Q17QS4 (PI5L1_BOVIN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 49.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 Short name=PI(4)P 5-kinase-like protein 1 Short name=PtdIns(4)P-5-kinase-like protein 1 EC=2.7.1.68 | ||
| Gene names |
| ||
| Organism | Bos taurus (Bovine) [Reference proteome] | ||
| Taxonomic identifier | 9913 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos![]() |
Protein attributes
| Sequence length | 396 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May act as a scaffold to localize and regulate type I PI4P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3 By similarity. |
| Catalytic activity | ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate. |
| Subunit structure | Heterodimerizes with other type I phosphatidylinositol 4-phosphate 5-kinase By similarity. |
| Subcellular location | Cytoplasm. Membrane. Note: Localized to large cytoplasmic vesicular structures By similarity. |
| Sequence similarities | Contains 1 PIPK domain. |
| Caution | It is unsure if the enzyme has intrinsic kinase activity. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | phosphatidylinositol phosphorylation Inferred from electronic annotation. Source: GOC |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | 1-phosphatidylinositol-4-phosphate 5-kinase activity Inferred from electronic annotation. Source: EC ATP bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q17QS4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q17QS4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-224: Missing. 225-257: CEVSRWVEPAPEGSVLVLVLKDLNFQGKTINLG → MSPALPGQVRVEPAAPCPAPDEHSGWGTDAPAG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 396 | 396 | Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 | PRO_0000285757 | |||||
Regions | |||||||||
| Domain | 38 – 395 | 358 | PIPK | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 224 | 224 | Missing in isoform 2. | VSP_024902 | |||||
| Alternative sequence | 225 – 257 | 33 | CEVSR…TINLG → MSPALPGQVRVEPAAPCPAP DEHSGWGTDAPAG in isoform 2. | VSP_024903 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Characterization of 954 bovine full-CDS cDNA sequences." Harhay G.P., Sonstegard T.S., Keele J.W., Heaton M.P., Clawson M.L., Snelling W.M., Wiedmann R.T., Van Tassell C.P., Smith T.P.L. BMC Genomics 6:166-166(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [2] | NIH - Mammalian Gene Collection (MGC) project Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Hereford. Tissue: Thalamus. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BT021629 mRNA. Translation: AAX46476.1. BC118210 mRNA. Translation: AAI18211.1. |
| IPI | IPI00718004. IPI00782887. |
| RefSeq | NP_001069315.2. NM_001075847.2. |
| UniGene | Bt.37390. |
3D structure databases | |
| ProteinModelPortal | Q17QS4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9913.ENSBTAP00000004392. |
Proteomic databases | |
| PRIDE | Q17QS4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 523736. |
| KEGG | bta:523736. |
Organism-specific databases | |
| CTD | 138429. |
Phylogenomic databases | |
| eggNOG | COG5253. |
| HOGENOM | HOG000115541. |
| HOVERGEN | HBG097351. |
| KO | K13712. |
Family and domain databases | |
| Gene3D | 3.30.800.10. 1 hit. 3.30.810.10. 1 hit. |
| InterPro | IPR023610. PInositol-4-P-5-kinase. IPR027483. PInositol-4-P-5-kinase_C. IPR002498. PInositol-4-P-5-kinase_core. IPR027484. PInositol-4-P-5-kinase_N. [Graphical view] |
| PANTHER | PTHR23086. PTHR23086. 1 hit. |
| Pfam | PF01504. PIP5K. 1 hit. [Graphical view] |
| PROSITE | PS51455. PIPK. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20873812. |
Entry information
| Entry name | PI5L1_BOVIN | ||||||||
| Accession | Primary (citable) accession number: Q17QS4 Secondary accession number(s): Q58DG8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
