Q16816 (PHKG1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 130.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform Short name=PHK-gamma-M EC=2.7.11.19 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 387 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Catalytic subunit of the phosphorylase b kinase (PHK), which mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase. In vitro, phosphorylates PYGM, TNNI3, MAPT/TAU, GAP43 and NRGN/RC3 By similarity. |
| Catalytic activity | 2 ATP + phosphorylase b = 2 ADP + phosphorylase a. ATP + [tau protein] = ADP + [tau protein] phosphate. ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Hexadecamer of 4 heterotetramers, each composed of alpha, beta, gamma, and delta subunits. Alpha (PHKA1 or PHKA2) and beta (PHKB) are regulatory subunits, gamma (PHKG1 or PHKG2) is the catalytic subunit, and delta is calmodulin. |
| Domain | The two calmodulin-binding domains appear to act in concert to bind a single molecule of calmodulin and are pseudosubstrate/autoinhibitory domains By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16816-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16816-2) The sequence of this isoform differs from the canonical sequence as follows: 106-106: L → LWEDTDTMEMEQKWCLGWDSPKSTNFRAQGRAR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 387 | 386 | Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform | PRO_0000086508 | |||||
Regions | |||||||||
| Domain | 20 – 288 | 269 | Protein kinase | ||||||
| Nucleotide binding | 26 – 34 | 9 | ATP By similarity | ||||||
| Region | 303 – 327 | 25 | Calmodulin-binding (domain-N) | ||||||
| Region | 343 – 367 | 25 | Calmodulin-binding (domain-C) | ||||||
Sites | |||||||||
| Active site | 150 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 49 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 106 | 1 | L → LWEDTDTMEMEQKWCLGWDS PKSTNFRAQGRAR in isoform 2. | VSP_044716 | |||||
| Natural variant | 48 | 1 | V → M in a colorectal adenocarcinoma sample; somatic mutation. Ref.7 | VAR_040994 | |||||
| Natural variant | 323 | 1 | R → C. Ref.7 | VAR_040995 | |||||
Experimental info | |||||||||
| Sequence conflict | 100 | 1 | F → L in BAH11466. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X80590 mRNA. Translation: CAA56681.1. AF254253 AF254252 Genomic DNA. Translation: AAL36972.1.AK293180 mRNA. Translation: BAH11466.1. AC092101 Genomic DNA. Translation: AAS07453.1. CH471140 Genomic DNA. Translation: EAX07987.1. BC051327 mRNA. Translation: AAH51327.1. BC069679 mRNA. Translation: AAH69679.1. BC069738 mRNA. Translation: AAH69738.1. BC069754 mRNA. Translation: AAH69754.1. BC074753 mRNA. Translation: AAH74753.1. |
| IPI | IPI00220396. IPI00922459. |
| RefSeq | NP_001245388.1. NM_001258459.1. NP_006204.1. NM_006213.4. |
| UniGene | Hs.730821. |
3D structure databases | |
| ProteinModelPortal | Q16816. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000297373. |
PTM databases | |
| PhosphoSite | Q16816. |
Polymorphism databases | |
| DMDM | 2833281. |
Proteomic databases | |
| PaxDb | Q16816. |
| PRIDE | Q16816. |
Protocols and materials databases | |
| DNASU | 5260. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000297373; ENSP00000297373; ENSG00000164776. ENST00000452681; ENSP00000445440; ENSG00000164776. |
| GeneID | 5260. |
| KEGG | hsa:5260. |
| UCSC | uc003try.1. human. |
Organism-specific databases | |
| CTD | 5260. |
| GeneCards | GC07M056115. |
| HGNC | HGNC:8930. PHKG1. |
| HPA | HPA012057. |
| MIM | 172470. gene. |
| neXtProt | NX_Q16816. |
| PharmGKB | PA33271. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG106193. |
| KO | K00871. |
| OMA | DFYENYE. |
| OrthoDB | EOG4CNQR5. |
| PhylomeDB | Q16816. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS09136-MONOMER. |
| BRENDA | 2.7.11.19. 2681. |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | Q16816. |
| Bgee | Q16816. |
| CleanEx | HS_PHKG1. |
| Genevestigator | Q16816. |
| GermOnline | ENSG00000164776. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR020636. Ca/CaM-dep_Ca-dep_prot_Kinase. IPR011009. Kinase-like_dom. IPR002291. Phosph_kin_gamma. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| PANTHER | PTHR24347. PTHR24347. 1 hit. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| PRINTS | PR01049. PHOSPHBKNASE. |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q16816. |
| ChEMBL | CHEMBL4004. |
| GenomeRNAi | 5260. |
| NextBio | 20318. |
| PMAP-CutDB | Q16816. |
| SOURCE | Search... |
Entry information
| Entry name | PHKG1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16816 Secondary accession number(s): B7Z1D0, F5H2S1, Q75LP5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
