Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q18953

- SPCS_CAEEL

UniProt

Q18953 - SPCS_CAEEL

Protein

O-phosphoseryl-tRNA(Sec) selenium transferase

Gene

secs-1

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.By similarity

    Catalytic activityi

    O-phospho-L-seryl-tRNA(Sec) + selenophosphate + H2O = L-selenocysteinyl-tRNA(Sec) + 2 phosphate.

    Cofactori

    Pyridoxal phosphate.By similarity

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei68 – 681May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylateBy similarity
    Binding sitei69 – 691PLPBy similarity
    Binding sitei91 – 911SubstrateBy similarity
    Binding sitei92 – 921SubstrateBy similarity
    Binding sitei99 – 991SubstrateBy similarity
    Binding sitei306 – 3061SubstrateBy similarity

    GO - Molecular functioni

    1. identical protein binding Source: IntAct
    2. protein binding Source: IntAct
    3. pyridoxal phosphate binding Source: InterPro
    4. transferase activity, transferring selenium-containing groups Source: InterPro
    5. tRNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. selenocysteinyl-tRNA(Sec) biosynthetic process Source: UniProtKB-UniPathway
    2. translation Source: UniProtKB-KW

    Keywords - Molecular functioni

    Transferase

    Keywords - Biological processi

    Protein biosynthesis

    Keywords - Ligandi

    Pyridoxal phosphate, RNA-binding, Selenium, tRNA-binding

    Enzyme and pathway databases

    UniPathwayiUPA00906; UER00898.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    O-phosphoseryl-tRNA(Sec) selenium transferase (EC:2.9.1.2)
    Alternative name(s):
    Selenocysteine synthase
    Short name:
    Sec synthase
    Selenocysteinyl-tRNA(Sec) synthase
    Sep-tRNA:Sec-tRNA synthase
    Short name:
    SepSecS
    UGA suppressor tRNA-associated protein homolog
    Gene namesi
    Name:secs-1
    ORF Names:D1054.13
    OrganismiCaenorhabditis elegans
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome V

    Organism-specific databases

    WormBaseiD1054.13a; CE05531; WBGene00008379; secs-1.
    D1054.13b; CE43036; WBGene00008379; secs-1.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 481481O-phosphoseryl-tRNA(Sec) selenium transferasePRO_0000219880Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei277 – 2771N6-(pyridoxal phosphate)lysineBy similarity

    Proteomic databases

    PaxDbiQ18953.

    Interactioni

    Subunit structurei

    Homotetramer.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself3EBI-318539,EBI-318539
    abl-1P039497EBI-318539,EBI-2315883

    Protein-protein interaction databases

    BioGridi44527. 7 interactions.
    DIPiDIP-26886N.
    IntActiQ18953. 9 interactions.
    MINTiMINT-1042069.

    Structurei

    3D structure databases

    ProteinModelPortaliQ18953.
    SMRiQ18953. Positions 18-445.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 3636TetramerizationBy similarityAdd
    BLAST
    Regioni90 – 10011Phosphate loop (P-loop)By similarityAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SepSecS family.Curated

    Phylogenomic databases

    eggNOGiCOG0076.
    GeneTreeiENSGT00390000007332.
    HOGENOMiHOG000254245.
    KOiK03341.
    OMAiNDYPCAY.
    OrthoDBiEOG71G9TX.
    PhylomeDBiQ18953.

    Family and domain databases

    Gene3Di3.40.640.10. 1 hit.
    InterProiIPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR019872. Sec-tRNA_Se_transferase.
    IPR008829. SLA/LP_auto_ag.
    [Graphical view]
    PANTHERiPTHR12944. PTHR12944. 1 hit.
    PfamiPF05889. SLA_LP_auto_ag. 1 hit.
    [Graphical view]
    PIRSFiPIRSF017689. SepSecS. 1 hit.
    SUPFAMiSSF53383. SSF53383. 1 hit.
    TIGRFAMsiTIGR03531. selenium_SpcS. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform a (identifier: Q18953-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKANFGKKEG EYSRLVSKSS NKLLNSLWEK KQIPEEGWSE HTLDLFLSWL    50
    SSHDTNNRVD MIPVGAGERE GRVLTPLVQR LHSNLTHGIG RSGNLLEIQP 100
    KALGSSMLAC LSNEFAKHAL HLLGLHAVKS CIVVPLCTGM SLSLCMTSWR 150
    RRRPKAKYVV WLRIDQKSSL KSIYHAGFEP IIVEPIRDRD SLITDVETVN 200
    RIIEQRGEEI LCVMTTTSCF APRSPDNVEA ISAICAAHDV PHLVNNAYGL 250
    QSEETIRKIA AAHECGRVDA VVQSLDKNFQ VPVGGAVIAA FKQNHIQSIA 300
    QSYPGRASSV PSRDLVLTLL YQGQSAFLEP FGKQKQMFLK MRRKLISFAE 350
    NIGECVYEVP ENEISSAMTL STIPPAKQTL FGSILFAKGI TGARVVTSSQ 400
    SKTTIEGCEF INFGSHTTEQ HGGYLNIACS VGMTDHELEE LFTRLTSSYA 450
    KFVRELAKED ERINSSGRRI PINESFDMEN D 481

    Note: No experimental confirmation available.

    Length:481
    Mass (Da):53,408
    Last modified:November 1, 1996 - v1
    Checksum:i1EFFCD6F6B989FE6
    GO
    Isoform b (identifier: Q18953-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSFEKLLMNLPGHTECACLPLCVDCQSRVDDCVSGRTARSEDM

    Note: No experimental confirmation available.

    Show »
    Length:523
    Mass (Da):58,021
    Checksum:iF68B578F23E2BA22
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSFEKLLMNLPGHTECACLP LCVDCQSRVDDCVSGRTARS EDM in isoform b. CuratedVSP_038162

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z74030 Genomic DNA. Translation: CAA98446.1.
    Z74030 Genomic DNA. Translation: CAR64661.1.
    PIRiT20309.
    RefSeqiNP_001129887.1. NM_001136415.1. [Q18953-2]
    NP_505761.1. NM_073360.3. [Q18953-1]
    UniGeneiCel.4312.

    Genome annotation databases

    EnsemblMetazoaiD1054.13a; D1054.13a; WBGene00008379. [Q18953-1]
    GeneIDi179498.
    KEGGicel:CELE_D1054.13.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z74030 Genomic DNA. Translation: CAA98446.1 .
    Z74030 Genomic DNA. Translation: CAR64661.1 .
    PIRi T20309.
    RefSeqi NP_001129887.1. NM_001136415.1. [Q18953-2 ]
    NP_505761.1. NM_073360.3. [Q18953-1 ]
    UniGenei Cel.4312.

    3D structure databases

    ProteinModelPortali Q18953.
    SMRi Q18953. Positions 18-445.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 44527. 7 interactions.
    DIPi DIP-26886N.
    IntActi Q18953. 9 interactions.
    MINTi MINT-1042069.

    Proteomic databases

    PaxDbi Q18953.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai D1054.13a ; D1054.13a ; WBGene00008379 . [Q18953-1 ]
    GeneIDi 179498.
    KEGGi cel:CELE_D1054.13.

    Organism-specific databases

    CTDi 179498.
    WormBasei D1054.13a ; CE05531 ; WBGene00008379 ; secs-1.
    D1054.13b ; CE43036 ; WBGene00008379 ; secs-1.

    Phylogenomic databases

    eggNOGi COG0076.
    GeneTreei ENSGT00390000007332.
    HOGENOMi HOG000254245.
    KOi K03341.
    OMAi NDYPCAY.
    OrthoDBi EOG71G9TX.
    PhylomeDBi Q18953.

    Enzyme and pathway databases

    UniPathwayi UPA00906 ; UER00898 .

    Miscellaneous databases

    NextBioi 905662.
    PROi Q18953.

    Family and domain databases

    Gene3Di 3.40.640.10. 1 hit.
    InterProi IPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR019872. Sec-tRNA_Se_transferase.
    IPR008829. SLA/LP_auto_ag.
    [Graphical view ]
    PANTHERi PTHR12944. PTHR12944. 1 hit.
    Pfami PF05889. SLA_LP_auto_ag. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF017689. SepSecS. 1 hit.
    SUPFAMi SSF53383. SSF53383. 1 hit.
    TIGRFAMsi TIGR03531. selenium_SpcS. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
      Strain: Bristol N2.

    Entry informationi

    Entry nameiSPCS_CAEEL
    AccessioniPrimary (citable) accession number: Q18953
    Secondary accession number(s): B5U8M4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 90 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3