Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q17QS4

- PI5L1_BOVIN

UniProt

Q17QS4 - PI5L1_BOVIN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phosphatidylinositol 4-phosphate 5-kinase-like protein 1

Gene

PIP5KL1

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

May act as a scaffold to localize and regulate type I PI4P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.By similarity

Catalytic activityi

ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

GO - Molecular functioni

  1. 1-phosphatidylinositol-4-phosphate 5-kinase activity Source: UniProtKB-EC
  2. ATP binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 (EC:2.7.1.68)
Short name:
PI(4)P 5-kinase-like protein 1
Short name:
PtdIns(4)P-5-kinase-like protein 1
Gene namesi
Name:PIP5KL1
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
ProteomesiUP000009136: Unplaced

Subcellular locationi

Cytoplasm. Membrane
Note: Localized to large cytoplasmic vesicular structures.By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 396396Phosphatidylinositol 4-phosphate 5-kinase-like protein 1PRO_0000285757Add
BLAST

Proteomic databases

PRIDEiQ17QS4.

Interactioni

Subunit structurei

Heterodimerizes with other type I phosphatidylinositol 4-phosphate 5-kinase.By similarity

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000004392.

Structurei

3D structure databases

ProteinModelPortaliQ17QS4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini38 – 395358PIPKPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 PIPK domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG5253.
HOGENOMiHOG000115541.
HOVERGENiHBG097351.
InParanoidiQ17QS4.
KOiK13712.

Family and domain databases

Gene3Di3.30.800.10. 1 hit.
3.30.810.10. 1 hit.
InterProiIPR023610. PInositol-4-P-5-kinase.
IPR027483. PInositol-4-P-5-kinase_C.
IPR002498. PInositol-4-P-5-kinase_core.
IPR027484. PInositol-4-P-5-kinase_N.
[Graphical view]
PANTHERiPTHR23086. PTHR23086. 1 hit.
PfamiPF01504. PIP5K. 1 hit.
[Graphical view]
PROSITEiPS51455. PIPK. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q17QS4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPSPGPRE ILAPSPEAGR RAAASSSGHR GLLWRLRDKQ CRLGLFEIGP
60 70 80 90 100
GHELHQVMCL MQAGLWAATQ VSMDHPPTGL PTEEDFSEVL TQVHEGFELG
110 120 130 140 150
TLAGPVFARL RRSLGLAEED YQAALGPSRP YLQFLSTSKS KASFFLSHDQ
160 170 180 190 200
RFFLKTLRSR EVQALLAHLP RYVHHLQRHP HSLLARVLGV HSLRVARGKK
210 220 230 240 250
KYFIVMQSVF YPAGRISERY DIKGCEVSRW VEPAPEGSVL VLVLKDLNFQ
260 270 280 290 300
GKTINLGPQR SWFLRQMELD TAFLRELNVL DYSLLMAFQR LHEDERGPGS
310 320 330 340 350
SLIFRTARSI RGAQSAEESG AQNRRLLPDA PNALHIVDGP EHRYFLGLVD
360 370 380 390
LTTVYGLRKR LEQLWKTLRY PGRTFSTVSP ACYARRLCQW VEAHTE
Length:396
Mass (Da):44,778
Last modified:July 25, 2006 - v1
Checksum:i218E24E583B1EF78
GO
Isoform 2 (identifier: Q17QS4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-224: Missing.
     225-257: CEVSRWVEPAPEGSVLVLVLKDLNFQGKTINLG → MSPALPGQVRVEPAAPCPAPDEHSGWGTDAPAG

Note: No experimental confirmation available.

Show »
Length:172
Mass (Da):19,385
Checksum:i7CF20070FF2113DB
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 224224Missing in isoform 2. 1 PublicationVSP_024902Add
BLAST
Alternative sequencei225 – 25733CEVSR…TINLG → MSPALPGQVRVEPAAPCPAP DEHSGWGTDAPAG in isoform 2. 1 PublicationVSP_024903Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT021629 mRNA. Translation: AAX46476.1.
BC118210 mRNA. Translation: AAI18211.1.
RefSeqiNP_001069315.2. NM_001075847.2. [Q17QS4-1]
UniGeneiBt.37390.

Genome annotation databases

GeneIDi523736.
KEGGibta:523736.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BT021629 mRNA. Translation: AAX46476.1 .
BC118210 mRNA. Translation: AAI18211.1 .
RefSeqi NP_001069315.2. NM_001075847.2. [Q17QS4-1 ]
UniGenei Bt.37390.

3D structure databases

ProteinModelPortali Q17QS4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9913.ENSBTAP00000004392.

Proteomic databases

PRIDEi Q17QS4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 523736.
KEGGi bta:523736.

Organism-specific databases

CTDi 138429.

Phylogenomic databases

eggNOGi COG5253.
HOGENOMi HOG000115541.
HOVERGENi HBG097351.
InParanoidi Q17QS4.
KOi K13712.

Miscellaneous databases

NextBioi 20873812.

Family and domain databases

Gene3Di 3.30.800.10. 1 hit.
3.30.810.10. 1 hit.
InterProi IPR023610. PInositol-4-P-5-kinase.
IPR027483. PInositol-4-P-5-kinase_C.
IPR002498. PInositol-4-P-5-kinase_core.
IPR027484. PInositol-4-P-5-kinase_N.
[Graphical view ]
PANTHERi PTHR23086. PTHR23086. 1 hit.
Pfami PF01504. PIP5K. 1 hit.
[Graphical view ]
PROSITEi PS51455. PIPK. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  2. NIH - Mammalian Gene Collection (MGC) project
    Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Hereford.
    Tissue: Thalamus.

Entry informationi

Entry nameiPI5L1_BOVIN
AccessioniPrimary (citable) accession number: Q17QS4
Secondary accession number(s): Q58DG8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: July 25, 2006
Last modified: October 29, 2014
This is version 55 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3