Reviewed,
UniProtKB/Swiss-Prot Q18680 (IPYR_CAEEL)
Last modified
October 13, 2009.
Version 77.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Probable inorganic pyrophosphatase 1 EC=3.6.1.1 Alternative name(s): Pyrophosphate phospho-hydrolase Short name=PPase | ||||||
| Gene names |
| ||||||
| Organism | Caenorhabditis elegans [Complete proteome] | ||||||
| Taxonomic identifier | 6239 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 407 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | Diphosphate + H2O = 2 phosphate. |
| Cofactor | Binds 4 magnesium ions per subunit. Other metal ions can support activity, but at a lower rate. Two magnesium ions are required for the activation of the enzyme and are present before substrate binds, two additional magnesium ions form complexes with substrate and product By similarity. |
| Sequence similarities | Belongs to the PPase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Metal-binding |
| Molecular function | Hydrolase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | embryonic development ending in birth or egg hatching Inferred from mutant phenotype. Source: WormBase growthInferred from mutant phenotype. Source: WormBase nematode larval developmentInferred from mutant phenotype. Source: WormBase phosphate metabolic processInferred from electronic annotation. Source: InterPro positive regulation of growth rateInferred from mutant phenotype. Source: WormBase reproductionInferred from mutant phenotype. Source: WormBase |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: InterPro |
| Molecular function | inorganic diphosphatase activity Inferred from electronic annotation. Source: EC magnesium ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform b (identifier: Q18680-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform a (identifier: Q18680-2) The sequence of this isoform differs from the canonical sequence as follows: 1-69: Missing. 70-100: RGSLTTAVSTSSSGAQRQMSANSERSLHTRL → MGLVLIAKRNKPLIAMMAAILFTVAVFLATR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform c (identifier: Q18680-3) The sequence of this isoform differs from the canonical sequence as follows: 100-100: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform d (identifier: Q18680-4) The sequence of this isoform differs from the canonical sequence as follows: 1-115: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 407 | 407 | Probable inorganic pyrophosphatase 1 | PRO_0000137571 | |||||
Sites | |||||||||
| Metal binding | 239 | 1 | Magnesium 1 By similarity | ||||||
| Metal binding | 244 | 1 | Magnesium 1 By similarity | ||||||
| Metal binding | 244 | 1 | Magnesium 2 By similarity | ||||||
| Metal binding | 276 | 1 | Magnesium 1 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 115 | 115 | Missing in isoform d. | VSP_009599 | |||||
| Alternative sequence | 1 – 69 | 69 | Missing in isoform a. | VSP_009598 | |||||
| Alternative sequence | 70 – 100 | 31 | RGSLT…LHTRL → MGLVLIAKRNKPLIAMMAAI LFTVAVFLATR in isoform a. | VSP_009600 | |||||
| Alternative sequence | 100 | 1 | Missing in isoform c. | VSP_009601 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| Z68882 Genomic DNA. Translation: CAA93107.3. Z68882 Genomic DNA. Translation: CAD89726.1. Z68882 Genomic DNA. Translation: CAD89727.1. Z68882 Genomic DNA. Translation: CAD89728.1. | |
| PIR | E88797. T20014. |
| RefSeq | NP_001023073.1. NP_001023074.1. NP_001023075.1. NP_001023076.1. |
| UniGene | Cel.8431 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1WGI based on UniProtKB P00817. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q18680. 1 interaction. |
| STRING | Q18680. |
Proteomic databases | |
| PRIDE | Q18680. |
Genome annotation databases | |
| Ensembl | C47E12.4a.1; C47E12.4a.1; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4a.2; C47E12.4a.2; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4b; C47E12.4b; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4c.1; C47E12.4c.1; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4c.2; C47E12.4c.2; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4c.3; C47E12.4c.3; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4d.1; C47E12.4d.1; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4d.2; C47E12.4d.2; C47E12.4; Caenorhabditis elegans. [Genome view] C47E12.4d.3; C47E12.4d.3; C47E12.4; Caenorhabditis elegans. [Genome view] |
| GeneID | 177856. |
| KEGG | cel:C47E12.4. |
| UCSC | C47E12.5a.1. c. elegans. |
Organism-specific databases | |
| CTD | 177856. |
| WormBase | WBGene00008149. pyp-1. |
| WormPep | C47E12.4a. CE33767. [WorfDB] C47E12.4b. CE33768. [WorfDB] C47E12.4c. CE33769. [WorfDB] C47E12.4d. CE05448. [WorfDB] |
Enzyme and pathway databases | |
| BRENDA | 3.6.1.1. 672. |
Gene expression databases | |
| ArrayExpress | Q18680. |
Family and domain databases | |
| InterPro | IPR008162. Pyrophosphatase. [Graphical view] |
| Gene3D | G3DSA:3.90.80.10. Pyrophosphatase. 1 hit. |
| PANTHER | PTHR10286. Pyrophosphatase. 1 hit. |
| Pfam | PF00719. Pyrophosphatase. 1 hit. [Graphical view] |
| ProDom | PD002014. Inorg_pphsph. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| PROSITE | PS00387. PPASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 898676. |
Entry information
| Entry name | IPYR_CAEEL | ||||||||
| Accession | Primary (citable) accession number: Q18680 Secondary accession number(s): Q86DB1, Q86DB2, Q86DB3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| SIMILARITY comments Index of protein domains and families |

Clusters with


