Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADP-dependent malic enzyme, mitochondrial

Gene

ME3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

(S)-malate + NADP+ = pyruvate + CO2 + NADPH.
Oxaloacetate = pyruvate + CO2.

Cofactori

Mg2+By similarity, Mn2+By similarityNote: Divalent metal cations. Prefers magnesium or manganese.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei137Proton donorBy similarity1
Binding sitei190NADBy similarity1
Active sitei208Proton acceptorBy similarity1
Metal bindingi280Divalent metal cationBy similarity1
Metal bindingi281Divalent metal cationBy similarity1
Metal bindingi304Divalent metal cationBy similarity1
Binding sitei304NADBy similarity1
Sitei304Important for activityBy similarity1
Binding sitei443NADBy similarity1

GO - Molecular functioni

  • cofactor binding Source: UniProtKB
  • malate dehydrogenase (decarboxylating) (NAD+) activity Source: InterPro
  • malate dehydrogenase (decarboxylating) (NADP+) activity Source: UniProtKB
  • malic enzyme activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • NAD binding Source: InterPro
  • oxaloacetate decarboxylase activity Source: UniProtKB-EC

GO - Biological processi

  • aerobic respiration Source: UniProtKB
  • malate metabolic process Source: UniProtKB
  • oxidation-reduction process Source: UniProtKB
  • oxygen metabolic process Source: UniProtKB
  • pyruvate metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

Metal-binding, NADP

Enzyme and pathway databases

BioCyciZFISH:HS07730-MONOMER.
SABIO-RKQ16798.

Names & Taxonomyi

Protein namesi
Recommended name:
NADP-dependent malic enzyme, mitochondrial (EC:1.1.1.40)
Short name:
NADP-ME
Alternative name(s):
Malic enzyme 3
Gene namesi
Name:ME3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:6985. ME3.

Subcellular locationi

GO - Cellular componenti

  • mitochondrial matrix Source: UniProtKB-SubCell
  • mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi10873.
OpenTargetsiENSG00000151376.
PharmGKBiPA30725.

Chemistry databases

ChEMBLiCHEMBL6182.

Polymorphism and mutation databases

BioMutaiME3.
DMDMi215274021.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000018539? – 604NADP-dependent malic enzyme, mitochondrial
Transit peptidei1 – ?MitochondrionSequence analysis

Proteomic databases

MaxQBiQ16798.
PaxDbiQ16798.
PeptideAtlasiQ16798.
PRIDEiQ16798.

PTM databases

iPTMnetiQ16798.
PhosphoSitePlusiQ16798.

Expressioni

Tissue specificityi

Expressed predominantly in organs with a low-division rate.

Gene expression databases

BgeeiENSG00000151376.
CleanExiHS_ME3.
ExpressionAtlasiQ16798. baseline and differential.
GenevisibleiQ16798. HS.

Organism-specific databases

HPAiHPA038473.

Interactioni

Protein-protein interaction databases

BioGridi116081. 1 interactor.
STRINGi9606.ENSP00000352657.

Structurei

3D structure databases

ProteinModelPortaliQ16798.
SMRiQ16798.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the malic enzymes family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG1257. Eukaryota.
COG0281. LUCA.
GeneTreeiENSGT00390000000754.
HOGENOMiHOG000042486.
HOVERGENiHBG000746.
InParanoidiQ16798.
KOiK00029.
OMAiCYQVTEG.
OrthoDBiEOG091G04H9.
PhylomeDBiQ16798.
TreeFamiTF300537.

Family and domain databases

Gene3Di3.40.50.10380. 1 hit.
3.40.50.720. 1 hit.
InterProiIPR015884. Malic_enzyme_CS.
IPR012301. Malic_N_dom.
IPR012302. Malic_NAD-bd.
IPR001891. Malic_OxRdtase.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PfamiPF00390. malic. 1 hit.
PF03949. Malic_M. 1 hit.
[Graphical view]
PIRSFiPIRSF000106. ME. 1 hit.
PRINTSiPR00072. MALOXRDTASE.
SMARTiSM01274. malic. 1 hit.
SM00919. Malic_M. 1 hit.
[Graphical view]
SUPFAMiSSF51735. SSF51735. 1 hit.
PROSITEiPS00331. MALIC_ENZYMES. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16798-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAALGTGTR LAPWPGRACG ALPRWTPTAP AQGCHSKPGP ARPVPLKKRG
60 70 80 90 100
YDVTRNPHLN KGMAFTLEER LQLGIHGLIP PCFLSQDVQL LRIMRYYERQ
110 120 130 140 150
QSDLDKYIIL MTLQDRNEKL FYRVLTSDVE KFMPIVYTPT VGLACQHYGL
160 170 180 190 200
TFRRPRGLFI TIHDKGHLAT MLNSWPEDNI KAVVVTDGER ILGLGDLGCY
210 220 230 240 250
GMGIPVGKLA LYTACGGVNP QQCLPVLLDV GTNNEELLRD PLYIGLKHQR
260 270 280 290 300
VHGKAYDDLL DEFMQAVTDK FGINCLIQFE DFANANAFRL LNKYRNKYCM
310 320 330 340 350
FNDDIQGTAS VAVAGILAAL RITKNKLSNH VFVFQGAGEA AMGIAHLLVM
360 370 380 390 400
ALEKEGVPKA EATRKIWMVD SKGLIVKGRS HLNHEKEMFA QDHPEVNSLE
410 420 430 440 450
EVVRLVKPTA IIGVAAIAGA FTEQILRDMA SFHERPIIFA LSNPTSKAEC
460 470 480 490 500
TAEKCYRVTE GRGIFASGSP FKSVTLEDGK TFIPGQGNNA YVFPGVALGV
510 520 530 540 550
IAGGIRHIPD EIFLLTAEQI AQEVSEQHLS QGRLYPPLST IRDVSLRIAI
560 570 580 590 600
KVLDYAYKHN LASYYPEPKD KEAFVRSLVY TPDYDSFTLD SYTWPKEAMN

VQTV
Length:604
Mass (Da):67,068
Last modified:November 25, 2008 - v2
Checksum:iE0E79A75F3CAC524
GO
Isoform 2 (identifier: Q16798-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     309-342: ASVAVAGILAALRITKNKLSNHVFVFQGAGEAAM → TCHTFSCPWHLWAQVMFQHIPGPMGFSEWLPRNS
     343-604: Missing.

Note: No experimental confirmation available.
Show »
Length:342
Mass (Da):38,626
Checksum:iBC18F52DF85F2BB8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti95R → G in AAH22472 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04736985S → G.1 PublicationCorresponds to variant rs17856661dbSNPEnsembl.1
Natural variantiVAR_047370324K → N.2 PublicationsCorresponds to variant rs1042780dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056626309 – 342ASVAV…GEAAM → TCHTFSCPWHLWAQVMFQHI PGPMGFSEWLPRNS in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_056627343 – 604Missing in isoform 2. 1 PublicationAdd BLAST262

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X79440 mRNA. Translation: CAA55956.1.
AK300974 mRNA. Translation: BAH13386.1.
AP001148 Genomic DNA. No translation available.
AP001831 Genomic DNA. No translation available.
AP002492 Genomic DNA. No translation available.
BC022472 mRNA. Translation: AAH22472.1.
CCDSiCCDS8277.1. [Q16798-1]
PIRiS53351.
RefSeqiNP_001014811.1. NM_001014811.1. [Q16798-1]
NP_001155058.1. NM_001161586.1. [Q16798-1]
NP_006671.2. NM_006680.2. [Q16798-1]
XP_005273774.1. XM_005273717.1. [Q16798-1]
UniGeneiHs.199743.

Genome annotation databases

EnsembliENST00000393324; ENSP00000376998; ENSG00000151376. [Q16798-1]
ENST00000526504; ENSP00000433636; ENSG00000151376. [Q16798-2]
ENST00000543262; ENSP00000440246; ENSG00000151376. [Q16798-1]
GeneIDi10873.
KEGGihsa:10873.
UCSCiuc001pbz.3. human. [Q16798-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X79440 mRNA. Translation: CAA55956.1.
AK300974 mRNA. Translation: BAH13386.1.
AP001148 Genomic DNA. No translation available.
AP001831 Genomic DNA. No translation available.
AP002492 Genomic DNA. No translation available.
BC022472 mRNA. Translation: AAH22472.1.
CCDSiCCDS8277.1. [Q16798-1]
PIRiS53351.
RefSeqiNP_001014811.1. NM_001014811.1. [Q16798-1]
NP_001155058.1. NM_001161586.1. [Q16798-1]
NP_006671.2. NM_006680.2. [Q16798-1]
XP_005273774.1. XM_005273717.1. [Q16798-1]
UniGeneiHs.199743.

3D structure databases

ProteinModelPortaliQ16798.
SMRiQ16798.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116081. 1 interactor.
STRINGi9606.ENSP00000352657.

Chemistry databases

ChEMBLiCHEMBL6182.

PTM databases

iPTMnetiQ16798.
PhosphoSitePlusiQ16798.

Polymorphism and mutation databases

BioMutaiME3.
DMDMi215274021.

Proteomic databases

MaxQBiQ16798.
PaxDbiQ16798.
PeptideAtlasiQ16798.
PRIDEiQ16798.

Protocols and materials databases

DNASUi10873.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393324; ENSP00000376998; ENSG00000151376. [Q16798-1]
ENST00000526504; ENSP00000433636; ENSG00000151376. [Q16798-2]
ENST00000543262; ENSP00000440246; ENSG00000151376. [Q16798-1]
GeneIDi10873.
KEGGihsa:10873.
UCSCiuc001pbz.3. human. [Q16798-1]

Organism-specific databases

CTDi10873.
DisGeNETi10873.
GeneCardsiME3.
H-InvDBHIX0010004.
HGNCiHGNC:6985. ME3.
HPAiHPA038473.
MIMi604626. gene.
neXtProtiNX_Q16798.
OpenTargetsiENSG00000151376.
PharmGKBiPA30725.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1257. Eukaryota.
COG0281. LUCA.
GeneTreeiENSGT00390000000754.
HOGENOMiHOG000042486.
HOVERGENiHBG000746.
InParanoidiQ16798.
KOiK00029.
OMAiCYQVTEG.
OrthoDBiEOG091G04H9.
PhylomeDBiQ16798.
TreeFamiTF300537.

Enzyme and pathway databases

BioCyciZFISH:HS07730-MONOMER.
SABIO-RKQ16798.

Miscellaneous databases

ChiTaRSiME3. human.
GenomeRNAii10873.
PROiQ16798.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151376.
CleanExiHS_ME3.
ExpressionAtlasiQ16798. baseline and differential.
GenevisibleiQ16798. HS.

Family and domain databases

Gene3Di3.40.50.10380. 1 hit.
3.40.50.720. 1 hit.
InterProiIPR015884. Malic_enzyme_CS.
IPR012301. Malic_N_dom.
IPR012302. Malic_NAD-bd.
IPR001891. Malic_OxRdtase.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PfamiPF00390. malic. 1 hit.
PF03949. Malic_M. 1 hit.
[Graphical view]
PIRSFiPIRSF000106. ME. 1 hit.
PRINTSiPR00072. MALOXRDTASE.
SMARTiSM01274. malic. 1 hit.
SM00919. Malic_M. 1 hit.
[Graphical view]
SUPFAMiSSF51735. SSF51735. 1 hit.
PROSITEiPS00331. MALIC_ENZYMES. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMAON_HUMAN
AccessioniPrimary (citable) accession number: Q16798
Secondary accession number(s): B7Z6V0, Q8TBJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: November 2, 2016
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.