Q18788 (MAN12_CAEEL) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 EC=3.2.1.113 Alternative name(s): Processing alpha-1,2-mannosidase C52E4.5 Short name=Alpha-1,2-mannosidase C52E4.5 | ||
| Gene names |
| ||
| Organism | Caenorhabditis elegans [Reference proteome] | ||
| Taxonomic identifier | 6239 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis![]() |
Protein attributes
| Sequence length | 590 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man9GlcNAc2 to produce Man5GlcNAc2 By similarity. |
| Catalytic activity | Hydrolysis of the terminal (1->2)-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man9(GlcNAc)2. |
| Cofactor | Calcium By similarity. |
| Pathway | |
| Subcellular location | |
| Sequence similarities | Belongs to the glycosyl hydrolase 47 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Calcium |
| Molecular function | Glycosidase Hydrolase |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein glycosylation Inferred from electronic annotation. Source: UniProtKB-UniPathway |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro mannosyl-oligosaccharide 1,2-alpha-mannosidase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: Q18788-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform b (identifier: Q18788-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MIDVSSSITNMNVTIVESFLDFFKILAYVSKFSSWKEPNKTTFPHAM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 590 | 590 | Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 | PRO_0000248514 | |||||
Regions | |||||||||
| Topological domain | 1 – 9 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 10 – 30 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 31 – 590 | 560 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 156 | 1 | N-linked (GlcNAc...) Ref.3 | ||||||
| Glycosylation | 212 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 373 | 1 | N-linked (GlcNAc...) Ref.2 Ref.3 | ||||||
| Glycosylation | 402 | 1 | N-linked (GlcNAc...) Ref.3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MIDVSSSITNMNVTIVESFL DFFKILAYVSKFSSWKEPNK TTFPHAM in isoform b. | VSP_044102 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| [2] | "Lectin affinity capture, isotope-coded tagging and mass spectrometry to identify N-linked glycoproteins." Kaji H., Saito H., Yamauchi Y., Shinkawa T., Taoka M., Hirabayashi J., Kasai K., Takahashi N., Isobe T. Nat. Biotechnol. 21:667-672(2003) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-373, MASS SPECTROMETRY. Strain: Bristol N2. |
| [3] | "Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins." Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T. Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-156; ASN-373 AND ASN-402, MASS SPECTROMETRY. Strain: Bristol N2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z78012 Genomic DNA. Translation: CAB01415.1. Z78012 Genomic DNA. Translation: CBW48349.1. |
| PIR | T20153. |
| RefSeq | NP_001256388.1. NM_001269459.1. NP_001256389.1. NM_001269460.1. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1X9D based on UniProtKB Q9UKM7. |
| ProteinModelPortal | Q18788. |
| SMR | Q18788. Positions 124-588. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 6239.C52E4.5. |
Protein family/group databases | |
| CAZy | GH47. Glycoside Hydrolase Family 47. |
Proteomic databases | |
| PaxDb | Q18788. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | C52E4.5a; C52E4.5a; C52E4.5. |
| GeneID | 179642. |
| KEGG | cel:CELE_C52E4.5. |
| UCSC | C52E4.5. c. elegans. |
Organism-specific databases | |
| CTD | 179642. |
| WormBase | C52E4.5a; CE08947; WBGene00008258. C52E4.5b; CE45297; WBGene00008258. |
Phylogenomic databases | |
| eggNOG | NOG300315. |
| GeneTree | ENSGT00390000016529. |
| HOGENOM | HOG000181987. |
| InParanoid | Q18788. |
| OMA | YLIKSYV. |
Enzyme and pathway databases | |
| UniPathway | UPA00378. |
Gene expression databases | |
| ArrayExpress | Q18788. |
Family and domain databases | |
| Gene3D | 1.50.10.50. 1 hit. |
| InterPro | IPR001382. Glyco_hydro_47. [Graphical view] |
| PANTHER | PTHR11742. PTHR11742. 1 hit. |
| Pfam | PF01532. Glyco_hydro_47. 1 hit. [Graphical view] |
| PRINTS | PR00747. GLYHDRLASE47. |
| SUPFAM | SSF48225. Glyco_hydro_47. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 906268. |
Entry information
| Entry name | MAN12_CAEEL | ||||||||
| Accession | Primary (citable) accession number: Q18788 Secondary accession number(s): E1B6T6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Caenorhabditis annotation project | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormBase |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
