Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Suppressor of presenilin protein 3

Gene

spr-3

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable transcriptional regulator, which participates in the transcriptional repression of the presenilin protein hop-1.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri21 – 4323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri48 – 7124C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri123 – 14523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri261 – 28323C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri291 – 31323C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri590 – 61223C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri618 – 64124C2H2-type 7PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Suppressor of presenilin protein 3
Gene namesi
Name:spr-3
ORF Names:C07A12.5
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome X

Organism-specific databases

WormBaseiC07A12.5a; CE36266; WBGene00005008; spr-3.
C07A12.5b; CE36267; WBGene00005008; spr-3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Loss of function results in a suppression of sel-12 mutant phenotypes, possibly by up-regulating hop-1 expression.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 684684Suppressor of presenilin protein 3PRO_0000046892Add
BLAST

Proteomic databases

PaxDbiQ17768.
PRIDEiQ17768.

PTM databases

iPTMnetiQ17768.

Expressioni

Developmental stagei

Expressed in eggs, L2 stage and in adult. Expressed at lower level in L1, L3 and L4 stages.1 Publication

Interactioni

Protein-protein interaction databases

BioGridi45657. 1 interaction.
STRINGi6239.C07A12.5a.

Structurei

3D structure databases

ProteinModelPortaliQ17768.
SMRiQ17768. Positions 14-43, 121-151, 250-320, 585-647.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 7 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri21 – 4323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri48 – 7124C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri123 – 14523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri261 – 28323C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri291 – 31323C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri590 – 61223C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri618 – 64124C2H2-type 7PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
InParanoidiQ17768.
OMAiLHRDRHY.
OrthoDBiEOG78WKXZ.
PhylomeDBiQ17768.

Family and domain databases

InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 7 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a (identifier: Q17768-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPPRKRKLEE LKNEQGEQGS YKCHLCGQCF YRGCGLASHL RRHAPVTFDC
60 70 80 90 100
EHCAYTCKHK YAYDRHLLQS HPELVESGPL VRMFKNEDED APMPILEREA
110 120 130 140 150
DVSDDAVKYE ALSSFSEPEP ISYKCPLCIS TFGSHARAVY HILSHRVKLY
160 170 180 190 200
QAPKSLKFFS RKTMQALGGF RLESQLMIKW RLQYDNRSVD EKRTRLWRYM
210 220 230 240 250
EENFGHEHLK QPKLESDNPS TSSSFESQTN LNDSSIIKKK LVMKCGTVFG
260 270 280 290 300
QRLIHDNTQY YLCRNCPYVS WNVSSLWRHF RHHIQKSKQS WTCIACSYSS
310 320 330 340 350
SSRVKIDLHV KMHKEMPEID LEFATWLRYE RRINKNDLNK PTNKKKKPDG
360 370 380 390 400
GNGSNHSDMR SLHAFLSLKN SKNNVVKHDI DAPTLHPLSP APKLVAMTQF
410 420 430 440 450
DFGEIVTYKS VNPLHQINKN NSNPTVLPNK RNSIKTSKSD TQIALSVKQS
460 470 480 490 500
SSMKMVKVSP GKVYQLPKTS KFYRPESPDS LASNNSAHGD EIESTSSDQF
510 520 530 540 550
QQSVKVPKYE DFLNMKPVMP YFQKQRHPLE AIAMYEKAKR EYEKNHCFPN
560 570 580 590 600
LPIFEFNIEY KNLHPLAKAQ YGKNNMKEYF LNEMEVEKSR ECTDCPFKHN
610 620 630 640 650
DLQQFRLHRD KHFYGGSHTC PECNYSSNNH NQVVEHTFVD HYLSDVRLVE
660 670 680
GLPSSDSEDD NIPVPPDTPQ RKKKAPKRGK RRGW
Length:684
Mass (Da):79,480
Last modified:August 22, 2003 - v3
Checksum:iB67B377852B88110
GO
Isoform b (identifier: Q17768-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-498: SKSDTQIALSVKQSSSMKMVKVSPGKVYQLPKTSKFYRPESPDSLASNNSAHGDEIESTSSD → N

Note: No experimental confirmation available.
Show »
Length:623
Mass (Da):72,920
Checksum:iA32E542149D28432
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei437 – 49862SKSDT…STSSD → N in isoform b. CuratedVSP_012009Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO080373 Genomic DNA. Translation: CCD63278.1.
FO080373 Genomic DNA. Translation: CCD63279.1.
RefSeqiNP_001024367.1. NM_001029196.3. [Q17768-1]
NP_001024368.1. NM_001029197.3. [Q17768-2]
UniGeneiCel.24627.

Genome annotation databases

EnsemblMetazoaiC07A12.5a; C07A12.5a; WBGene00005008. [Q17768-1]
GeneIDi180722.
KEGGicel:CELE_C07A12.5.
UCSCiC07A12.5b. c. elegans. [Q17768-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO080373 Genomic DNA. Translation: CCD63278.1.
FO080373 Genomic DNA. Translation: CCD63279.1.
RefSeqiNP_001024367.1. NM_001029196.3. [Q17768-1]
NP_001024368.1. NM_001029197.3. [Q17768-2]
UniGeneiCel.24627.

3D structure databases

ProteinModelPortaliQ17768.
SMRiQ17768. Positions 14-43, 121-151, 250-320, 585-647.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi45657. 1 interaction.
STRINGi6239.C07A12.5a.

PTM databases

iPTMnetiQ17768.

Proteomic databases

PaxDbiQ17768.
PRIDEiQ17768.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC07A12.5a; C07A12.5a; WBGene00005008. [Q17768-1]
GeneIDi180722.
KEGGicel:CELE_C07A12.5.
UCSCiC07A12.5b. c. elegans. [Q17768-1]

Organism-specific databases

CTDi180722.
WormBaseiC07A12.5a; CE36266; WBGene00005008; spr-3.
C07A12.5b; CE36267; WBGene00005008; spr-3.

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
InParanoidiQ17768.
OMAiLHRDRHY.
OrthoDBiEOG78WKXZ.
PhylomeDBiQ17768.

Miscellaneous databases

PROiQ17768.

Family and domain databases

InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 7 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Two suppressors of sel-12 encode C2H2 zinc-finger proteins that regulate presenilin transcription in Caenorhabditis elegans."
    Lakowski B., Eimer S., Goebel C., Boettcher A., Wagler B., Baumeister R.
    Development 130:2117-2128(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM A), FUNCTION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, DISRUPTION PHENOTYPE.
  2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.

Entry informationi

Entry nameiSPR3_CAEEL
AccessioniPrimary (citable) accession number: Q17768
Secondary accession number(s): Q7JP33
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 22, 2003
Last sequence update: August 22, 2003
Last modified: June 8, 2016
This is version 108 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.