKNFQ VPVGGAVIAA FKQNHIQSIA 

       310        320        330        340        350        360 
QSYPGRASSV PSRDLVLTLL YQGQSAFLEP FGKQKQMFLK MRRKLISFAE NIGECVYEVP 

       370        380        390        400        410        420 
ENEISSAMTL STIPPAKQTL FGSILFAKGI TGARVVTSSQ SKTTIEGCEF INFGSHTTEQ 

       430        440        450        460        470        480 
HGGYLNIACS VGMTDHELEE LFTRLTSSYA KFVRELAKED ERINSSGRRI PINESFDMEN 


D 

« Hide

Isoform b [UniParc].

Checksum: F68B578F23E2BA22
Show »

FASTA52358,021

References

[1]"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
Strain: Bristol N2.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z74030 Genomic DNA. Translation: CAA98446.1.
Z74030 Genomic DNA. Translation: CAR64661.1.
PIRT20309.
RefSeqNP_001129887.1. NM_001136415.1. [Q18953-2]
NP_505761.1. NM_073360.3. [Q18953-1]
UniGeneCel.4312.

3D structure databases

ProteinModelPortalQ18953.
SMRQ18953. Positions 18-445.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid44527. 7 interactions.
DIPDIP-26886N.
IntActQ18953. 9 interactions.
MINTMINT-1042069.

Proteomic databases

PaxDbQ18953.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaD1054.13a; D1054.13a; WBGene00008379. [Q18953-1]
GeneID179498.
KEGGcel:CELE_D1054.13.

Organism-specific databases

CTD179498.
WormBaseD1054.13a; CE05531; WBGene00008379; secs-1.
D1054.13b; CE43036; WBGene00008379; secs-1.

Phylogenomic databases

eggNOGCOG0076.
GeneTreeENSGT00390000007332.
HOGENOMHOG000254245.
KOK03341.
OMANDYPCAY.
OrthoDBEOG71G9TX.
PhylomeDBQ18953.

Enzyme and pathway databases

UniPathwayUPA00906; UER00898.

Family and domain databases

Gene3D3.40.640.10. 1 hit.
InterProIPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR019872. Sec-tRNA_Se_transferase.
IPR008829. SLA/LP_auto_ag.
[Graphical view]
PANTHERPTHR12944. PTHR12944. 1 hit.
PfamPF05889. SLA_LP_auto_ag. 1 hit.
[Graphical view]
PIRSFPIRSF017689. SepSecS. 1 hit.
SUPFAMSSF53383. SSF53383. 1 hit.
TIGRFAMsTIGR03531. selenium_SpcS. 1 hit.
ProtoNetSearch...

Other

NextBio905662.
PROQ18953.

Entry information

Entry nameSPCS_CAEEL
AccessionPrimary (citable) accession number: Q18953
Secondary accession number(s): B5U8M4
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: June 11, 2014
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

Caenorhabditis elegans

Caenorhabditis elegans: entries, gene names and cross-references to WormBase