Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative deoxyribonuclease TATDN3

Gene

TATDN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Putative deoxyribonuclease.

Cofactori

a divalent metal cationNote: Binds 2 divalent metal cations per subunit.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi12 – 121Divalent metal cation 1
Metal bindingi14 – 141Divalent metal cation 1
Metal bindingi107 – 1071Divalent metal cation 1
Metal bindingi107 – 1071Divalent metal cation 2
Metal bindingi147 – 1471Divalent metal cation 2
Metal bindingi170 – 1701Divalent metal cation 2
Metal bindingi218 – 2181Divalent metal cation 1

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Nuclease

Keywords - Ligandi

Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Putative deoxyribonuclease TATDN3 (EC:3.1.21.-)
Gene namesi
Name:TATDN3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:27010. TATDN3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670831.

Polymorphism and mutation databases

BioMutaiTATDN3.
DMDMi121948822.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 274274Putative deoxyribonuclease TATDN3PRO_0000313595Add
BLAST

Proteomic databases

MaxQBiQ17R31.
PaxDbiQ17R31.
PeptideAtlasiQ17R31.
PRIDEiQ17R31.

PTM databases

iPTMnetiQ17R31.
PhosphoSiteiQ17R31.

Expressioni

Gene expression databases

BgeeiENSG00000203705.
CleanExiHS_TATDN3.
ExpressionAtlasiQ17R31. baseline and differential.
GenevisibleiQ17R31. HS.

Organism-specific databases

HPAiHPA032092.
HPA042598.

Interactioni

Protein-protein interaction databases

BioGridi126118. 4 interactions.
IntActiQ17R31. 4 interactions.
STRINGi9606.ENSP00000431376.

Structurei

Secondary structure

1
274
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi8 – 136Combined sources
Helixi18 – 203Combined sources
Turni21 – 233Combined sources
Helixi24 – 3310Combined sources
Beta strandi36 – 416Combined sources
Helixi46 – 483Combined sources
Helixi49 – 5810Combined sources
Turni59 – 624Combined sources
Beta strandi63 – 675Combined sources
Helixi85 – 9814Combined sources
Helixi99 – 1013Combined sources
Beta strandi103 – 1097Combined sources
Turni114 – 1163Combined sources
Helixi120 – 14021Combined sources
Beta strandi144 – 1474Combined sources
Helixi152 – 16110Combined sources
Beta strandi166 – 1705Combined sources
Helixi176 – 1849Combined sources
Beta strandi188 – 1914Combined sources
Helixi193 – 1964Combined sources
Helixi199 – 2079Combined sources
Helixi210 – 2123Combined sources
Beta strandi213 – 2153Combined sources
Helixi232 – 2343Combined sources
Helixi235 – 24612Combined sources
Helixi250 – 26415Combined sources
Helixi268 – 2714Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2Y1HX-ray2.50A/B5-274[»]
ProteinModelPortaliQ17R31.
SMRiQ17R31. Positions 5-272.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TatD-type hydrolase family.Curated

Phylogenomic databases

eggNOGiKOG3020. Eukaryota.
COG0084. LUCA.
GeneTreeiENSGT00720000108846.
HOGENOMiHOG000201525.
HOVERGENiHBG106421.
InParanoidiQ17R31.
KOiK03424.
OMAiICVGECG.
OrthoDBiEOG091G0JN0.
PhylomeDBiQ17R31.

Family and domain databases

InterProiIPR032466. Metal_Hydrolase.
IPR001130. TatD_family.
[Graphical view]
PANTHERiPTHR10060. PTHR10060. 1 hit.
PfamiPF01026. TatD_DNase. 1 hit.
[Graphical view]
PIRSFiPIRSF005902. DNase_TatD. 1 hit.
SUPFAMiSSF51556. SSF51556. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q17R31-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRAAGVGLVD CHCHLSAPDF DRDLDDVLEK AKKANVVALV AVAEHSGEFE
60 70 80 90 100
KIMQLSERYN GFVLPCLGVH PVQGLPPEDQ RSVTLKDLDV ALPIIENYKD
110 120 130 140 150
RLLAIGEVGL DFSPRFAGTG EQKEEQRQVL IRQIQLAKRL NLPVNVHSRS
160 170 180 190 200
AGRPTINLLQ EQGAEKVLLH AFDGRPSVAM EGVRAGYFFS IPPSIIRSGQ
210 220 230 240 250
KQKLVKQLPL TSICLETDSP ALGPEKQVRN EPWNISISAE YIAQVKGISV
260 270
EEVIEVTTQN ALKLFPKLRH LLQK
Length:274
Mass (Da):30,333
Last modified:July 25, 2006 - v1
Checksum:iD2428A5666E164A5
GO
Isoform 2 (identifier: Q17R31-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     201-201: Missing.

Note: Gene prediction based on EST data.
Show »
Length:273
Mass (Da):30,205
Checksum:i8E68621787CB18E9
GO
Isoform 3 (identifier: Q17R31-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: Q → QLLSLFSK

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):31,122
Checksum:i7EF47D4C411BE35E
GO
Isoform 4 (identifier: Q17R31-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-107: Missing.

Note: No experimental confirmation available.
Show »
Length:253
Mass (Da):27,980
Checksum:iC8474597AACFED9D
GO
Isoform 5 (identifier: Q17R31-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: Q → QLLSLFSK
     228-274: VRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQK → QNILPR

Show »
Length:240
Mass (Da):26,458
Checksum:iE78E1CD69060E04C
GO

Sequence cautioni

The sequence AAH48115 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti86 – 861K → R in BAH11457 (PubMed:14702039).Curated
Sequence conflicti171 – 1711A → T in BAH11457 (PubMed:14702039).Curated
Sequence conflicti231 – 2311E → G in BAH14214 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei87 – 10721Missing in isoform 4. 1 PublicationVSP_045263Add
BLAST
Alternative sequencei200 – 2001Q → QLLSLFSK in isoform 3 and isoform 5. 1 PublicationVSP_044448
Alternative sequencei201 – 2011Missing in isoform 2. 1 PublicationVSP_030048
Alternative sequencei228 – 27447VRNEP…HLLQK → QNILPR in isoform 5. CuratedVSP_045742Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293129 mRNA. Translation: BAH11457.1.
AK304557 mRNA. Translation: BAH14214.1.
AC104333 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93376.1.
CH471100 Genomic DNA. Translation: EAW93377.1.
CH471100 Genomic DNA. Translation: EAW93378.1.
BC048115 mRNA. Translation: AAH48115.1. Different initiation.
BC113638 mRNA. Translation: AAI13639.1.
BC117485 mRNA. Translation: AAI17486.1.
BC143956 mRNA. Translation: AAI43957.1.
CCDSiCCDS31019.1. [Q17R31-1]
CCDS41465.1. [Q17R31-2]
CCDS53475.1. [Q17R31-3]
CCDS53476.1. [Q17R31-5]
CCDS53477.1. [Q17R31-4]
RefSeqiNP_001036017.1. NM_001042552.2. [Q17R31-1]
NP_001036018.1. NM_001042553.2. [Q17R31-2]
NP_001139641.1. NM_001146169.1. [Q17R31-5]
NP_001139642.1. NM_001146170.1. [Q17R31-4]
NP_001139643.1. NM_001146171.1. [Q17R31-3]
UniGeneiHs.530538.

Genome annotation databases

EnsembliENST00000366973; ENSP00000355940; ENSG00000203705. [Q17R31-2]
ENST00000366974; ENSP00000355941; ENSG00000203705. [Q17R31-1]
ENST00000526641; ENSP00000434801; ENSG00000203705. [Q17R31-4]
ENST00000531963; ENSP00000433755; ENSG00000203705. [Q17R31-5]
ENST00000532324; ENSP00000431376; ENSG00000203705. [Q17R31-3]
GeneIDi128387.
KEGGihsa:128387.
UCSCiuc001hjo.3. human. [Q17R31-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293129 mRNA. Translation: BAH11457.1.
AK304557 mRNA. Translation: BAH14214.1.
AC104333 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93376.1.
CH471100 Genomic DNA. Translation: EAW93377.1.
CH471100 Genomic DNA. Translation: EAW93378.1.
BC048115 mRNA. Translation: AAH48115.1. Different initiation.
BC113638 mRNA. Translation: AAI13639.1.
BC117485 mRNA. Translation: AAI17486.1.
BC143956 mRNA. Translation: AAI43957.1.
CCDSiCCDS31019.1. [Q17R31-1]
CCDS41465.1. [Q17R31-2]
CCDS53475.1. [Q17R31-3]
CCDS53476.1. [Q17R31-5]
CCDS53477.1. [Q17R31-4]
RefSeqiNP_001036017.1. NM_001042552.2. [Q17R31-1]
NP_001036018.1. NM_001042553.2. [Q17R31-2]
NP_001139641.1. NM_001146169.1. [Q17R31-5]
NP_001139642.1. NM_001146170.1. [Q17R31-4]
NP_001139643.1. NM_001146171.1. [Q17R31-3]
UniGeneiHs.530538.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2Y1HX-ray2.50A/B5-274[»]
ProteinModelPortaliQ17R31.
SMRiQ17R31. Positions 5-272.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126118. 4 interactions.
IntActiQ17R31. 4 interactions.
STRINGi9606.ENSP00000431376.

PTM databases

iPTMnetiQ17R31.
PhosphoSiteiQ17R31.

Polymorphism and mutation databases

BioMutaiTATDN3.
DMDMi121948822.

Proteomic databases

MaxQBiQ17R31.
PaxDbiQ17R31.
PeptideAtlasiQ17R31.
PRIDEiQ17R31.

Protocols and materials databases

DNASUi128387.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000366973; ENSP00000355940; ENSG00000203705. [Q17R31-2]
ENST00000366974; ENSP00000355941; ENSG00000203705. [Q17R31-1]
ENST00000526641; ENSP00000434801; ENSG00000203705. [Q17R31-4]
ENST00000531963; ENSP00000433755; ENSG00000203705. [Q17R31-5]
ENST00000532324; ENSP00000431376; ENSG00000203705. [Q17R31-3]
GeneIDi128387.
KEGGihsa:128387.
UCSCiuc001hjo.3. human. [Q17R31-1]

Organism-specific databases

CTDi128387.
GeneCardsiTATDN3.
HGNCiHGNC:27010. TATDN3.
HPAiHPA032092.
HPA042598.
neXtProtiNX_Q17R31.
PharmGKBiPA142670831.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3020. Eukaryota.
COG0084. LUCA.
GeneTreeiENSGT00720000108846.
HOGENOMiHOG000201525.
HOVERGENiHBG106421.
InParanoidiQ17R31.
KOiK03424.
OMAiICVGECG.
OrthoDBiEOG091G0JN0.
PhylomeDBiQ17R31.

Miscellaneous databases

ChiTaRSiTATDN3. human.
GenomeRNAii128387.
PROiQ17R31.

Gene expression databases

BgeeiENSG00000203705.
CleanExiHS_TATDN3.
ExpressionAtlasiQ17R31. baseline and differential.
GenevisibleiQ17R31. HS.

Family and domain databases

InterProiIPR032466. Metal_Hydrolase.
IPR001130. TatD_family.
[Graphical view]
PANTHERiPTHR10060. PTHR10060. 1 hit.
PfamiPF01026. TatD_DNase. 1 hit.
[Graphical view]
PIRSFiPIRSF005902. DNase_TatD. 1 hit.
SUPFAMiSSF51556. SSF51556. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiTATD3_HUMAN
AccessioniPrimary (citable) accession number: Q17R31
Secondary accession number(s): A6NGS3
, B7Z1C1, B7Z978, B7ZLQ6, E9PJE5, E9PNH3, G3V151, Q4G0L1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 25, 2006
Last modified: September 7, 2016
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.