Reviewed,
UniProtKB/Swiss-Prot Q17941 (AKT1_CAEEL)
Last modified
June 16, 2009.
Version 77.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein kinase akt-1 EC=2.7.11.1 Alternative name(s): Protein kinase B akt-1 Short name=PKB akt-1 | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans [Complete proteome] | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 541 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Acts downstream age-1 and pdk-1 in the daf-2/insulin receptor-like transduction pathway, which controls longevity and prevents developmental arrest at the dauer stage. Phosphorylates Forkhead-related daf-16 transcription factor, which inhibits its entry into the nucleus and antagonizes its function. Ref.1 Ref.3 Ref.4 Ref.5 Ref.6 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Interacts with pdk-1, sgk-1, akt-2 and daf-16. Part of a complex containing sgk-1, akt-1 and akt-2. Ref.6 |
| Tissue specificity | Expressed in neurons, muscle cells of the pharynx, rectal gland cells, and spermatheca. Ref.1 |
| Developmental stage | Expressed in late stage embryos and throughout life. Ref.1 |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily. Contains 1 AGC-kinase C-terminal domain. Contains 1 PH domain. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Developmental protein Kinase Serine/threonine-protein kinase Transferase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | dauer entry Ref.6 Inferred from mutant phenotype. Source: WormBase determination of adult life span Ref.6Inferred from mutant phenotype. Source: WormBase positive regulation of growth rateInferred from mutant phenotype. Source: WormBase protein amino acid phosphorylationInferred from electronic annotation. Source: InterPro |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction. Source: IntAct protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| daf-16 | O18676 | 1 | EBI-1770718,EBI-1770827 | |
| pptr-1 | O18178 | 1 | EBI-1770718,EBI-2298122 | |
| skn-1 | P34707-1 | 1 | EBI-1770718,EBI-434984 | |
| skn-1 | P34707-3 | 1 | EBI-1770718,EBI-434993 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: Q17941-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform b (identifier: Q17941-2) The sequence of this isoform differs from the canonical sequence as follows: 262-287: EQHYLCFVMQFANGGELFTHVRKCGT → TNDRLCFVMEFAIGGDLYYHLNREVQMNKEG 298-298: A → S 309-317: RCDIVYRDM → ANSIVYRDL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 541 | 541 | Serine/threonine-protein kinase akt-1 | PRO_0000085615 | |||||
Regions | |||||||||
| Domain | 15 – 118 | 104 | PH | ||||||
| Domain | 193 – 450 | 258 | Protein kinase | ||||||
| Domain | 451 – 528 | 78 | AGC-kinase C-terminal | ||||||
| Nucleotide binding | 199 – 207 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 316 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 222 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 262 – 287 | 26 | EQHYL…RKCGT → TNDRLCFVMEFAIGGDLYYH LNREVQMNKEG in isoform b. | VSP_017044 | |||||
| Alternative sequence | 298 | 1 | A → S in isoform b. | VSP_017045 | |||||
| Alternative sequence | 309 – 317 | 9 | RCDIVYRDM → ANSIVYRDL in isoform b. | VSP_017046 | |||||
Experimental info | |||||||||
| Mutagenesis | 183 | 1 | A → T in mg144; suppresses the dauer arrest phenotype of the age-1(mg44) null mutant. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Caenorhabditis elegans Akt/PKB transduces insulin receptor-like signals from AGE-1 PI3 kinase to the DAF-16 transcription factor." Paradis S., Ruvkun G. Genes Dev. 12:2488-2498(1998) [PubMed: 9716402] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), FUNCTION, MUTAGENESIS OF ALA-183, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [2] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Bristol N2. |
| [3] | "A PDK1 homolog is necessary and sufficient to transduce AGE-1 PI3 kinase signals that regulate diapause in Caenorhabditis elegans." Paradis S., Ailion M., Toker A., Thomas J.H., Ruvkun G. Genes Dev. 13:1438-1452(1999) [PubMed: 10364160] [Abstract] Cited for: FUNCTION. |
| [4] | "daf-16 integrates developmental and environmental inputs to mediate aging in the nematode Caenorhabditis elegans." Henderson S.T., Johnson T.E. Curr. Biol. 11:1975-1980(2001) [PubMed: 11747825] [Abstract] Cited for: FUNCTION. |
| [5] | "Regulation of the Caenorhabditis elegans longevity protein DAF-16 by insulin/IGF-1 and germline signaling." Lin K., Hsin H., Libina N., Kenyon C. Nat. Genet. 28:139-145(2001) [PubMed: 11381260] [Abstract] Cited for: FUNCTION. |
| [6] | "C. elegans SGK-1 is the critical component in the Akt/PKB kinase complex to control stress response and life span." Hertweck M., Goebel C., Baumeister R. Dev. Cell 6:577-588(2004) [PubMed: 15068796] [Abstract] Cited for: INTERACTION WITH PDK-1; SGK-1; AKT-2 AND DAF-16, FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF072379 mRNA. Translation: AAC62466.1. AF072380 mRNA. Translation: AAC62467.1. Z73969 Genomic DNA. Translation: CAA98238.1. Z73969 Genomic DNA. Translation: CAA98240.1. | |
| PIR | T43232. T43233. |
| RefSeq | NP_001023645.1. |
| UniGene | Cel.36405 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1MRY based on UniProtKB P31751. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q17941. 4 interactions. |
Proteomic databases | |
| PRIDE | Q17941. |
Genome annotation databases | |
| Ensembl | C12D8.10. Caenorhabditis elegans. [Contig view] |
| GeneID | 179424. |
| KEGG | cel:C12D8.10. |
| NMPDR | fig|6239.3.peg.19363. |
Organism-specific databases | |
| WormBase | WBGene00000102. akt-1. |
| WormPep | C12D8.10a. CE15612. [WorfDB] C12D8.10b. CE05274. [WorfDB] |
Phylogenomic databases | |
| OMA | Q17941. THTLTEN. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 672. |
Gene expression databases | |
| ArrayExpress | Q17941. |
Family and domain databases | |
| InterPro | IPR000961. AGC-kinase_C. IPR011993. PH_type. IPR017892. Pkinase_C. IPR001849. Pleckstrin_homology. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. IPR015744. Serine/threonine_Kinase_Rac. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. |
| PANTHER | PTHR22985:SF69. Akt. 1 hit. |
| Pfam | PF00169. PH. 1 hit. PF00069. Pkinase. 1 hit. PF00433. Pkinase_C. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00233. PH. 1 hit. SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 905330. |
Entry information
| Entry name | AKT1_CAEEL | ||||||||
| Accession | Primary (citable) accession number: Q17941 Secondary accession number(s): Q17942 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| SIMILARITY comments Index of protein domains and families |

Clusters with


