Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lymphocyte antigen 6K

Gene

LY6K

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in cell growth.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Lymphocyte antigen 6K
Short name:
Ly-6K
Gene namesi
Name:LY6K
Synonyms:CO16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:24225. LY6K.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134987940.

Polymorphism and mutation databases

BioMutaiLY6K.
DMDMi189028864.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717Sequence analysisAdd
BLAST
Chaini18 – 138121Lymphocyte antigen 6KPRO_0000337084Add
BLAST
Propeptidei139 – 16527Removed in mature formSequence analysisPRO_0000337085Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi20 – 201N-linked (GlcNAc...)Sequence analysis
Lipidationi138 – 1381GPI-anchor amidated glycineSequence analysis

Keywords - PTMi

Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

EPDiQ17RY6.
MaxQBiQ17RY6.
PaxDbiQ17RY6.
PRIDEiQ17RY6.

Expressioni

Tissue specificityi

Specifically expressed in testis (at protein level).2 Publications

Gene expression databases

BgeeiQ17RY6.
CleanExiHS_LY6K.
ExpressionAtlasiQ17RY6. baseline and differential.
GenevisibleiQ17RY6. HS.

Organism-specific databases

HPAiHPA017770.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000453042.

Structurei

3D structure databases

ProteinModelPortaliQ17RY6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini47 – 14195UPAR/Ly6Add
BLAST

Sequence similaritiesi

Contains 1 UPAR/Ly6 domain.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410JG7H. Eukaryota.
ENOG411134J. LUCA.
GeneTreeiENSGT00520000056196.
HOGENOMiHOG000172423.
InParanoidiQ17RY6.
OMAiLEGPPIN.
PhylomeDBiQ17RY6.
TreeFamiTF336908.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q17RY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALLALLLVV ALPRVWTDAN LTARQRDPED SQRTDEGDNR VWCHVCEREN
60 70 80 90 100
TFECQNPRRC KWTEPYCVIA AVKIFPRFFM VAKQCSAGCA AMERPKPEEK
110 120 130 140 150
RFLLEEPMPF FYLKCCKIRY CNLEGPPINS SVFKEYAGSM GESCGGLWLA
160
ILLLLASIAA GLSLS
Length:165
Mass (Da):18,673
Last modified:May 20, 2008 - v2
Checksum:iBA75B436BE91363D
GO
Isoform 2 (identifier: Q17RY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-105: KIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLE → TVLRWLCSDGETQARGEAVSPGRAHALLLPQVL
     106-165: Missing.

Note: No experimental confirmation available.
Show »
Length:105
Mass (Da):11,902
Checksum:iD2FEF4616469798C
GO

Sequence cautioni

The sequence AAH01291.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAI17143.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAI17145.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAA04692.1 differs from that shown. Reason: Frameshift at positions 182 and 184. Curated
The sequence CAA04692.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence EAW82311.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti29 – 291E → Q in CAA04692 (Ref. 1) Curated
Sequence conflicti41 – 411V → A in CAA04692 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei73 – 10533KIFPR…RFLLE → TVLRWLCSDGETQARGEAVS PGRAHALLLPQVL in isoform 2. 1 PublicationVSP_045602Add
BLAST
Alternative sequencei106 – 16560Missing in isoform 2. 1 PublicationVSP_045603Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001348 mRNA. Translation: CAA04692.1. Sequence problems.
AC108002 Genomic DNA. No translation available.
CH471162 Genomic DNA. Translation: EAW82311.1. Different initiation.
BC001291 mRNA. Translation: AAH01291.2. Different initiation.
BC117142 mRNA. Translation: AAI17143.1. Different initiation.
BC117144 mRNA. Translation: AAI17145.1. Different initiation.
AI740834 mRNA. No translation available.
CCDSiCCDS59114.1. [Q17RY6-2]
CCDS6385.2. [Q17RY6-1]
RefSeqiNP_001153826.1. NM_001160354.1.
NP_001153827.1. NM_001160355.1. [Q17RY6-2]
NP_059997.3. NM_017527.3. [Q17RY6-1]
UniGeneiHs.69517.
Hs.716823.

Genome annotation databases

EnsembliENST00000292430; ENSP00000292430; ENSG00000160886. [Q17RY6-1]
ENST00000519387; ENSP00000429695; ENSG00000160886. [Q17RY6-2]
GeneIDi54742.
KEGGihsa:54742.
UCSCiuc011ljv.3. human. [Q17RY6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001348 mRNA. Translation: CAA04692.1. Sequence problems.
AC108002 Genomic DNA. No translation available.
CH471162 Genomic DNA. Translation: EAW82311.1. Different initiation.
BC001291 mRNA. Translation: AAH01291.2. Different initiation.
BC117142 mRNA. Translation: AAI17143.1. Different initiation.
BC117144 mRNA. Translation: AAI17145.1. Different initiation.
AI740834 mRNA. No translation available.
CCDSiCCDS59114.1. [Q17RY6-2]
CCDS6385.2. [Q17RY6-1]
RefSeqiNP_001153826.1. NM_001160354.1.
NP_001153827.1. NM_001160355.1. [Q17RY6-2]
NP_059997.3. NM_017527.3. [Q17RY6-1]
UniGeneiHs.69517.
Hs.716823.

3D structure databases

ProteinModelPortaliQ17RY6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000453042.

Polymorphism and mutation databases

BioMutaiLY6K.
DMDMi189028864.

Proteomic databases

EPDiQ17RY6.
MaxQBiQ17RY6.
PaxDbiQ17RY6.
PRIDEiQ17RY6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000292430; ENSP00000292430; ENSG00000160886. [Q17RY6-1]
ENST00000519387; ENSP00000429695; ENSG00000160886. [Q17RY6-2]
GeneIDi54742.
KEGGihsa:54742.
UCSCiuc011ljv.3. human. [Q17RY6-1]

Organism-specific databases

CTDi54742.
GeneCardsiLY6K.
HGNCiHGNC:24225. LY6K.
HPAiHPA017770.
MIMi615093. gene.
neXtProtiNX_Q17RY6.
PharmGKBiPA134987940.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JG7H. Eukaryota.
ENOG411134J. LUCA.
GeneTreeiENSGT00520000056196.
HOGENOMiHOG000172423.
InParanoidiQ17RY6.
OMAiLEGPPIN.
PhylomeDBiQ17RY6.
TreeFamiTF336908.

Miscellaneous databases

GenomeRNAii54742.
PROiQ17RY6.
SOURCEiSearch...

Gene expression databases

BgeeiQ17RY6.
CleanExiHS_LY6K.
ExpressionAtlasiQ17RY6. baseline and differential.
GenevisibleiQ17RY6. HS.

Family and domain databases

ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of a novel cDNA not expressed in Fanconi anemia fibroblasts and B-cell lines."
    Machl A.W., Planitzer S.A., Rueckels M., Kubbies M.
    Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fibroblast.
  2. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain and Cervix.
  5. The Cancer Genome Anatomy Project (CGAP) at the National Cancer Institute
    Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-104 (ISOFORM 2).
  6. "Characterization of the human Ly-6 antigens, the newly annotated member Ly-6K included, as molecular markers for head-and-neck squamous cell carcinoma."
    de Nooij-van Dalen A.G., van Dongen G.A.M.S., Smeets S.J., Nieuwenhuis E.J.C., Stigter-van Walsum M., Snow G.B., Brakenhoff R.H.
    Int. J. Cancer 103:768-774(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. "Cancer-testis antigen lymphocyte antigen 6 complex locus K is a serologic biomarker and a therapeutic target for lung and esophageal carcinomas."
    Ishikawa N., Takano A., Yasui W., Inai K., Nishimura H., Ito H., Miyagi Y., Nakayama H., Fujita M., Hosokawa M., Tsuchiya E., Kohno N., Nakamura Y., Daigo Y.
    Cancer Res. 67:11601-11611(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiLY6K_HUMAN
AccessioniPrimary (citable) accession number: Q17RY6
Secondary accession number(s): G3V116, O15227, Q9BVD7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: June 8, 2016
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.