Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein lingerer

Gene

lig

Organism
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Protein inferred from homologyi

Functioni

Acts in the nervous system to mediate the control of copulatory organs during courtship.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Behavior

Names & Taxonomyi

Protein namesi
Recommended name:
Protein lingerer
Gene namesi
Name:ligBy similarity
ORF Names:AAEL009607
OrganismiAedes aegypti (Yellowfever mosquito) (Culex aegypti)
Taxonomic identifieri7159 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraNematoceraCulicoideaCulicidaeCulicinaeAediniAedesStegomyia
Proteomesi
  • UP000008820 Componenti: Unassembled WGS sequence

Subcellular locationi

  • Cytoplasm By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12501250Protein lingererPRO_0000314619Add
BLAST

Keywords - PTMi

Phosphoprotein

Interactioni

Protein-protein interaction databases

STRINGi7159.AAEL009607-PA.

Structurei

3D structure databases

ProteinModelPortaliQ16VD3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini107 – 14741UBASequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi175 – 284110Gly-richSequence analysisAdd
BLAST
Compositional biasi359 – 42466Gln-richSequence analysisAdd
BLAST
Compositional biasi469 – 945477Ser-richSequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 UBA domain.Sequence analysis

Phylogenomic databases

eggNOGiENOG410IGWX. Eukaryota.
ENOG4110RI8. LUCA.
HOGENOMiHOG000046379.
InParanoidiQ16VD3.
OMAiPTHHNIN.
OrthoDBiEOG761BTB.
PhylomeDBiQ16VD3.

Family and domain databases

InterProiIPR022166. DUF3697_Uba2.
IPR009060. UBA-like.
[Graphical view]
PfamiPF12478. DUF3697. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A1 Publication (identifier: Q16VD3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTQTRSGGG GGGRNKSKAS KENKENAGMD EQPQPQLQQQ KGNATVNSGG
60 70 80 90 100
GEKQKKGIDN SGSKGGDSKD KQHQQTTTHT IKTKQPTAEQ IRIAQITDIK
110 120 130 140 150
SGMDDPKIQE KIQKLMETTQ RSEEEVCCAL QECDNDLDRA VIFLLETLPV
160 170 180 190 200
GAFATTSKKK KNKSQNKEQN DSATGDGDWD NGGNVGSGSG GGGGLSADSK
210 220 230 240 250
DRRGNRPGNQ RSGGGPGGPG SRGGRGGFRD GERGGDRDRN GFDRGGRGPR
260 270 280 290 300
GRDGRDGGPG RGSYGGGSRG GRGGGPRVGT RGPGMRESNR APRITDHQEI
310 320 330 340 350
DVWDSVATPS ANDLNKPEES SAFADTWGDW DNEEYTGSLS DTKVFTPSTQ
360 370 380 390 400
VAATTPPAQQ QQQQPTSSST QSQPTSQPQQ PTTPQPVQSQ IAPVQPATVS
410 420 430 440 450
SSVTSLEQQI LNPLQPKETD LVQQYSTTVV SSTATAAAAA TVQYPDLHSA
460 470 480 490 500
PSAAQHLRQA LEMPQINNSS SSLSAEQSQY FNTLSSQNSN LQSSVVNSYQ
510 520 530 540 550
QSSVQYPTSY GSSSTYSDQV TSSQQAPTAR RQRARVPPPS KIPSSAVEMP
560 570 580 590 600
GDSLNNIGYL DVQFGGLDFG TDDTFDSVPV TDKFNTNSLE QSTPSSVQLP
610 620 630 640 650
SAVQPTQSEV NDYQSKPSVV NNLQQKSSLT SSLQSTQILP GQSDALTATQ
660 670 680 690 700
SDSLSNSYSQ RNTSTVVPSS VSSGVNVNSI NSTTSTLEQL TKTDPYSQST
710 720 730 740 750
GTNAGSGGYQ NVSYSTSQAN KTSSYPSSAA PQGYNNSSYS STQVSTNTYP
760 770 780 790 800
ASSNNYSSYN QSGVNSYQQP SSNVSSSVVP NNNSTSSVGV STVNQSNPNL
810 820 830 840 850
PVNNNVSNNS SSNTNTGYLS SQYPVSQTSS AFPSQQSYQN SSQNVYGNTG
860 870 880 890 900
LNSNTGYSGS TSTSSGQYSN FSSSKLKDTP VSTQFDSVSS STVSNNNSAN
910 920 930 940 950
NNSVSSSSSS LPNSSVVSTT SMSSPSLGLT NTKVTNSTAK SSSSSGTGVV
960 970 980 990 1000
PNIPMVSPYI QPGVPFYQQP LYSYEDLQML QQRMSHVPGY YDMNYQTPTS
1010 1020 1030 1040 1050
LGAAGVRDAN LGSVAYSTMS DGRFTRTDNN SSPVSNVPST MSQQTGSGGP
1060 1070 1080 1090 1100
MLNLPYAYFY GGNVMPGGFQ YGTPAVYPPQ PMATNATSGG QFQKPAYNSG
1110 1120 1130 1140 1150
YGTSGYDTLS QSGQDYNKNP YPSSGVGQQS KGQTVSNQQS AGGSGSDIAP
1160 1170 1180 1190 1200
SMYGKSHVAL NKVNSYEKQS FHSGTPPPYN IAGTQTAGAT SGQPYGQHLY
1210 1220 1230 1240 1250
IPQIPTHHNI NMHQAMHQDS NSSGQRPQSN SQGKTATKQG YSPSYWTGQN
Note: No experimental confirmation available.Curated
Length:1,250
Mass (Da):131,545
Last modified:July 25, 2006 - v1
Checksum:i1AD19FE9F376E209
GO
Isoform B1 Publication (identifier: Q16VD3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-939: SMSSPSLGLTNTKVTNSTA → T
     1219-1250: DSNSSGQRPQSNSQGKTATKQGYSPSYWTGQN → V

Note: No experimental confirmation available.Curated
Show »
Length:1,201
Mass (Da):126,438
Checksum:iF08288F8624C12DE
GO
Isoform C1 Publication (identifier: Q16VD3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-939: SMSSPSLGLTNTKVTNSTA → T

Note: No experimental confirmation available.Curated
Show »
Length:1,232
Mass (Da):129,768
Checksum:i2209CDB7F6207243
GO
Isoform D1 Publication (identifier: Q16VD3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     812-812: Missing.
     921-939: SMSSPSLGLTNTKVTNSTA → T

Note: No experimental confirmation available.Curated
Show »
Length:1,231
Mass (Da):129,681
Checksum:i14A0037957D0F3D3
GO
Isoform E1 Publication (identifier: Q16VD3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-939: SMSSPSLGLTNTKVTNSTA → T
     1218-1218: Q → QMDNRTYNSGSGVMR

Note: No experimental confirmation available.Curated
Show »
Length:1,246
Mass (Da):131,338
Checksum:iEB4F7EB1FBA4664D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei812 – 8121Missing in isoform D. 1 PublicationVSP_052635
Alternative sequencei921 – 93919SMSSP…TNSTA → T in isoform B, isoform C, isoform D and isoform E. 1 PublicationVSP_052636Add
BLAST
Alternative sequencei1218 – 12181Q → QMDNRTYNSGSGVMR in isoform E. 1 PublicationVSP_052637
Alternative sequencei1219 – 125032DSNSS…WTGQN → V in isoform B. 1 PublicationVSP_052638Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH477597 Genomic DNA. Translation: EAT38499.1.
CH477597 Genomic DNA. Translation: EAT38500.1.
CH477597 Genomic DNA. Translation: EAT38501.1.
CH477597 Genomic DNA. Translation: EAT38502.1.
CH477597 Genomic DNA. Translation: EAT38503.1.
RefSeqiXP_001653854.1. XM_001653804.1. [Q16VD3-5]
XP_001653855.1. XM_001653805.1. [Q16VD3-3]
XP_001653856.1. XM_001653806.1. [Q16VD3-2]
XP_001653857.1. XM_001653807.1. [Q16VD3-1]
XP_001653858.1. XM_001653808.1. [Q16VD3-4]
UniGeneiAae.18497.

Genome annotation databases

GeneIDi5572191.
KEGGiaag:AaeL_AAEL009607.
VectorBaseiAAEL009607. Aedes aegypti.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH477597 Genomic DNA. Translation: EAT38499.1.
CH477597 Genomic DNA. Translation: EAT38500.1.
CH477597 Genomic DNA. Translation: EAT38501.1.
CH477597 Genomic DNA. Translation: EAT38502.1.
CH477597 Genomic DNA. Translation: EAT38503.1.
RefSeqiXP_001653854.1. XM_001653804.1. [Q16VD3-5]
XP_001653855.1. XM_001653805.1. [Q16VD3-3]
XP_001653856.1. XM_001653806.1. [Q16VD3-2]
XP_001653857.1. XM_001653807.1. [Q16VD3-1]
XP_001653858.1. XM_001653808.1. [Q16VD3-4]
UniGeneiAae.18497.

3D structure databases

ProteinModelPortaliQ16VD3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi7159.AAEL009607-PA.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi5572191.
KEGGiaag:AaeL_AAEL009607.
VectorBaseiAAEL009607. Aedes aegypti.

Organism-specific databases

CTDi5572191.

Phylogenomic databases

eggNOGiENOG410IGWX. Eukaryota.
ENOG4110RI8. LUCA.
HOGENOMiHOG000046379.
InParanoidiQ16VD3.
OMAiPTHHNIN.
OrthoDBiEOG761BTB.
PhylomeDBiQ16VD3.

Family and domain databases

InterProiIPR022166. DUF3697_Uba2.
IPR009060. UBA-like.
[Graphical view]
PfamiPF12478. DUF3697. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "Genome sequence of Aedes aegypti, a major arbovirus vector."
    Nene V., Wortman J.R., Lawson D., Haas B.J., Kodira C.D., Tu Z.J., Loftus B.J., Xi Z., Megy K., Grabherr M., Ren Q., Zdobnov E.M., Lobo N.F., Campbell K.S., Brown S.E., Bonaldo M.F., Zhu J., Sinkins S.P.
    , Hogenkamp D.G., Amedeo P., Arensburger P., Atkinson P.W., Bidwell S.L., Biedler J., Birney E., Bruggner R.V., Costas J., Coy M.R., Crabtree J., Crawford M., DeBruyn B., DeCaprio D., Eiglmeier K., Eisenstadt E., El-Dorry H., Gelbart W.M., Gomes S.L., Hammond M., Hannick L.I., Hogan J.R., Holmes M.H., Jaffe D., Johnston S.J., Kennedy R.C., Koo H., Kravitz S., Kriventseva E.V., Kulp D., Labutti K., Lee E., Li S., Lovin D.D., Mao C., Mauceli E., Menck C.F., Miller J.R., Montgomery P., Mori A., Nascimento A.L., Naveira H.F., Nusbaum C., O'Leary S.B., Orvis J., Pertea M., Quesneville H., Reidenbach K.R., Rogers Y.-H.C., Roth C.W., Schneider J.R., Schatz M., Shumway M., Stanke M., Stinson E.O., Tubio J.M.C., Vanzee J.P., Verjovski-Almeida S., Werner D., White O.R., Wyder S., Zeng Q., Zhao Q., Zhao Y., Hill C.A., Raikhel A.S., Soares M.B., Knudson D.L., Lee N.H., Galagan J., Salzberg S.L., Paulsen I.T., Dimopoulos G., Collins F.H., Bruce B., Fraser-Liggett C.M., Severson D.W.
    Science 316:1718-1723(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: LVPib12.

Entry informationi

Entry nameiLIG_AEDAE
AccessioniPrimary (citable) accession number: Q16VD3
Secondary accession number(s): Q16VC9
, Q16VD0, Q16VD1, Q16VD2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 25, 2006
Last modified: December 9, 2015
This is version 55 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.