Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase akt-1

Gene

akt-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts downstream of age-1 and pdk-1 in the daf-2/insulin receptor-like transduction pathway. Phosphorylates Forkhead-related daf-16 and the longevity-promoting skn-1 transcription factors, which inhibits their entry into the nucleus and antagonizes their functions (PubMed:9716402, PubMed:11747825, PubMed:11381260, PubMed:15068796, PubMed:18358814). Has an essential role in regulating developmental arrest at the dauer stage (PubMed:10364160). Plays a role in immune function and pathogen resistance (PubMed:18782349). Regulates salt chemotaxis learning (PubMed:16950159).8 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Enzyme regulationi

Phosphorylated and activated by pdk-1.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei222 – 2221ATPPROSITE-ProRule annotation
Active sitei316 – 3161Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi199 – 2079ATPPROSITE-ProRule annotation

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • calmodulin binding Source: WormBase
  • metal ion binding Source: UniProtKB-KW
  • phosphatidylinositol-3,4,5-trisphosphate binding Source: WormBase
  • protein kinase activity Source: WormBase
  • protein serine/threonine kinase activity Source: WormBase

GO - Biological processi

  • chemosensory behavior Source: UniProtKB
  • chemotaxis Source: UniProtKB
  • determination of adult lifespan Source: WormBase
  • innate immune response Source: UniProtKB-KW
  • insulin receptor signaling pathway Source: WormBase
  • intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator Source: CACAO
  • peptidyl-serine phosphorylation Source: WormBase
  • peptidyl-threonine phosphorylation Source: WormBase
  • protein phosphorylation Source: WormBase
  • response to salt Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Immunity, Innate immunity

Keywords - Ligandi

ATP-binding, Calmodulin-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-CEL-114604. GPVI-mediated activation cascade.
R-CEL-1257604. PIP3 activates AKT signaling.
R-CEL-1474151. Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation.
R-CEL-165158. Activation of AKT2.
R-CEL-198323. AKT phosphorylates targets in the cytosol.
R-CEL-198693. AKT phosphorylates targets in the nucleus.
R-CEL-199418. Negative regulation of the PI3K/AKT network.
R-CEL-203615. eNOS activation.
R-CEL-211163. AKT-mediated inactivation of FOXO1A.
R-CEL-354192. Integrin alphaIIb beta3 signaling.
R-CEL-389357. CD28 dependent PI3K/Akt signaling.
R-CEL-389513. CTLA4 inhibitory signaling.
R-CEL-392451. G beta:gamma signalling through PI3Kgamma.
R-CEL-450385. Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA.
R-CEL-450604. KSRP (KHSRP) binds and destabilizes mRNA.
R-CEL-5218920. VEGFR2 mediated vascular permeability.
R-CEL-6811558. PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
SignaLinkiQ17941.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase akt-1 (EC:2.7.11.1)
Alternative name(s):
Protein kinase B akt-1
Short name:
PKB akt-1
Gene namesi
Name:akt-1
ORF Names:C12D8.10
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome V

Organism-specific databases

WormBaseiC12D8.10a; CE15612; WBGene00000102; akt-1.
C12D8.10b; CE05274; WBGene00000102; akt-1.
C12D8.10c; CE31304; WBGene00000102; akt-1.

Subcellular locationi

GO - Cellular componenti

  • axon Source: WormBase
  • cytoplasmic side of plasma membrane Source: WormBase
  • dendrite Source: WormBase
  • intracellular Source: GO_Central
  • neuronal cell body Source: WormBase
Complete GO annotation...

Pathology & Biotechi

Disruption phenotypei

Increased resistance to pathogens. Simultaneous knockdown of akt-1 and akt-2 result in dauer formation and a weak extension to life span.2 Publications

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi183 – 1831A → T in mg144; suppresses the dauer arrest phenotype of the age-1(mg44) null mutant. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 541541Serine/threonine-protein kinase akt-1PRO_0000085615Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei350 – 3501Phosphothreonine1 Publication
Modified residuei517 – 5171Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ17941.
PRIDEiQ17941.

PTM databases

iPTMnetiQ17941.

Expressioni

Tissue specificityi

Expressed in neurons, muscle cells of the pharynx, rectal gland cells, vulva and spermatheca.2 Publications

Developmental stagei

Expressed in late stage embryos and throughout life.1 Publication

Gene expression databases

BgeeiWBGene00000102.

Interactioni

Subunit structurei

Interacts with pdk-1, sgk-1, akt-2 and daf-16 (PubMed:15068796). Part of a complex containing sgk-1, akt-1 and akt-2 (PubMed:15068796). Interacts with cmd-1 in the presence of Ca2+ (PubMed:17854888). Interacts with let-92 phosphatase regulatory subunit pptr-1 (PubMed:19249087).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
akt-2Q9XTG72EBI-1770718,EBI-320656
daf-16O168503EBI-1770718,EBI-324028
mdf-1G5EFM02EBI-1770718,EBI-316684
pptr-1O181783EBI-1770718,EBI-2298122
sgk-1Q2PJ683EBI-1770718,EBI-1770776

GO - Molecular functioni

  • calmodulin binding Source: WormBase

Protein-protein interaction databases

BioGridi44454. 1 interaction.
IntActiQ17941. 9 interactions.
STRINGi6239.C12D8.10b.1.

Structurei

3D structure databases

ProteinModelPortaliQ17941.
SMRiQ17941. Positions 16-117, 119-518.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 118104PHPROSITE-ProRule annotationAdd
BLAST
Domaini193 – 450258Protein kinasePROSITE-ProRule annotationAdd
BLAST
Domaini451 – 52878AGC-kinase C-terminalAdd
BLAST

Sequence similaritiesi

Contains 1 AGC-kinase C-terminal domain.Curated
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0598. Eukaryota.
ENOG410XNPH. LUCA.
GeneTreeiENSGT00820000126961.
HOGENOMiHOG000233033.
InParanoidiQ17941.
KOiK04456.
OMAiREYIKNW.
OrthoDBiEOG091G06FF.
PhylomeDBiQ17941.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR000961. AGC-kinase_C.
IPR011009. Kinase-like_dom.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR017892. Pkinase_C.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00069. Pkinase. 1 hit.
PF00433. Pkinase_C. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a (identifier: Q17941-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSMTSLSTKS RRQEDVVIEG WLHKKGEHIR NWRPRYFMIF NDGALLGFRA
60 70 80 90 100
KPKEGQPFPE PLNDFMIKDA ATMLFEKPRP NMFMVRCLQW TTVIERTFYA
110 120 130 140 150
ESAEVRQRWI HAIESISKKY KGTNANPQEE LMETNQQPKI DEDSEFAGAA
160 170 180 190 200
HAIMGQPSSG HGDNCSIDFR ASMISIADTS EAAKRDKITM EDFDFLKVLG
210 220 230 240 250
KGTFGKVILC KEKRTQKLYA IKILKKDVII AREEVAHTLT ENRVLQRCKH
260 270 280 290 300
PFLTELKYSF QEQHYLCFVM QFANGGELFT HVRKCGTFSE PRARFYGAEI
310 320 330 340 350
VLALGYLHRC DIVYRDMKLE NLLLDKDGHI KIADFGLCKE EISFGDKTST
360 370 380 390 400
FCGTPEYLAP EVLDDHDYGR CVDWWGVGVV MYEMMCGRLP FYSKDHNKLF
410 420 430 440 450
ELIMAGDLRF PSKLSQEART LLTGLLVKDP TQRLGGGPED ALEICRADFF
460 470 480 490 500
RTVDWEATYR KEIEPPYKPN VQSETDTSYF DNEFTSQPVQ LTPPSRSGAL
510 520 530 540
ATVDEQEEMQ SNFTQFSFHN VMGSINRIHE ASEDNEDYDM G
Length:541
Mass (Da):62,200
Last modified:August 1, 1998 - v2
Checksum:i17FEDD1109926950
GO
Isoform b (identifier: Q17941-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-287: EQHYLCFVMQFANGGELFTHVRKCGT → TNDRLCFVMEFAIGGDLYYHLNREVQMNKEG
     298-298: A → S
     309-317: RCDIVYRDM → ANSIVYRDL

Show »
Length:546
Mass (Da):62,743
Checksum:i9719098DBED87AFB
GO
Isoform c (identifier: Q17941-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-541: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):29,259
Checksum:iBC1E384AB75A7C77
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei255 – 541287Missing in isoform c. CuratedVSP_038163Add
BLAST
Alternative sequencei262 – 28726EQHYL…RKCGT → TNDRLCFVMEFAIGGDLYYH LNREVQMNKEG in isoform b. 1 PublicationVSP_017044Add
BLAST
Alternative sequencei298 – 2981A → S in isoform b. 1 PublicationVSP_017045
Alternative sequencei309 – 3179RCDIVYRDM → ANSIVYRDL in isoform b. 1 PublicationVSP_017046

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072379 mRNA. Translation: AAC62466.1.
AF072380 mRNA. Translation: AAC62467.1.
Z73969 Genomic DNA. Translation: CAA98238.1.
Z73969 Genomic DNA. Translation: CAA98240.1.
Z73969 Genomic DNA. Translation: CAD44085.1.
PIRiT43232.
T43233.
RefSeqiNP_001023645.1. NM_001028474.4. [Q17941-1]
NP_001023646.1. NM_001028475.2. [Q17941-2]
NP_001023647.1. NM_001028476.3. [Q17941-3]
UniGeneiCel.5036.

Genome annotation databases

EnsemblMetazoaiC12D8.10a; C12D8.10a; WBGene00000102. [Q17941-1]
GeneIDi179424.
KEGGicel:CELE_C12D8.10.
UCSCiC12D8.10b.1. c. elegans. [Q17941-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072379 mRNA. Translation: AAC62466.1.
AF072380 mRNA. Translation: AAC62467.1.
Z73969 Genomic DNA. Translation: CAA98238.1.
Z73969 Genomic DNA. Translation: CAA98240.1.
Z73969 Genomic DNA. Translation: CAD44085.1.
PIRiT43232.
T43233.
RefSeqiNP_001023645.1. NM_001028474.4. [Q17941-1]
NP_001023646.1. NM_001028475.2. [Q17941-2]
NP_001023647.1. NM_001028476.3. [Q17941-3]
UniGeneiCel.5036.

3D structure databases

ProteinModelPortaliQ17941.
SMRiQ17941. Positions 16-117, 119-518.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi44454. 1 interaction.
IntActiQ17941. 9 interactions.
STRINGi6239.C12D8.10b.1.

PTM databases

iPTMnetiQ17941.

Proteomic databases

PaxDbiQ17941.
PRIDEiQ17941.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC12D8.10a; C12D8.10a; WBGene00000102. [Q17941-1]
GeneIDi179424.
KEGGicel:CELE_C12D8.10.
UCSCiC12D8.10b.1. c. elegans. [Q17941-1]

Organism-specific databases

CTDi179424.
WormBaseiC12D8.10a; CE15612; WBGene00000102; akt-1.
C12D8.10b; CE05274; WBGene00000102; akt-1.
C12D8.10c; CE31304; WBGene00000102; akt-1.

Phylogenomic databases

eggNOGiKOG0598. Eukaryota.
ENOG410XNPH. LUCA.
GeneTreeiENSGT00820000126961.
HOGENOMiHOG000233033.
InParanoidiQ17941.
KOiK04456.
OMAiREYIKNW.
OrthoDBiEOG091G06FF.
PhylomeDBiQ17941.

Enzyme and pathway databases

ReactomeiR-CEL-114604. GPVI-mediated activation cascade.
R-CEL-1257604. PIP3 activates AKT signaling.
R-CEL-1474151. Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation.
R-CEL-165158. Activation of AKT2.
R-CEL-198323. AKT phosphorylates targets in the cytosol.
R-CEL-198693. AKT phosphorylates targets in the nucleus.
R-CEL-199418. Negative regulation of the PI3K/AKT network.
R-CEL-203615. eNOS activation.
R-CEL-211163. AKT-mediated inactivation of FOXO1A.
R-CEL-354192. Integrin alphaIIb beta3 signaling.
R-CEL-389357. CD28 dependent PI3K/Akt signaling.
R-CEL-389513. CTLA4 inhibitory signaling.
R-CEL-392451. G beta:gamma signalling through PI3Kgamma.
R-CEL-450385. Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA.
R-CEL-450604. KSRP (KHSRP) binds and destabilizes mRNA.
R-CEL-5218920. VEGFR2 mediated vascular permeability.
R-CEL-6811558. PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
SignaLinkiQ17941.

Miscellaneous databases

PROiQ17941.

Gene expression databases

BgeeiWBGene00000102.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR000961. AGC-kinase_C.
IPR011009. Kinase-like_dom.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR017892. Pkinase_C.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00069. Pkinase. 1 hit.
PF00433. Pkinase_C. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAKT1_CAEEL
AccessioniPrimary (citable) accession number: Q17941
Secondary accession number(s): Q17942, Q8MQE0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: August 1, 1998
Last modified: September 7, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.