Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q17QS4 (PI5L1_BOVIN) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 53. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Phosphatidylinositol 4-phosphate 5-kinase-like protein 1

Short name=PI(4)P 5-kinase-like protein 1
Short name=PtdIns(4)P-5-kinase-like protein 1
EC=2.7.1.68
Gene names
Name:PIP5KL1
OrganismBos taurus (Bovine) [Reference proteome]
Taxonomic identifier9913 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos

Protein attributes

Sequence length396 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May act as a scaffold to localize and regulate type I PI4P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3 By similarity.

Catalytic activity

ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

Subunit structure

Heterodimerizes with other type I phosphatidylinositol 4-phosphate 5-kinase By similarity.

Subcellular location

Cytoplasm. Membrane. Note: Localized to large cytoplasmic vesicular structures By similarity.

Sequence similarities

Contains 1 PIPK domain.

Caution

It is unsure if the enzyme has intrinsic kinase activity.

Ontologies

Keywords
   Cellular componentCytoplasm
Membrane
   Coding sequence diversityAlternative splicing
   LigandATP-binding
Nucleotide-binding
   Molecular functionKinase
Transferase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_function1-phosphatidylinositol-4-phosphate 5-kinase activity

Inferred from electronic annotation. Source: UniProtKB-EC

ATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q17QS4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q17QS4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-224: Missing.
     225-257: CEVSRWVEPAPEGSVLVLVLKDLNFQGKTINLG → MSPALPGQVRVEPAAPCPAPDEHSGWGTDAPAG
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 396396Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
PRO_0000285757

Regions

Domain38 – 395358PIPK

Natural variations

Alternative sequence1 – 224224Missing in isoform 2.
VSP_024902
Alternative sequence225 – 25733CEVSR…TINLG → MSPALPGQVRVEPAAPCPAP DEHSGWGTDAPAG in isoform 2.
VSP_024903

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 25, 2006. Version 1.
Checksum: 218E24E583B1EF78

FASTA39644,778
        10         20         30         40         50         60 
MAAPSPGPRE ILAPSPEAGR RAAASSSGHR GLLWRLRDKQ CRLGLFEIGP GHELHQVMCL 

        70         80         90        100        110        120 
MQAGLWAATQ VSMDHPPTGL PTEEDFSEVL TQVHEGFELG TLAGPVFARL RRSLGLAEED 

       130        140        150        160        170        180 
YQAALGPSRP YLQFLSTSKS KASFFLSHDQ RFFLKTLRSR EVQALLAHLP RYVHHLQRHP 

       190        200        210        220        230        240 
HSLLARVLGV HSLRVARGKK KYFIVMQSVF YPAGRISERY DIKGCEVSRW VEPAPEGSVL 

       250        260        270        280        290        300 
VLVLKDLNFQ GKTINLGPQR SWFLRQMELD TAFLRELNVL DYSLLMAFQR LHEDERGPGS 

       310        320        330        340        350        360 
SLIFRTARSI RGAQSAEESG AQNRRLLPDA PNALHIVDGP EHRYFLGLVD LTTVYGLRKR 

       370        380        390 
LEQLWKTLRY PGRTFSTVSP ACYARRLCQW VEAHTE 

« Hide

Isoform 2 [UniParc].

Checksum: 7CF20070FF2113DB
Show »

FASTA17219,385

References

[1]"Characterization of 954 bovine full-CDS cDNA sequences."
Harhay G.P., Sonstegard T.S., Keele J.W., Heaton M.P., Clawson M.L., Snelling W.M., Wiedmann R.T., Van Tassell C.P., Smith T.P.L.
BMC Genomics 6:166-166(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[2]NIH - Mammalian Gene Collection (MGC) project
Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: Hereford.
Tissue: Thalamus.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
BT021629 mRNA. Translation: AAX46476.1.
BC118210 mRNA. Translation: AAI18211.1.
RefSeqNP_001069315.2. NM_001075847.2. [Q17QS4-1]
UniGeneBt.37390.

3D structure databases

ProteinModelPortalQ17QS4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9913.ENSBTAP00000004392.

Proteomic databases

PRIDEQ17QS4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID523736.
KEGGbta:523736.

Organism-specific databases

CTD138429.

Phylogenomic databases

eggNOGCOG5253.
HOGENOMHOG000115541.
HOVERGENHBG097351.
KOK13712.

Family and domain databases

Gene3D3.30.800.10. 1 hit.
3.30.810.10. 1 hit.
InterProIPR023610. PInositol-4-P-5-kinase.
IPR027483. PInositol-4-P-5-kinase_C.
IPR002498. PInositol-4-P-5-kinase_core.
IPR027484. PInositol-4-P-5-kinase_N.
[Graphical view]
PANTHERPTHR23086. PTHR23086. 1 hit.
PfamPF01504. PIP5K. 1 hit.
[Graphical view]
PROSITEPS51455. PIPK. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20873812.

Entry information

Entry namePI5L1_BOVIN
AccessionPrimary (citable) accession number: Q17QS4
Secondary accession number(s): Q58DG8
Entry history
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: July 25, 2006
Last modified: May 14, 2014
This is version 53 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families