Reviewed,
UniProtKB/Swiss-Prot Q16881 (TRXR1_HUMAN)
Last modified
February 9, 2010.
Version 123.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Thioredoxin reductase 1, cytoplasmic Short name=TR EC=1.8.1.9 Alternative name(s): Thioredoxin reductase TR1 KM-102-derived reductase-like factor Gene associated with retinoid-IFN-induced mortality 12 protein Short name=GRIM-12 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 649 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Isoform 1 may possess glutaredoxin activity as well as thioredoxin reductase activity and induces actin and tubulin polymerization, leading to formation of cell membrane protrusions. Isoform 4 enhances the transcriptional activity of estrogen receptors alpha and beta while isoform 5 enhances the transcriptional activity of the beta receptor only. Isoform 5 also mediates cell death induced by a combination of interferon-beta and retinoic acid. Ref.3 Ref.12 Ref.14 Ref.17 |
| Catalytic activity | Thioredoxin + NADP+ = thioredoxin disulfide + NADPH. |
| Cofactor | Binds 1 FAD per subunit. |
| Subunit structure | Homodimer. Isoform 4 interacts with ESR1 and ESR2. Ref.12 Ref.14 |
| Subcellular location | Cytoplasm By similarity Ref.14. |
| Tissue specificity | Isoform 1 is expressed predominantly in Leydig cells (at protein level). Also expressed in ovary, spleen, heart, liver, kidney and pancreas and in a number of cancer cell lines. Isoform 4 is widely expressed with highest levels in kidney, testis, uterus, ovary, prostate, placenta and fetal liver. Ref.14 Ref.17 Ref.2 |
| Induction | Isoform 5 is induced by a combination of interferon-beta and retinoic acid (at protein level). Isoform 1 is induced by estradiol or testosterone in HeLa cells. Ref.3 Ref.17 |
| Domain | The N-terminal glutaredoxin domain found in isoform 1 does not contain the C-P-Y-C redox-active motif normally found in glutaredoxins and has been found to be inactive in classical glutaredoxin assays. Ref.13 |
| Post-translational modification | The N-terminus of isoform 5 is blocked. |
| Miscellaneous | The thioredoxin reductase active site is a redox-active disulfide bond. The selenocysteine residue is also essential for catalytic activity. |
| Sequence similarities | Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. Contains 1 glutaredoxin domain. |
| Sequence caution | The sequence AAB35418.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence AAC69621.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence AAF15900.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence AAV38446.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence AAZ67916.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence BAA13674.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence CAA04503.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence CAA62629.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. The sequence CAG38744.1 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16881-1) Also known as: V; TXNRD1_v3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Minor isoform. | ||||||
| Isoform 2 (identifier: Q16881-2) Also known as: II; TXNRD1_v4; The sequence of this isoform differs from the canonical sequence as follows: 1-106: Missing. 107-138: LEGTLSELAAETDLPVVFVKQRKIGGHGPTLK → MLSRLVLNSWAQAIIRPRPPKVLGLQVTTFSE | ||||||
| Isoform 3 (identifier: Q16881-3) Also known as: III; TXNRD1_v5; The sequence of this isoform differs from the canonical sequence as follows: 1-51: Missing. 52-100: TADSRALLQA...VPYFVLELDQ → MQQVMLTCKG...LTRSALLLCH | ||||||
| Isoform 4 (identifier: Q16881-4) Also known as: IV; TXNRD1_v2; TrxR1b; The sequence of this isoform differs from the canonical sequence as follows: 1-98: Missing. 99-101: DQT → MSC | ||||||
| Isoform 5 (identifier: Q16881-5) Also known as: I; TXNRD1_v1; TrxR1a; The sequence of this isoform differs from the canonical sequence as follows: 1-150: Missing. | ||||||
| Note: Major isoform. | ||||||
| Isoform 6 (identifier: Q16881-6) Also known as: VI; The sequence of this isoform differs from the canonical sequence as follows: 1-139: MGCAEGKAVA...IGGHGPTLKA → MPVDDYWLCL...QERNVQFGLA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 649 | 649 | Thioredoxin reductase 1, cytoplasmic | PRO_0000030286 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 151 – 152 | 2 | Removed in mature form (in isoform 5) | PRO_0000030285 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 56 – 156 | 101 | Glutaredoxin | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 192 – 209 | 18 | FAD By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 622 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Non-standard residue | 648 | 1 | Selenocysteine Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 161 | 1 | Phosphotyrosine Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 163 | 1 | Phosphotyrosine Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 239 | 1 | N6-acetyllysine Ref.19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 281 | 1 | Phosphotyrosine Ref.15 Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 405 | 1 | N6-acetyllysine Ref.19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 572 | 1 | Phosphotyrosine Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 209 ↔ 214 | Redox-active By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 647 ↔ 648 | Cysteinyl-selenocysteine (Cys-Sec) By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 150 | 150 | Missing in isoform 5. | VSP_031558 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 139 | 139 | MGCAE…PTLKA → MPVDDYWLCLPASCARPFVQ TVRVVQSCPHCCWFPGVLPS VPEPLRMPAMLPTGSHSAVL PPSHCSTAPPSTSQEPSSSA DPKLCLSPPTSDSRQERNVQ FGLA in isoform 6. | VSP_031559 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 106 | 106 | Missing in isoform 2. | VSP_031560 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 98 | 98 | Missing in isoform 4. | VSP_031561 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 51 | 51 | Missing in isoform 3. | VSP_031562 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 52 – 100 | 49 | TADSR…LELDQ → MQQVMLTCKGVNRGHAVPAG PGRKPRPRRSSRLLAGEKHL TRSALLLCH in isoform 3. | VSP_031563 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 99 – 101 | 3 | DQT → MSC in isoform 4. | VSP_031564 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 107 – 138 | 32 | LEGTL…GPTLK → MLSRLVLNSWAQAIIRPRPP KVLGLQVTTFSE in isoform 2. | VSP_031565 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 365 | 1 | D → G: dbSNP rs1127954. Ref.1 Ref.4 | VAR_051776 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 153 | 1 | G → S in AAQ62473. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 181 | 1 | A → P in AAF15900. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 194 | 1 | V → G in AAF15900. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 200 | 1 | G → E in AAQ62469. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 202 | 1 | R → K in AAQ62463. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 215 | 1 | I → N in AAQ62463. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 306 | 1 | R → S in AAB35418. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 306 | 1 | R → S in CAA62629. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 306 | 1 | R → S in AAL15432. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 365 | 1 | D → N in AAC69621. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 449 | 1 | K → R in CAG38744. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 641 | 1 | S → R in AAC69621. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 12 – 18 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 22 – 32 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 33 – 35 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 38 – 41 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 57 – 62 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 64 – 83 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 84 – 87 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 98 – 122 | 25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 128 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 130 – 136 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 139 – 144 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 149 – 159 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 163 – 165 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 176 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 183 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 192 – 196 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 211 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 222 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 230 – 242 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 246 – 260 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 266 – 277 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 279 – 289 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 293 – 296 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 298 – 300 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 302 – 306 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 311 – 313 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 329 – 331 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 343 – 358 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 372 – 374 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 376 – 378 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 380 – 384 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 387 – 394 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 398 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 399 – 406 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 409 – 411 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 412 – 415 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 421 – 428 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 429 – 431 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 434 – 442 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 445 – 457 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 462 – 467 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 475 – 480 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 486 – 488 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and sequencing of a human thioredoxin reductase." Gasdaska P.Y., Gasdaska J.R., Cochran S., Powis G. FEBS Lett. 373:5-9(1995) [PubMed: 7589432] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), PROTEIN SEQUENCE OF 153-161; 307-315 AND 585-607, VARIANT GLY-365. Tissue: Placenta. |
| [2] | "Cloning and characterization of a novel oxidoreductase KDRF from a human bone marrow-derived stromal cell line KM-102." Koishi R., Kawashima I., Yoshimura C., Sugawara M., Serizawa N. J. Biol. Chem. 272:2570-2577(1997) [PubMed: 8999974] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), PROTEIN SEQUENCE OF 122-127 AND 147-151, TISSUE SPECIFICITY. Tissue: Bone marrow stroma. |
| [3] | "Thioredoxin reductase mediates cell death effects of the combination of beta interferon and retinoic acid." Hofman E.R., Boyanapalli M., Lindner D.J., Weihua X., Hassel B.A., Jagus R., Gutierrez P.L., Kalvakolanu D.V. Mol. Cell. Biol. 18:6493-6504(1998) [PubMed: 9774665] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), FUNCTION, INDUCTION. Tissue: Mammary carcinoma. |
| [4] | "Evidence for intriguingly complex transcription of human thioredoxin reductase 1." Rundloef A.-K., Janard M., Miranda-Vizuete A., Arner E.S. Free Radic. Biol. Med. 36:641-656(2004) [PubMed: 14980707] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), VARIANT GLY-365. Tissue: Mammary gland, Ovary, Testis and Thymus. |
| [5] | "Identification by ddPCR of thioredoxin reductase as a vitamin D regulated gene in human osteoblasts." Schuetze N., Bachthaler M., Lechner A., Koehrle J., Jakob F. Submitted (AUG-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). |
| [6] | "Cloning and sequencing of thioredoxin reductase gene from human brain." Xu L., Dai R., Xu J.Y. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Brain. |
| [7] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). |
| [8] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). |
| [9] | NIEHS SNPs program Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Lung. |
| [11] | "Selenocysteine, identified as the penultimate C-terminal residue in human T-cell thioredoxin reductase, corresponds to TGA in the human placental gene." Gladyshev V.N., Jeang K.-T., Stadtman T.C. Proc. Natl. Acad. Sci. U.S.A. 93:6146-6151(1996) [PubMed: 8650234] [Abstract] Cited for: PROTEIN SEQUENCE OF 307-316; 449-456; 466-476 AND 638-649, MASS SPECTROMETRY, BLOCKAGE OF N-TERMINUS, SELENOCYSTEINE AT SEC-648. |
| [12] | "A new selenoprotein from human lung adenocarcinoma cells: purification, properties, and thioredoxin reductase activity." Tamura T., Stadtman T.C. Proc. Natl. Acad. Sci. U.S.A. 93:1006-1011(1996) [PubMed: 8577704] [Abstract] Cited for: FUNCTION, HOMODIMERIZATION, CHARACTERIZATION, PRESENCE OF SELENOCYSTEINE. |
| [13] | "Alternative splicing involving the thioredoxin reductase module in mammals: a glutaredoxin-containing thioredoxin reductase 1." Su D., Gladyshev V.N. Biochemistry 43:12177-12188(2004) [PubMed: 15379556] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5 AND 6), DOMAIN. |
| [14] | "An alternative splicing variant of the selenoprotein thioredoxin reductase is a modulator of estrogen signaling." Damdimopoulos A.E., Miranda-Vizuete A., Treuter E., Gustafsson J.-A., Spyrou G. J. Biol. Chem. 279:38721-38729(2004) [PubMed: 15199063] [Abstract] Cited for: FUNCTION, INTERACTION WITH ESR1 AND ESR2, SUBCELLULAR LOCATION, TISSUE SPECIFICITY (ISOFORM 4). |
| [15] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-161; TYR-163; TYR-281 AND TYR-572, MASS SPECTROMETRY. |
| [16] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-281, MASS SPECTROMETRY. |
| [17] | "Induction of cell membrane protrusions by the N-terminal glutaredoxin domain of a rare splice variant of human thioredoxin reductase 1." Dammeyer P., Damdimopoulos A.E., Nordman T., Jimenez A., Miranda-Vizuete A., Arner E.S.J. J. Biol. Chem. 283:2814-2821(2008) [PubMed: 18042542] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION (ISOFORM 1). |
| [18] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [19] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-239 AND LYS-405, MASS SPECTROMETRY. |
| [20] | "The structure of human thioredoxin reductase 1 provides insights into C-terminal rearrangements during catalysis." Fritz-Wolf K., Urig S., Becker K. J. Mol. Biol. 370:116-127(2007) [PubMed: 17512005] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) (ISOFORM 5). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X91247 mRNA. Translation: CAA62629.1. Sequence problems. S79851 mRNA. Translation: AAB35418.1. Sequence problems. D88687 mRNA. Translation: BAA13674.1. Sequence problems. AF077367 mRNA. Translation: AAC69621.1. Sequence problems. AY057105 mRNA. Translation: AAL15432.1. AY344081 mRNA. Translation: AAQ62461.1. AY344083 mRNA. Translation: AAQ62462.1. AY344084 mRNA. Translation: AAQ62463.1. AY344086 mRNA. Translation: AAQ62464.1. AY344087 mRNA. Translation: AAQ62465.1. AY344089 mRNA. Translation: AAQ62466.1. AY344092 mRNA. Translation: AAQ62467.1. AY344093 mRNA. Translation: AAQ62468.1. AY344095 mRNA. Translation: AAQ62469.1. AY344096 mRNA. Translation: AAQ62470.1. AY344670 mRNA. Translation: AAQ62471.1. AY344673 mRNA. Translation: AAQ62472.1. AY344679 mRNA. Translation: AAQ62473.1. AJ001050 mRNA. Translation: CAA04503.1. Sequence problems. AF208018 mRNA. Translation: AAF15900.1. Sequence problems. CR536506 mRNA. Translation: CAG38744.1. Sequence problems. BT019640 mRNA. Translation: AAV38446.1. Sequence problems. DQ157758 Genomic DNA. Translation: AAZ67916.1. Sequence problems. BC018122 mRNA. Translation: AAH18122.2. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00554786. IPI00783641. IPI00847482. IPI00871867. IPI00884896. IPI00885213. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | S66677. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001087240.1. NP_003321.3. NP_877393.1. NP_877419.1. NP_877420.1. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q16881. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
2-D gel databases | |||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00554786. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000429002; ENSP00000412045; ENSG00000198431; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 7296. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:7296. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 7296. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC12P103133. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:12437. TXNRD1. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 601112. gene. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37093. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG12063. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_1698. Metabolism of nucleotides. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q16881. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000211449. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR016156. FAD/NAD-linked_Rdtase_dimer. IPR013027. FAD_pyr_nucl-diS_OxRdtase. IPR002109. Glutaredoxin. IPR000815. Hg_reductase. IPR004099. Pyr_nucl-diS_OxRdtase_dimer. IPR012999. Pyr_OxRdtase_I_AS. IPR001327. Pyr_OxRdtase_NAD_bd. IPR012336. Thioredoxin-like_fold. IPR006338. Thioredoxin/glutathione_Rdtase. IPR012335. Thioredoxin_fold. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.30.390.30. Pyr_redox_dim. 1 hit. G3DSA:3.40.30.10. Thioredoxin_fold. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR22912:SF23. Reduct_Se. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00462. Glutaredoxin. 1 hit. PF00070. Pyr_redox. 1 hit. PF07992. Pyr_redox_2. 1 hit. PF02852. Pyr_redox_dim. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00368. FADPNR. PR00945. HGRDTASE. | ||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR01438. TGR. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00195. GLUTAREDOXIN_1. False negative. PS51354. GLUTAREDOXIN_2. 1 hit. PS00076. PYRIDINE_REDOX_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||
| NextBio | 28527. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | TRXR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16881 Secondary accession number(s): Q6FI31 Q9UH79 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


