Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q17QS4

- PI5L1_BOVIN

UniProt

Q17QS4 - PI5L1_BOVIN

Protein

Phosphatidylinositol 4-phosphate 5-kinase-like protein 1

Gene

PIP5KL1

Organism
Bos taurus (Bovine)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 54 (01 Oct 2014)
      Sequence version 1 (25 Jul 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as a scaffold to localize and regulate type I PI4P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.By similarity

    Catalytic activityi

    ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.

    GO - Molecular functioni

    1. 1-phosphatidylinositol-4-phosphate 5-kinase activity Source: UniProtKB-EC
    2. ATP binding Source: UniProtKB-KW

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 (EC:2.7.1.68)
    Short name:
    PI(4)P 5-kinase-like protein 1
    Short name:
    PtdIns(4)P-5-kinase-like protein 1
    Gene namesi
    Name:PIP5KL1
    OrganismiBos taurus (Bovine)
    Taxonomic identifieri9913 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
    ProteomesiUP000009136: Unplaced

    Subcellular locationi

    Cytoplasm. Membrane
    Note: Localized to large cytoplasmic vesicular structures.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 396396Phosphatidylinositol 4-phosphate 5-kinase-like protein 1PRO_0000285757Add
    BLAST

    Proteomic databases

    PRIDEiQ17QS4.

    Interactioni

    Subunit structurei

    Heterodimerizes with other type I phosphatidylinositol 4-phosphate 5-kinase.By similarity

    Protein-protein interaction databases

    STRINGi9913.ENSBTAP00000004392.

    Structurei

    3D structure databases

    ProteinModelPortaliQ17QS4.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini38 – 395358PIPKPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 PIPK domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5253.
    HOGENOMiHOG000115541.
    HOVERGENiHBG097351.
    KOiK13712.

    Family and domain databases

    Gene3Di3.30.800.10. 1 hit.
    3.30.810.10. 1 hit.
    InterProiIPR023610. PInositol-4-P-5-kinase.
    IPR027483. PInositol-4-P-5-kinase_C.
    IPR002498. PInositol-4-P-5-kinase_core.
    IPR027484. PInositol-4-P-5-kinase_N.
    [Graphical view]
    PANTHERiPTHR23086. PTHR23086. 1 hit.
    PfamiPF01504. PIP5K. 1 hit.
    [Graphical view]
    PROSITEiPS51455. PIPK. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q17QS4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAPSPGPRE ILAPSPEAGR RAAASSSGHR GLLWRLRDKQ CRLGLFEIGP    50
    GHELHQVMCL MQAGLWAATQ VSMDHPPTGL PTEEDFSEVL TQVHEGFELG 100
    TLAGPVFARL RRSLGLAEED YQAALGPSRP YLQFLSTSKS KASFFLSHDQ 150
    RFFLKTLRSR EVQALLAHLP RYVHHLQRHP HSLLARVLGV HSLRVARGKK 200
    KYFIVMQSVF YPAGRISERY DIKGCEVSRW VEPAPEGSVL VLVLKDLNFQ 250
    GKTINLGPQR SWFLRQMELD TAFLRELNVL DYSLLMAFQR LHEDERGPGS 300
    SLIFRTARSI RGAQSAEESG AQNRRLLPDA PNALHIVDGP EHRYFLGLVD 350
    LTTVYGLRKR LEQLWKTLRY PGRTFSTVSP ACYARRLCQW VEAHTE 396
    Length:396
    Mass (Da):44,778
    Last modified:July 25, 2006 - v1
    Checksum:i218E24E583B1EF78
    GO
    Isoform 2 (identifier: Q17QS4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-224: Missing.
         225-257: CEVSRWVEPAPEGSVLVLVLKDLNFQGKTINLG → MSPALPGQVRVEPAAPCPAPDEHSGWGTDAPAG

    Note: No experimental confirmation available.

    Show »
    Length:172
    Mass (Da):19,385
    Checksum:i7CF20070FF2113DB
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 224224Missing in isoform 2. 1 PublicationVSP_024902Add
    BLAST
    Alternative sequencei225 – 25733CEVSR…TINLG → MSPALPGQVRVEPAAPCPAP DEHSGWGTDAPAG in isoform 2. 1 PublicationVSP_024903Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BT021629 mRNA. Translation: AAX46476.1.
    BC118210 mRNA. Translation: AAI18211.1.
    RefSeqiNP_001069315.2. NM_001075847.2. [Q17QS4-1]
    UniGeneiBt.37390.

    Genome annotation databases

    GeneIDi523736.
    KEGGibta:523736.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BT021629 mRNA. Translation: AAX46476.1 .
    BC118210 mRNA. Translation: AAI18211.1 .
    RefSeqi NP_001069315.2. NM_001075847.2. [Q17QS4-1 ]
    UniGenei Bt.37390.

    3D structure databases

    ProteinModelPortali Q17QS4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9913.ENSBTAP00000004392.

    Proteomic databases

    PRIDEi Q17QS4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 523736.
    KEGGi bta:523736.

    Organism-specific databases

    CTDi 138429.

    Phylogenomic databases

    eggNOGi COG5253.
    HOGENOMi HOG000115541.
    HOVERGENi HBG097351.
    KOi K13712.

    Miscellaneous databases

    NextBioi 20873812.

    Family and domain databases

    Gene3Di 3.30.800.10. 1 hit.
    3.30.810.10. 1 hit.
    InterProi IPR023610. PInositol-4-P-5-kinase.
    IPR027483. PInositol-4-P-5-kinase_C.
    IPR002498. PInositol-4-P-5-kinase_core.
    IPR027484. PInositol-4-P-5-kinase_N.
    [Graphical view ]
    PANTHERi PTHR23086. PTHR23086. 1 hit.
    Pfami PF01504. PIP5K. 1 hit.
    [Graphical view ]
    PROSITEi PS51455. PIPK. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    2. NIH - Mammalian Gene Collection (MGC) project
      Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: Hereford.
      Tissue: Thalamus.

    Entry informationi

    Entry nameiPI5L1_BOVIN
    AccessioniPrimary (citable) accession number: Q17QS4
    Secondary accession number(s): Q58DG8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 1, 2007
    Last sequence update: July 25, 2006
    Last modified: October 1, 2014
    This is version 54 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3