Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q18953

- SPCS_CAEEL

UniProt

Q18953 - SPCS_CAEEL

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

O-phosphoseryl-tRNA(Sec) selenium transferase

Gene

secs-1

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.By similarity

Catalytic activityi

O-phospho-L-seryl-tRNA(Sec) + selenophosphate + H2O = L-selenocysteinyl-tRNA(Sec) + 2 phosphate.

Cofactori

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei68 – 681May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylateBy similarity
Binding sitei69 – 691PLPBy similarity
Binding sitei91 – 911SubstrateBy similarity
Binding sitei92 – 921SubstrateBy similarity
Binding sitei99 – 991SubstrateBy similarity
Binding sitei306 – 3061SubstrateBy similarity

GO - Molecular functioni

  1. identical protein binding Source: IntAct
  2. pyridoxal phosphate binding Source: InterPro
  3. transferase activity, transferring selenium-containing groups Source: InterPro
  4. tRNA binding Source: UniProtKB-KW

GO - Biological processi

  1. selenocysteinyl-tRNA(Sec) biosynthetic process Source: UniProtKB-UniPathway
  2. translation Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Protein biosynthesis

Keywords - Ligandi

Pyridoxal phosphate, RNA-binding, Selenium, tRNA-binding

Enzyme and pathway databases

UniPathwayiUPA00906; UER00898.

Names & Taxonomyi

Protein namesi
Recommended name:
O-phosphoseryl-tRNA(Sec) selenium transferase (EC:2.9.1.2)
Alternative name(s):
Selenocysteine synthase
Short name:
Sec synthase
Selenocysteinyl-tRNA(Sec) synthase
Sep-tRNA:Sec-tRNA synthase
Short name:
SepSecS
UGA suppressor tRNA-associated protein homolog
Gene namesi
Name:secs-1
ORF Names:D1054.13
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome V

Organism-specific databases

WormBaseiD1054.13a; CE05531; WBGene00008379; secs-1.
D1054.13b; CE43036; WBGene00008379; secs-1.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 481481O-phosphoseryl-tRNA(Sec) selenium transferasePRO_0000219880Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei277 – 2771N6-(pyridoxal phosphate)lysineBy similarity

Proteomic databases

PaxDbiQ18953.

Interactioni

Subunit structurei

Homotetramer.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-318539,EBI-318539
abl-1P039497EBI-318539,EBI-2315883

Protein-protein interaction databases

BioGridi44527. 7 interactions.
DIPiDIP-26886N.
IntActiQ18953. 9 interactions.
MINTiMINT-1042069.

Structurei

3D structure databases

ProteinModelPortaliQ18953.
SMRiQ18953. Positions 18-445.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 3636TetramerizationBy similarityAdd
BLAST
Regioni90 – 10011Phosphate loop (P-loop)By similarityAdd
BLAST

Sequence similaritiesi

Belongs to the SepSecS family.Curated

Phylogenomic databases

eggNOGiCOG0076.
GeneTreeiENSGT00390000007332.
HOGENOMiHOG000254245.
InParanoidiQ18953.
KOiK03341.
OMAiNDYPCAY.
OrthoDBiEOG71G9TX.
PhylomeDBiQ18953.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
InterProiIPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR019872. Sec-tRNA_Se_transferase.
IPR008829. SLA/LP_auto_ag.
[Graphical view]
PANTHERiPTHR12944. PTHR12944. 1 hit.
PfamiPF05889. SLA_LP_auto_ag. 1 hit.
[Graphical view]
PIRSFiPIRSF017689. SepSecS. 1 hit.
SUPFAMiSSF53383. SSF53383. 1 hit.
TIGRFAMsiTIGR03531. selenium_SpcS. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform a (identifier: Q18953-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKANFGKKEG EYSRLVSKSS NKLLNSLWEK KQIPEEGWSE HTLDLFLSWL
60 70 80 90 100
SSHDTNNRVD MIPVGAGERE GRVLTPLVQR LHSNLTHGIG RSGNLLEIQP
110 120 130 140 150
KALGSSMLAC LSNEFAKHAL HLLGLHAVKS CIVVPLCTGM SLSLCMTSWR
160 170 180 190 200
RRRPKAKYVV WLRIDQKSSL KSIYHAGFEP IIVEPIRDRD SLITDVETVN
210 220 230 240 250
RIIEQRGEEI LCVMTTTSCF APRSPDNVEA ISAICAAHDV PHLVNNAYGL
260 270 280 290 300
QSEETIRKIA AAHECGRVDA VVQSLDKNFQ VPVGGAVIAA FKQNHIQSIA
310 320 330 340 350
QSYPGRASSV PSRDLVLTLL YQGQSAFLEP FGKQKQMFLK MRRKLISFAE
360 370 380 390 400
NIGECVYEVP ENEISSAMTL STIPPAKQTL FGSILFAKGI TGARVVTSSQ
410 420 430 440 450
SKTTIEGCEF INFGSHTTEQ HGGYLNIACS VGMTDHELEE LFTRLTSSYA
460 470 480
KFVRELAKED ERINSSGRRI PINESFDMEN D

Note: No experimental confirmation available.

Length:481
Mass (Da):53,408
Last modified:November 1, 1996 - v1
Checksum:i1EFFCD6F6B989FE6
GO
Isoform b (identifier: Q18953-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSFEKLLMNLPGHTECACLPLCVDCQSRVDDCVSGRTARSEDM

Note: No experimental confirmation available.

Show »
Length:523
Mass (Da):58,021
Checksum:iF68B578F23E2BA22
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSFEKLLMNLPGHTECACLP LCVDCQSRVDDCVSGRTARS EDM in isoform b. CuratedVSP_038162

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z74030 Genomic DNA. Translation: CAA98446.1.
Z74030 Genomic DNA. Translation: CAR64661.1.
PIRiT20309.
RefSeqiNP_001129887.1. NM_001136415.1. [Q18953-2]
NP_505761.1. NM_073360.3. [Q18953-1]
UniGeneiCel.4312.

Genome annotation databases

EnsemblMetazoaiD1054.13a; D1054.13a; WBGene00008379. [Q18953-1]
GeneIDi179498.
KEGGicel:CELE_D1054.13.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z74030 Genomic DNA. Translation: CAA98446.1 .
Z74030 Genomic DNA. Translation: CAR64661.1 .
PIRi T20309.
RefSeqi NP_001129887.1. NM_001136415.1. [Q18953-2 ]
NP_505761.1. NM_073360.3. [Q18953-1 ]
UniGenei Cel.4312.

3D structure databases

ProteinModelPortali Q18953.
SMRi Q18953. Positions 18-445.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 44527. 7 interactions.
DIPi DIP-26886N.
IntActi Q18953. 9 interactions.
MINTi MINT-1042069.

Proteomic databases

PaxDbi Q18953.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai D1054.13a ; D1054.13a ; WBGene00008379 . [Q18953-1 ]
GeneIDi 179498.
KEGGi cel:CELE_D1054.13.

Organism-specific databases

CTDi 179498.
WormBasei D1054.13a ; CE05531 ; WBGene00008379 ; secs-1.
D1054.13b ; CE43036 ; WBGene00008379 ; secs-1.

Phylogenomic databases

eggNOGi COG0076.
GeneTreei ENSGT00390000007332.
HOGENOMi HOG000254245.
InParanoidi Q18953.
KOi K03341.
OMAi NDYPCAY.
OrthoDBi EOG71G9TX.
PhylomeDBi Q18953.

Enzyme and pathway databases

UniPathwayi UPA00906 ; UER00898 .

Miscellaneous databases

NextBioi 905662.
PROi Q18953.

Family and domain databases

Gene3Di 3.40.640.10. 1 hit.
InterProi IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR019872. Sec-tRNA_Se_transferase.
IPR008829. SLA/LP_auto_ag.
[Graphical view ]
PANTHERi PTHR12944. PTHR12944. 1 hit.
Pfami PF05889. SLA_LP_auto_ag. 1 hit.
[Graphical view ]
PIRSFi PIRSF017689. SepSecS. 1 hit.
SUPFAMi SSF53383. SSF53383. 1 hit.
TIGRFAMsi TIGR03531. selenium_SpcS. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.

Entry informationi

Entry nameiSPCS_CAEEL
AccessioniPrimary (citable) accession number: Q18953
Secondary accession number(s): B5U8M4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: November 26, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3