Q16849 (PTPRN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Receptor-type tyrosine-protein phosphatase-like N Short name=R-PTP-N Alternative name(s): Islet cell antigen 512 Short name=ICA 512 Islet cell autoantigen 3 PTP IA-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 979 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Implicated in neuroendocrine secretory processes. May be involved in processes specific for neurosecretory granules, such as their biogenesis, trafficking or regulated exocytosis or may have a general role in neuroendocrine functions. Seems to lack intrinsic enzyme activity. May play a role in the regulation of secretory granules via its interaction with SNTB2. Ref.6 Ref.7 |
| Subunit structure | Interacts with phosphorylated SNTB2, protecting it from protein cleavage by CAPN1. Dephosphorylation of SNTB2 upon insulin stimulation disrupts the interaction and results in its cleavage. Ref.8 |
| Subcellular location | Membrane; Single-pass type I membrane protein. Note: Neuroendocrine secretory granules. |
| Tissue specificity | Expression is restricted to neuroendocrine cells. Found in pancreas, brain and pituitary. Ref.1 |
| Post-translational modification | O-glycosylated with core 1 or possibly core 8 glycans. Ref.9 Ref.10 Appears to undergo multiple proteolytic cleavage at consecutive basic residues. |
| Miscellaneous | Autoantigen in insulin-dependent diabetes mellitus (IDDM). |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Receptor class 8 subfamily. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MADD | Q8WXG6 | 4 | EBI-728153,EBI-310528 | |
| PPIA | P62937 | 3 | EBI-728153,EBI-437708 | |
| PTPRS | Q13332 | 5 | EBI-728153,EBI-711536 | |
| PTPRT | O14522 | 3 | EBI-728153,EBI-728180 | |
| SNX19 | Q92543 | 4 | EBI-728153,EBI-728232 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16849-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16849-2) The sequence of this isoform differs from the canonical sequence as follows: 479-508: KPLSLAAGVKLLEILAEHVHMSSGSFINIS → N | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q16849-3) The sequence of this isoform differs from the canonical sequence as follows: 1-90: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 34 | 34 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 35 – 979 | 945 | Receptor-type tyrosine-protein phosphatase-like N | PRO_0000025451 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 35 – 575 | 541 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 576 – 600 | 25 | Helical; Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 601 – 979 | 379 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 709 – 969 | 261 | Tyrosine-protein phosphatase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 909 – 915 | 7 | Substrate binding By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 909 | 1 | Phosphocysteine intermediate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 448 – 449 | 2 | Cleavage Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 441 | 1 | O-linked (GalNAc...) Ref.9 Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 506 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 524 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 90 | 90 | Missing in isoform 3. | VSP_045867 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 479 – 508 | 30 | KPLSL…FINIS → N in isoform 2. | VSP_043654 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 419 | 1 | S → R. Corresponds to variant rs35314717 [ dbSNP | Ensembl ]. | VAR_051762 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 673 | 1 | S → G in BAG59024. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 471 – 477 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 483 – 497 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 501 – 503 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 504 – 510 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 513 – 518 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 527 – 536 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 538 – 545 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 549 – 555 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 692 – 704 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 706 – 717 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 727 – 730 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 732 – 734 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 735 – 737 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 755 – 757 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 766 – 770 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 780 – 783 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 788 – 790 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 791 – 801 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 805 – 808 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 812 – 814 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 826 – 832 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 835 – 844 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 846 – 858 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 859 – 861 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 864 – 872 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 877 – 880 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 885 – 896 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 905 – 908 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 910 – 913 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 914 – 930 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 938 – 946 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 956 – 975 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and identification of a receptor-type protein tyrosine phosphatase, IA-2, from human insulinoma." Lan M.S., Lu J., Goto Y., Notkins A.L. DNA Cell Biol. 13:505-514(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Insulinoma. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Thalamus. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [6] | "Islet cell antigen 512 is a diabetes-specific islet autoantigen related to protein tyrosine phosphatases." Rabin D.U., Pleasic S.M., Shapiro J.A., Yoo-Warren H., Oles J., Hicks J.M., Goldstein D.E., Rae P.M. J. Immunol. 152:3183-3188(1994) [PubMed] [Europe PMC] [Abstract] Cited for: PRELIMINARY NUCLEOTIDE SEQUENCE OF 389-789, ROLE IN DIABETES MELLITUS. Tissue: Pancreatic islet. |
| [7] | "ICA 512, an autoantigen of type I diabetes, is an intrinsic membrane protein of neurosecretory granules." Solimena M., Dirkx R. Jr., Hermel J.-M., Pleasic-Williams S., Shapiro J.A., Caron L., Rabin D.U. EMBO J. 15:2102-2114(1996) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION, ROLE IN DIABETES MELLITUS. |
| [8] | "Dephosphorylation of beta2-syntrophin and Ca2+/mu-calpain-mediated cleavage of ICA512 upon stimulation of insulin secretion." Ort T., Voronov S., Guo J., Zawalich K., Froehner S.C., Zawalich W., Solimena M. EMBO J. 20:4013-4023(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNTB2, PROTEOLYTIC PROCESSING, DEPHOSPHORYLATION. |
| [9] | "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD." Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-441, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. |
| [10] | "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins." Halim A., Ruetschi U., Larson G., Nilsson J. J. Proteome Res. 12:573-584(2013) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-441, MASS SPECTROMETRY. |
| [11] | "Structure of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase IA-2." Primo M.E., Klinke S., Sica M.P., Goldbaum F.A., Jakoncic J., Poskus E., Ermacora M.R. J. Biol. Chem. 283:4674-4681(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.3 ANGSTROMS) OF 468-558. |
| [12] | "Structural genomics of protein phosphatases." Almo S.C., Bonanno J.B., Sauder J.M., Emtage S., Dilorenzo T.P., Malashkevich V., Wasserman S.R., Swaminathan S., Eswaramoorthy S., Agarwal R., Kumaran D., Madegowda M., Ragumani S., Patskovsky Y., Alvarado J., Ramagopal U.A., Faber-Barata J., Chance M.R. Burley S.K.J. Struct. Funct. Genomics 8:121-140(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.23 ANGSTROMS) OF 681-979. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L18983 mRNA. Translation: AAA90974.1. AK296335 mRNA. Translation: BAG59024.1. AC114803 Genomic DNA. Translation: AAY24038.1. CH471063 Genomic DNA. Translation: EAW70724.1. CH471063 Genomic DNA. Translation: EAW70726.1. BC070053 mRNA. Translation: AAH70053.1. X62899 mRNA. Translation: CAA44688.2. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00004440. IPI00916379. IPI00917520. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | I37577. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001186692.1. NM_001199763.1. NP_001186693.1. NM_001199764.1. NP_002837.1. NM_002846.3. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.89655. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q16849. 9 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1350221. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000295718. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 2499754. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5798. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000295718; ENSP00000295718; ENSG00000054356. ENST00000409251; ENSP00000386638; ENSG00000054356. ENST00000537666; ENSP00000444244; ENSG00000054356. ENST00000539342; ENSP00000445579; ENSG00000054356. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5798. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5798. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002vkz.3. human. uc002vla.3. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 5798. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC02M220118. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9676. PTPRN. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA007179. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 601773. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA34021. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5599. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000243992. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG053762. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K07817. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | EVCIQDG. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4WDDBX. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PTPRN. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000054356. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR021613. Receptor_IA-2. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF11548. Receptor_IA-2. 1 hit. PF00102. Y_phosphatase. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00700. PRTYPHPHTASE. | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00194. PTPc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50055. TYR_PHOSPHATASE_PTP. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5798. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 22580. | ||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q16849. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PTPRN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16849 Secondary accession number(s): B4DK12 Q6NSL1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
