Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q18788

- MAN12_CAEEL

UniProt

Q18788 - MAN12_CAEEL

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5

Gene

C52E4.5

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man9GlcNAc2 to produce Man5GlcNAc2 (By similarity).By similarity

Catalytic activityi

Hydrolysis of the terminal (1->2)-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man9(GlcNAc)2.

Cofactori

Calcium.By similarity

Pathwayi

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Source: UniProtKB-EC

GO - Biological processi

  1. protein glycosylation Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_183157. Progressive trimming of alpha-1,2-linked mannose residues from Man9/8/7GlcNAc2 to produce Man5GlcNAc2.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGH47. Glycoside Hydrolase Family 47.

Names & Taxonomyi

Protein namesi
Recommended name:
Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 (EC:3.2.1.113)
Alternative name(s):
Processing alpha-1,2-mannosidase C52E4.5
Short name:
Alpha-1,2-mannosidase C52E4.5
Gene namesi
ORF Names:C52E4.5
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome V

Organism-specific databases

WormBaseiC52E4.5a; CE08947; WBGene00008258.
C52E4.5b; CE45297; WBGene00008258.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 590590Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5PRO_0000248514Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi156 – 1561N-linked (GlcNAc...)1 Publication
Glycosylationi212 – 2121N-linked (GlcNAc...)Sequence Analysis
Glycosylationi373 – 3731N-linked (GlcNAc...)2 Publications
Glycosylationi402 – 4021N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ18788.

Interactioni

Protein-protein interaction databases

IntActiQ18788. 1 interaction.
MINTiMINT-7966692.
STRINGi6239.C52E4.5.

Structurei

3D structure databases

ProteinModelPortaliQ18788.
SMRiQ18788. Positions 124-588.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 99CytoplasmicSequence Analysis
Topological domaini31 – 590560LumenalSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei10 – 3021Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 47 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG300315.
GeneTreeiENSGT00390000016529.
HOGENOMiHOG000181987.
InParanoidiQ18788.
OMAiYLIKSYV.
OrthoDBiEOG7X0VH1.
PhylomeDBiQ18788.

Family and domain databases

Gene3Di1.50.10.50. 1 hit.
InterProiIPR001382. Glyco_hydro_47.
[Graphical view]
PANTHERiPTHR11742. PTHR11742. 1 hit.
PfamiPF01532. Glyco_hydro_47. 1 hit.
[Graphical view]
PRINTSiPR00747. GLYHDRLASE47.
SUPFAMiSSF48225. SSF48225. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform a (identifier: Q18788) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKTVRFNKQA LAILAACFIF LLCVVCYFSA SSESHNAVVV GERARGHIAV
60 70 80 90 100
RDVENRHLAE EKHAVIHAKT VGKIERVVSQ EKVEILRPAR VESKPPGEKT
110 120 130 140 150
STEPEETGVG KAPIQTSEGL EKLIGKIHYE NKDEENDLRR QKVKEMMIHA
160 170 180 190 200
WEGYKNYSWG ANELRPMSKK PNSQNIFGGS QMPATIVDAA DTLFIMDLKD
210 220 230 240 250
KYKEARDYIE NNFSMAKSTS TLSVFETTIR FLGGLLSLYA LTQESFYIEK
260 270 280 290 300
AREVGEALLP AFNTPSGIPK SNLDVASKHA SNYGWANGGQ SILSEIGSLH
310 320 330 340 350
LEFLYLSRIS NAPIFEKKVK KVRDALEKAE KPNGLYSNYI NPDTGKFTGS
360 370 380 390 400
HMSLGALGDS FYEYLIKSYV QSNYTDTQAK NMYWDVSDAI QKHMIKVSKQ
410 420 430 440 450
SNLTYTVELN NGQAQHKMGH LACFVPGMFA LQAINEDTEE EKLRIMTLAE
460 470 480 490 500
ELAKTCHESY IRSETHIGPE MFYFNERDEA TSKHSENGYI QRPEVIEGWF
510 520 530 540 550
YLWRLTGKTM YRDWVWDAVQ AIEKYCRVDS GFTGLQNVYN PKAGREDVMQ
560 570 580 590
SFFLAEFLKY AYLTFADESL ISLDKWVFNT EAHPVPVLTN
Length:590
Mass (Da):66,950
Last modified:November 1, 1996 - v1
Checksum:iB0714A3671204843
GO
Isoform b (identifier: Q18788-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIDVSSSITNMNVTIVESFLDFFKILAYVSKFSSWKEPNKTTFPHAM

Note: No experimental confirmation available.

Show »
Length:636
Mass (Da):72,204
Checksum:iB012A1EEEA43463B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MIDVSSSITNMNVTIVESFL DFFKILAYVSKFSSWKEPNK TTFPHAM in isoform b. CuratedVSP_044102

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z78012 Genomic DNA. Translation: CAB01415.1.
Z78012 Genomic DNA. Translation: CBW48349.1.
PIRiT20153.
RefSeqiNP_001256388.1. NM_001269459.1. [Q18788-2]
NP_001256389.1. NM_001269460.1. [Q18788-1]
UniGeneiCel.4401.

Genome annotation databases

EnsemblMetazoaiC52E4.5a; C52E4.5a; WBGene00008258. [Q18788-1]
GeneIDi179642.
KEGGicel:CELE_C52E4.5.
UCSCiC52E4.5. c. elegans. [Q18788-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z78012 Genomic DNA. Translation: CAB01415.1 .
Z78012 Genomic DNA. Translation: CBW48349.1 .
PIRi T20153.
RefSeqi NP_001256388.1. NM_001269459.1. [Q18788-2 ]
NP_001256389.1. NM_001269460.1. [Q18788-1 ]
UniGenei Cel.4401.

3D structure databases

ProteinModelPortali Q18788.
SMRi Q18788. Positions 124-588.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q18788. 1 interaction.
MINTi MINT-7966692.
STRINGi 6239.C52E4.5.

Protein family/group databases

CAZyi GH47. Glycoside Hydrolase Family 47.

Proteomic databases

PaxDbi Q18788.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai C52E4.5a ; C52E4.5a ; WBGene00008258 . [Q18788-1 ]
GeneIDi 179642.
KEGGi cel:CELE_C52E4.5.
UCSCi C52E4.5. c. elegans. [Q18788-1 ]

Organism-specific databases

CTDi 179642.
WormBasei C52E4.5a ; CE08947 ; WBGene00008258 .
C52E4.5b ; CE45297 ; WBGene00008258 .

Phylogenomic databases

eggNOGi NOG300315.
GeneTreei ENSGT00390000016529.
HOGENOMi HOG000181987.
InParanoidi Q18788.
OMAi YLIKSYV.
OrthoDBi EOG7X0VH1.
PhylomeDBi Q18788.

Enzyme and pathway databases

UniPathwayi UPA00378 .
Reactomei REACT_183157. Progressive trimming of alpha-1,2-linked mannose residues from Man9/8/7GlcNAc2 to produce Man5GlcNAc2.

Miscellaneous databases

NextBioi 906268.

Family and domain databases

Gene3Di 1.50.10.50. 1 hit.
InterProi IPR001382. Glyco_hydro_47.
[Graphical view ]
PANTHERi PTHR11742. PTHR11742. 1 hit.
Pfami PF01532. Glyco_hydro_47. 1 hit.
[Graphical view ]
PRINTSi PR00747. GLYHDRLASE47.
SUPFAMi SSF48225. SSF48225. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  2. "Lectin affinity capture, isotope-coded tagging and mass spectrometry to identify N-linked glycoproteins."
    Kaji H., Saito H., Yamauchi Y., Shinkawa T., Taoka M., Hirabayashi J., Kasai K., Takahashi N., Isobe T.
    Nat. Biotechnol. 21:667-672(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-373, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Bristol N2.
  3. "Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins."
    Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T.
    Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-156; ASN-373 AND ASN-402, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Bristol N2.

Entry informationi

Entry nameiMAN12_CAEEL
AccessioniPrimary (citable) accession number: Q18788
Secondary accession number(s): E1B6T6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: November 1, 1996
Last modified: October 1, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3