Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q18788

- MAN12_CAEEL

UniProt

Q18788 - MAN12_CAEEL

Protein

Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5

Gene

C52E4.5

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man9GlcNAc2 to produce Man5GlcNAc2 By similarity.By similarity

    Catalytic activityi

    Hydrolysis of the terminal (1->2)-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man9(GlcNAc)2.

    Cofactori

    Calcium.By similarity

    Pathwayi

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Source: UniProtKB-EC

    GO - Biological processi

    1. protein glycosylation Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Glycosidase, Hydrolase

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_183157. Progressive trimming of alpha-1,2-linked mannose residues from Man9/8/7GlcNAc2 to produce Man5GlcNAc2.
    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiGH47. Glycoside Hydrolase Family 47.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 (EC:3.2.1.113)
    Alternative name(s):
    Processing alpha-1,2-mannosidase C52E4.5
    Short name:
    Alpha-1,2-mannosidase C52E4.5
    Gene namesi
    ORF Names:C52E4.5
    OrganismiCaenorhabditis elegans
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome V

    Organism-specific databases

    WormBaseiC52E4.5a; CE08947; WBGene00008258.
    C52E4.5b; CE45297; WBGene00008258.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 590590Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5PRO_0000248514Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi156 – 1561N-linked (GlcNAc...)1 Publication
    Glycosylationi212 – 2121N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi373 – 3731N-linked (GlcNAc...)2 Publications
    Glycosylationi402 – 4021N-linked (GlcNAc...)1 Publication

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ18788.

    Interactioni

    Protein-protein interaction databases

    IntActiQ18788. 1 interaction.
    MINTiMINT-7966692.
    STRINGi6239.C52E4.5.

    Structurei

    3D structure databases

    ProteinModelPortaliQ18788.
    SMRiQ18788. Positions 124-588.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 99CytoplasmicSequence Analysis
    Topological domaini31 – 590560LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei10 – 3021Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyl hydrolase 47 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG300315.
    GeneTreeiENSGT00390000016529.
    HOGENOMiHOG000181987.
    InParanoidiQ18788.
    OMAiYLIKSYV.
    OrthoDBiEOG7X0VH1.
    PhylomeDBiQ18788.

    Family and domain databases

    Gene3Di1.50.10.50. 1 hit.
    InterProiIPR001382. Glyco_hydro_47.
    [Graphical view]
    PANTHERiPTHR11742. PTHR11742. 1 hit.
    PfamiPF01532. Glyco_hydro_47. 1 hit.
    [Graphical view]
    PRINTSiPR00747. GLYHDRLASE47.
    SUPFAMiSSF48225. SSF48225. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform a (identifier: Q18788-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKTVRFNKQA LAILAACFIF LLCVVCYFSA SSESHNAVVV GERARGHIAV    50
    RDVENRHLAE EKHAVIHAKT VGKIERVVSQ EKVEILRPAR VESKPPGEKT 100
    STEPEETGVG KAPIQTSEGL EKLIGKIHYE NKDEENDLRR QKVKEMMIHA 150
    WEGYKNYSWG ANELRPMSKK PNSQNIFGGS QMPATIVDAA DTLFIMDLKD 200
    KYKEARDYIE NNFSMAKSTS TLSVFETTIR FLGGLLSLYA LTQESFYIEK 250
    AREVGEALLP AFNTPSGIPK SNLDVASKHA SNYGWANGGQ SILSEIGSLH 300
    LEFLYLSRIS NAPIFEKKVK KVRDALEKAE KPNGLYSNYI NPDTGKFTGS 350
    HMSLGALGDS FYEYLIKSYV QSNYTDTQAK NMYWDVSDAI QKHMIKVSKQ 400
    SNLTYTVELN NGQAQHKMGH LACFVPGMFA LQAINEDTEE EKLRIMTLAE 450
    ELAKTCHESY IRSETHIGPE MFYFNERDEA TSKHSENGYI QRPEVIEGWF 500
    YLWRLTGKTM YRDWVWDAVQ AIEKYCRVDS GFTGLQNVYN PKAGREDVMQ 550
    SFFLAEFLKY AYLTFADESL ISLDKWVFNT EAHPVPVLTN 590
    Length:590
    Mass (Da):66,950
    Last modified:November 1, 1996 - v1
    Checksum:iB0714A3671204843
    GO
    Isoform b (identifier: Q18788-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MIDVSSSITNMNVTIVESFLDFFKILAYVSKFSSWKEPNKTTFPHAM

    Note: No experimental confirmation available.

    Show »
    Length:636
    Mass (Da):72,204
    Checksum:iB012A1EEEA43463B
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MIDVSSSITNMNVTIVESFL DFFKILAYVSKFSSWKEPNK TTFPHAM in isoform b. CuratedVSP_044102

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z78012 Genomic DNA. Translation: CAB01415.1.
    Z78012 Genomic DNA. Translation: CBW48349.1.
    PIRiT20153.
    RefSeqiNP_001256388.1. NM_001269459.1. [Q18788-2]
    NP_001256389.1. NM_001269460.1. [Q18788-1]
    UniGeneiCel.4401.

    Genome annotation databases

    EnsemblMetazoaiC52E4.5a; C52E4.5a; WBGene00008258. [Q18788-1]
    GeneIDi179642.
    KEGGicel:CELE_C52E4.5.
    UCSCiC52E4.5. c. elegans. [Q18788-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z78012 Genomic DNA. Translation: CAB01415.1 .
    Z78012 Genomic DNA. Translation: CBW48349.1 .
    PIRi T20153.
    RefSeqi NP_001256388.1. NM_001269459.1. [Q18788-2 ]
    NP_001256389.1. NM_001269460.1. [Q18788-1 ]
    UniGenei Cel.4401.

    3D structure databases

    ProteinModelPortali Q18788.
    SMRi Q18788. Positions 124-588.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q18788. 1 interaction.
    MINTi MINT-7966692.
    STRINGi 6239.C52E4.5.

    Protein family/group databases

    CAZyi GH47. Glycoside Hydrolase Family 47.

    Proteomic databases

    PaxDbi Q18788.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai C52E4.5a ; C52E4.5a ; WBGene00008258 . [Q18788-1 ]
    GeneIDi 179642.
    KEGGi cel:CELE_C52E4.5.
    UCSCi C52E4.5. c. elegans. [Q18788-1 ]

    Organism-specific databases

    CTDi 179642.
    WormBasei C52E4.5a ; CE08947 ; WBGene00008258 .
    C52E4.5b ; CE45297 ; WBGene00008258 .

    Phylogenomic databases

    eggNOGi NOG300315.
    GeneTreei ENSGT00390000016529.
    HOGENOMi HOG000181987.
    InParanoidi Q18788.
    OMAi YLIKSYV.
    OrthoDBi EOG7X0VH1.
    PhylomeDBi Q18788.

    Enzyme and pathway databases

    UniPathwayi UPA00378 .
    Reactomei REACT_183157. Progressive trimming of alpha-1,2-linked mannose residues from Man9/8/7GlcNAc2 to produce Man5GlcNAc2.

    Miscellaneous databases

    NextBioi 906268.

    Family and domain databases

    Gene3Di 1.50.10.50. 1 hit.
    InterProi IPR001382. Glyco_hydro_47.
    [Graphical view ]
    PANTHERi PTHR11742. PTHR11742. 1 hit.
    Pfami PF01532. Glyco_hydro_47. 1 hit.
    [Graphical view ]
    PRINTSi PR00747. GLYHDRLASE47.
    SUPFAMi SSF48225. SSF48225. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
      Strain: Bristol N2.
    2. "Lectin affinity capture, isotope-coded tagging and mass spectrometry to identify N-linked glycoproteins."
      Kaji H., Saito H., Yamauchi Y., Shinkawa T., Taoka M., Hirabayashi J., Kasai K., Takahashi N., Isobe T.
      Nat. Biotechnol. 21:667-672(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-373, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: Bristol N2.
    3. "Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins."
      Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T.
      Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-156; ASN-373 AND ASN-402, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: Bristol N2.

    Entry informationi

    Entry nameiMAN12_CAEEL
    AccessioniPrimary (citable) accession number: Q18788
    Secondary accession number(s): E1B6T6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 5, 2006
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 105 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. Glycosyl hydrolases
      Classification of glycosyl hydrolase families and list of entries
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3