Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3

Gene

PFKFB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Synthesis and degradation of fructose 2,6-bisphosphate.

Catalytic activityi

Beta-D-fructose 2,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate.
ATP + D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei75Fructose 6-phosphate1 Publication1
Binding sitei99Fructose 6-phosphate1 Publication1
Active sitei125Sequence analysis1
Binding sitei127Fructose 6-phosphate1 Publication1
Binding sitei133Fructose 6-phosphate1 Publication1
Active sitei155Sequence analysis1
Binding sitei169Fructose 6-phosphate1 Publication1
Binding sitei190Fructose 6-phosphate1 Publication1
Binding sitei194Fructose 6-phosphate1 Publication1
Binding sitei253Fructose 2,6-bisphosphate1 Publication1
Sitei253Transition state stabilizer1 Publication1
Active sitei254Tele-phosphohistidine intermediate1 Publication1
Binding sitei260Fructose 2,6-bisphosphate1 Publication1
Sitei260Transition state stabilizer1 Publication1
Binding sitei266Fructose 2,6-bisphosphate; via amide nitrogen1 Publication1
Active sitei323Proton donor/acceptor1 Publication1
Binding sitei334Fructose 2,6-bisphosphate1 Publication1
Binding sitei348Fructose 2,6-bisphosphate1 Publication1
Binding sitei352Fructose 2,6-bisphosphate1 Publication1
Binding sitei363Fructose 2,6-bisphosphate1 Publication1
Sitei388Transition state stabilizer1 Publication1
Binding sitei389Fructose 2,6-bisphosphate1 Publication1
Binding sitei393Fructose 2,6-bisphosphateBy similarity1
Binding sitei425ATP3 Publications1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi42 – 50ATP3 Publications9
Nucleotide bindingi164 – 169ATP3 Publications6
Nucleotide bindingi345 – 348ATPBy similarity4
Nucleotide bindingi389 – 393ATPBy similarity5

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS10144-MONOMER.
ZFISH:HS10144-MONOMER.
BRENDAi2.7.1.105. 2681.
3.1.3.46. 2681.
ReactomeiR-HSA-70171. Glycolysis.
SABIO-RKQ16875.
SIGNORiQ16875.

Names & Taxonomyi

Protein namesi
Recommended name:
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
Short name:
6PF-2-K/Fru-2,6-P2ase 3
Short name:
PFK/FBPase 3
Alternative name(s):
6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme
Renal carcinoma antigen NY-REN-56
iPFK-2
Including the following 2 domains:
Fructose-2,6-bisphosphatase (EC:3.1.3.46)
Gene namesi
Name:PFKFB3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:8874. PFKFB3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi5209.
OpenTargetsiENSG00000170525.
PharmGKBiPA33213.

Chemistry databases

ChEMBLiCHEMBL2331053.

Polymorphism and mutation databases

BioMutaiPFKFB3.
DMDMi3023733.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001799681 – 5206-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3Add BLAST520

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei461Phosphoserine; by AMPKCombined sources1 Publication1
Modified residuei463PhosphothreonineCombined sources1
Modified residuei467PhosphoserineCombined sources1
Modified residuei471Phosphothreonine; by PKCBy similarity1

Post-translational modificationi

Phosphorylation by AMPK stimulates activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ16875.
PeptideAtlasiQ16875.
PRIDEiQ16875.

PTM databases

DEPODiQ16875.
iPTMnetiQ16875.
PhosphoSitePlusiQ16875.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000170525.
CleanExiHS_PFKFB3.
ExpressionAtlasiQ16875. baseline and differential.
GenevisibleiQ16875. HS.

Organism-specific databases

HPAiCAB020795.
HPA008266.
HPA043889.

Interactioni

Protein-protein interaction databases

BioGridi111230. 13 interactors.
DIPiDIP-33964N.
IntActiQ16875. 5 interactors.
STRINGi9606.ENSP00000369100.

Chemistry databases

BindingDBiQ16875.

Structurei

Secondary structure

1520
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi5 – 7Combined sources3
Turni9 – 11Combined sources3
Beta strandi14 – 16Combined sources3
Beta strandi36 – 43Combined sources8
Beta strandi44 – 47Combined sources4
Helixi48 – 61Combined sources14
Beta strandi66 – 70Combined sources5
Helixi71 – 78Combined sources8
Beta strandi79 – 81Combined sources3
Helixi85 – 88Combined sources4
Helixi93 – 116Combined sources24
Beta strandi120 – 126Combined sources7
Helixi131 – 144Combined sources14
Beta strandi147 – 154Combined sources8
Helixi157 – 163Combined sources7
Helixi165 – 169Combined sources5
Helixi173 – 175Combined sources3
Helixi180 – 195Combined sources16
Turni203 – 209Combined sources7
Beta strandi210 – 216Combined sources7
Turni217 – 220Combined sources4
Beta strandi221 – 225Combined sources5
Helixi230 – 241Combined sources12
Beta strandi249 – 253Combined sources5
Helixi258 – 261Combined sources4
Helixi273 – 289Combined sources17
Beta strandi295 – 298Combined sources4
Helixi302 – 309Combined sources8
Turni310 – 312Combined sources3
Beta strandi315 – 317Combined sources3
Helixi319 – 321Combined sources3
Helixi327 – 329Combined sources3
Helixi334 – 340Combined sources7
Helixi342 – 350Combined sources9
Turni352 – 354Combined sources3
Helixi363 – 379Combined sources17
Beta strandi381 – 387Combined sources7
Helixi389 – 399Combined sources11
Turni404 – 406Combined sources3
Helixi407 – 409Combined sources3
Beta strandi416 – 423Combined sources8
Beta strandi426 – 433Combined sources8
Helixi442 – 446Combined sources5
Helixi455 – 457Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AXNX-ray2.10A1-520[»]
2DWOX-ray2.25A1-520[»]
2DWPX-ray2.70A1-520[»]
2I1VX-ray2.50B1-520[»]
3QPUX-ray2.30A1-520[»]
3QPVX-ray2.50A1-520[»]
3QPWX-ray2.25A1-520[»]
4D4JX-ray3.00A1-449[»]
4D4KX-ray3.24A1-449[»]
4D4LX-ray3.16A1-449[»]
4D4MX-ray2.32A1-449[»]
4MA4X-ray2.23A1-520[»]
5AJVX-ray3.01B1-520[»]
5AJWX-ray2.50A1-520[»]
5AJXX-ray2.58A1-520[»]
5AJYX-ray2.37A1-520[»]
5AJZX-ray2.35A1-520[»]
5AK0X-ray2.03A1-520[»]
ProteinModelPortaliQ16875.
SMRiQ16875.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ16875.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 2456-phosphofructo-2-kinaseAdd BLAST245
Regioni246 – 520Fructose-2,6-bisphosphataseAdd BLAST275

Sequence similaritiesi

In the C-terminal section; belongs to the phosphoglycerate mutase family.Curated

Phylogenomic databases

eggNOGiKOG0234. Eukaryota.
COG0406. LUCA.
GeneTreeiENSGT00390000018751.
HOGENOMiHOG000181112.
HOVERGENiHBG005628.
InParanoidiQ16875.
KOiK01103.
OMAiADEMPYL.
OrthoDBiEOG091G0A43.
PhylomeDBiQ16875.
TreeFamiTF313541.

Family and domain databases

CDDicd07067. HP_PGM_like. 1 hit.
Gene3Di3.40.50.1240. 1 hit.
3.40.50.300. 1 hit.
InterProiIPR003094. 6Pfruct_kin.
IPR013079. 6Phosfructo_kin.
IPR013078. His_Pase_superF_clade-1.
IPR029033. His_PPase_superfam.
IPR027417. P-loop_NTPase.
IPR001345. PG/BPGM_mutase_AS.
[Graphical view]
PANTHERiPTHR10606. PTHR10606. 1 hit.
PfamiPF01591. 6PF2K. 1 hit.
PF00300. His_Phos_1. 1 hit.
[Graphical view]
PRINTSiPR00991. 6PFRUCTKNASE.
SMARTiSM00855. PGAM. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
SSF53254. SSF53254. 1 hit.
PROSITEiPS00175. PG_MUTASE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16875-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLELTQSRV QKIWVPVDHR PSLPRSCGPK LTNSPTVIVM VGLPARGKTY
60 70 80 90 100
ISKKLTRYLN WIGVPTKVFN VGEYRREAVK QYSSYNFFRP DNEEAMKVRK
110 120 130 140 150
QCALAALRDV KSYLAKEGGQ IAVFDATNTT RERRHMILHF AKENDFKAFF
160 170 180 190 200
IESVCDDPTV VASNIMEVKI SSPDYKDCNS AEAMDDFMKR ISCYEASYQP
210 220 230 240 250
LDPDKCDRDL SLIKVIDVGR RFLVNRVQDH IQSRIVYYLM NIHVQPRTIY
260 270 280 290 300
LCRHGENEHN LQGRIGGDSG LSSRGKKFAS ALSKFVEEQN LKDLRVWTSQ
310 320 330 340 350
LKSTIQTAEA LRLPYEQWKA LNEIDAGVCE ELTYEEIRDT YPEEYALREQ
360 370 380 390 400
DKYYYRYPTG ESYQDLVQRL EPVIMELERQ ENVLVICHQA VLRCLLAYFL
410 420 430 440 450
DKSAEEMPYL KCPLHTVLKL TPVAYGCRVE SIYLNVESVC THRERSEDAK
460 470 480 490 500
KGPNPLMRRN SVTPLASPEP TKKPRINSFE EHVASTSAAL PSCLPPEVPT
510 520
QLPGQNMKGS RSSADSSRKH
Length:520
Mass (Da):59,609
Last modified:November 1, 1996 - v1
Checksum:iA7675A4ADC376879
GO
Isoform 2 (identifier: Q16875-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     506-520: NMKGSRSSADSSRKH → PLLGQACLT

Show »
Length:514
Mass (Da):58,876
Checksum:i18FD1D267306853D
GO
Isoform 3 (identifier: Q16875-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MPLELTQSRVQKIWVPVDHRPSLPRS → MPFRKA

Note: Gene prediction based on EST data.
Show »
Length:500
Mass (Da):57,287
Checksum:i32D2924D3D207C17
GO
Isoform 4 (identifier: Q16875-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MPLELTQSRVQKIWVPVDHRPSLPRS → MGEGGQKEGDSQQAGALPLLCQLDTFSPKATVFGVSINPA

Note: No experimental confirmation available.
Show »
Length:534
Mass (Da):60,602
Checksum:iFB3222408A8BC7EE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti136M → V in AAB99795 (Ref. 4) Curated1
Sequence conflicti141A → G in AAC62000 (PubMed:10077634).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0471651 – 26MPLEL…SLPRS → MPFRKA in isoform 3. CuratedAdd BLAST26
Alternative sequenceiVSP_0545491 – 26MPLEL…SLPRS → MGEGGQKEGDSQQAGALPLL CQLDTFSPKATVFGVSINPA in isoform 4. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_004680506 – 520NMKGS…SSRKH → PLLGQACLT in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49817 mRNA. Translation: BAA08624.1.
L77662 mRNA. Translation: AAL40083.1.
AF109735 mRNA. Translation: AAD08818.1.
AF041831
, AF041823, AF041824, AF041825, AF041826, AF041827, AF041828, AF041829, AF041830 Genomic DNA. Translation: AAB99795.1.
AF056320 mRNA. Translation: AAC62000.1.
AK291263 mRNA. Translation: BAF83952.1.
AK304450 mRNA. Translation: BAH14191.1.
AL359960, AL157395 Genomic DNA. Translation: CAH72163.1.
AL157395, AL359960 Genomic DNA. Translation: CAH73606.1.
CH471072 Genomic DNA. Translation: EAW86398.1.
CH471072 Genomic DNA. Translation: EAW86399.1.
BC040482 mRNA. Translation: AAH40482.1.
CCDSiCCDS44353.1. [Q16875-3]
CCDS60479.1. [Q16875-4]
CCDS7078.1. [Q16875-1]
CCDS81439.1. [Q16875-2]
PIRiJC4626.
RefSeqiNP_001269559.1. NM_001282630.2. [Q16875-4]
NP_001300992.1. NM_001314063.1. [Q16875-2]
NP_004557.1. NM_004566.3. [Q16875-1]
UniGeneiHs.195471.

Genome annotation databases

EnsembliENST00000360521; ENSP00000353712; ENSG00000170525. [Q16875-2]
ENST00000379775; ENSP00000369100; ENSG00000170525. [Q16875-1]
ENST00000379789; ENSP00000369115; ENSG00000170525. [Q16875-3]
ENST00000536985; ENSP00000443319; ENSG00000170525. [Q16875-4]
GeneIDi5209.
KEGGihsa:5209.
UCSCiuc001ijd.4. human. [Q16875-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49817 mRNA. Translation: BAA08624.1.
L77662 mRNA. Translation: AAL40083.1.
AF109735 mRNA. Translation: AAD08818.1.
AF041831
, AF041823, AF041824, AF041825, AF041826, AF041827, AF041828, AF041829, AF041830 Genomic DNA. Translation: AAB99795.1.
AF056320 mRNA. Translation: AAC62000.1.
AK291263 mRNA. Translation: BAF83952.1.
AK304450 mRNA. Translation: BAH14191.1.
AL359960, AL157395 Genomic DNA. Translation: CAH72163.1.
AL157395, AL359960 Genomic DNA. Translation: CAH73606.1.
CH471072 Genomic DNA. Translation: EAW86398.1.
CH471072 Genomic DNA. Translation: EAW86399.1.
BC040482 mRNA. Translation: AAH40482.1.
CCDSiCCDS44353.1. [Q16875-3]
CCDS60479.1. [Q16875-4]
CCDS7078.1. [Q16875-1]
CCDS81439.1. [Q16875-2]
PIRiJC4626.
RefSeqiNP_001269559.1. NM_001282630.2. [Q16875-4]
NP_001300992.1. NM_001314063.1. [Q16875-2]
NP_004557.1. NM_004566.3. [Q16875-1]
UniGeneiHs.195471.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AXNX-ray2.10A1-520[»]
2DWOX-ray2.25A1-520[»]
2DWPX-ray2.70A1-520[»]
2I1VX-ray2.50B1-520[»]
3QPUX-ray2.30A1-520[»]
3QPVX-ray2.50A1-520[»]
3QPWX-ray2.25A1-520[»]
4D4JX-ray3.00A1-449[»]
4D4KX-ray3.24A1-449[»]
4D4LX-ray3.16A1-449[»]
4D4MX-ray2.32A1-449[»]
4MA4X-ray2.23A1-520[»]
5AJVX-ray3.01B1-520[»]
5AJWX-ray2.50A1-520[»]
5AJXX-ray2.58A1-520[»]
5AJYX-ray2.37A1-520[»]
5AJZX-ray2.35A1-520[»]
5AK0X-ray2.03A1-520[»]
ProteinModelPortaliQ16875.
SMRiQ16875.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111230. 13 interactors.
DIPiDIP-33964N.
IntActiQ16875. 5 interactors.
STRINGi9606.ENSP00000369100.

Chemistry databases

BindingDBiQ16875.
ChEMBLiCHEMBL2331053.

PTM databases

DEPODiQ16875.
iPTMnetiQ16875.
PhosphoSitePlusiQ16875.

Polymorphism and mutation databases

BioMutaiPFKFB3.
DMDMi3023733.

Proteomic databases

PaxDbiQ16875.
PeptideAtlasiQ16875.
PRIDEiQ16875.

Protocols and materials databases

DNASUi5209.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360521; ENSP00000353712; ENSG00000170525. [Q16875-2]
ENST00000379775; ENSP00000369100; ENSG00000170525. [Q16875-1]
ENST00000379789; ENSP00000369115; ENSG00000170525. [Q16875-3]
ENST00000536985; ENSP00000443319; ENSG00000170525. [Q16875-4]
GeneIDi5209.
KEGGihsa:5209.
UCSCiuc001ijd.4. human. [Q16875-1]

Organism-specific databases

CTDi5209.
DisGeNETi5209.
GeneCardsiPFKFB3.
HGNCiHGNC:8874. PFKFB3.
HPAiCAB020795.
HPA008266.
HPA043889.
MIMi605319. gene.
neXtProtiNX_Q16875.
OpenTargetsiENSG00000170525.
PharmGKBiPA33213.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0234. Eukaryota.
COG0406. LUCA.
GeneTreeiENSGT00390000018751.
HOGENOMiHOG000181112.
HOVERGENiHBG005628.
InParanoidiQ16875.
KOiK01103.
OMAiADEMPYL.
OrthoDBiEOG091G0A43.
PhylomeDBiQ16875.
TreeFamiTF313541.

Enzyme and pathway databases

BioCyciMetaCyc:HS10144-MONOMER.
ZFISH:HS10144-MONOMER.
BRENDAi2.7.1.105. 2681.
3.1.3.46. 2681.
ReactomeiR-HSA-70171. Glycolysis.
SABIO-RKQ16875.
SIGNORiQ16875.

Miscellaneous databases

ChiTaRSiPFKFB3. human.
EvolutionaryTraceiQ16875.
GeneWikiiPFKFB3.
GenomeRNAii5209.
PROiQ16875.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170525.
CleanExiHS_PFKFB3.
ExpressionAtlasiQ16875. baseline and differential.
GenevisibleiQ16875. HS.

Family and domain databases

CDDicd07067. HP_PGM_like. 1 hit.
Gene3Di3.40.50.1240. 1 hit.
3.40.50.300. 1 hit.
InterProiIPR003094. 6Pfruct_kin.
IPR013079. 6Phosfructo_kin.
IPR013078. His_Pase_superF_clade-1.
IPR029033. His_PPase_superfam.
IPR027417. P-loop_NTPase.
IPR001345. PG/BPGM_mutase_AS.
[Graphical view]
PANTHERiPTHR10606. PTHR10606. 1 hit.
PfamiPF01591. 6PF2K. 1 hit.
PF00300. His_Phos_1. 1 hit.
[Graphical view]
PRINTSiPR00991. 6PFRUCTKNASE.
SMARTiSM00855. PGAM. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
SSF53254. SSF53254. 1 hit.
PROSITEiPS00175. PG_MUTASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiF263_HUMAN
AccessioniPrimary (citable) accession number: Q16875
Secondary accession number(s): B7Z955
, O43622, O75902, Q5VX15, Q5VX18, Q5VX19
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: November 2, 2016
This is version 174 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Multifunctional enzyme, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.