Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q16798

- MAON_HUMAN

UniProt

Q16798 - MAON_HUMAN

Protein

NADP-dependent malic enzyme, mitochondrial

Gene

ME3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 131 (01 Oct 2014)
      Sequence version 2 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    (S)-malate + NADP+ = pyruvate + CO2 + NADPH.
    Oxaloacetate = pyruvate + CO2.

    Cofactori

    Divalent metal cations. Prefers magnesium or manganese By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei137 – 1371Proton donorBy similarity
    Binding sitei190 – 1901NADBy similarity
    Active sitei208 – 2081Proton acceptorBy similarity
    Metal bindingi280 – 2801Divalent metal cationBy similarity
    Metal bindingi281 – 2811Divalent metal cationBy similarity
    Metal bindingi304 – 3041Divalent metal cationBy similarity
    Binding sitei304 – 3041NADBy similarity
    Sitei304 – 3041Important for activityBy similarity
    Binding sitei443 – 4431NADBy similarity

    GO - Molecular functioni

    1. cofactor binding Source: UniProtKB
    2. malate dehydrogenase (decarboxylating) (NAD+) activity Source: InterPro
    3. malate dehydrogenase (decarboxylating) (NADP+) activity Source: UniProtKB
    4. malic enzyme activity Source: UniProtKB
    5. metal ion binding Source: UniProtKB-KW
    6. NAD binding Source: InterPro
    7. oxaloacetate decarboxylase activity Source: UniProtKB-EC

    GO - Biological processi

    1. aerobic respiration Source: UniProtKB
    2. malate metabolic process Source: UniProtKB
    3. oxidation-reduction process Source: UniProtKB
    4. oxygen metabolic process Source: UniProtKB
    5. pyruvate metabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Ligandi

    Metal-binding, NADP

    Enzyme and pathway databases

    SABIO-RKQ16798.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NADP-dependent malic enzyme, mitochondrial (EC:1.1.1.40)
    Short name:
    NADP-ME
    Alternative name(s):
    Malic enzyme 3
    Gene namesi
    Name:ME3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:6985. ME3.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrial matrix Source: UniProtKB-SubCell
    2. mitochondrion Source: UniProtKB

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30725.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini? – 604NADP-dependent malic enzyme, mitochondrialPRO_0000018539
    Transit peptidei1 – ?MitochondrionSequence Analysis

    Proteomic databases

    MaxQBiQ16798.
    PaxDbiQ16798.
    PRIDEiQ16798.

    PTM databases

    PhosphoSiteiQ16798.

    Expressioni

    Tissue specificityi

    Expressed predominantly in organs with a low-division rate.

    Gene expression databases

    ArrayExpressiQ16798.
    BgeeiQ16798.
    CleanExiHS_ME3.
    GenevestigatoriQ16798.

    Organism-specific databases

    HPAiHPA038473.

    Interactioni

    Protein-protein interaction databases

    BioGridi116081. 1 interaction.
    STRINGi9606.ENSP00000352657.

    Structurei

    3D structure databases

    ProteinModelPortaliQ16798.
    SMRiQ16798. Positions 48-602.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the malic enzymes family.Curated

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0281.
    HOGENOMiHOG000042486.
    HOVERGENiHBG000746.
    InParanoidiQ16798.
    KOiK00029.
    OMAiDFAYKHN.
    OrthoDBiEOG7G4QF0.
    PhylomeDBiQ16798.
    TreeFamiTF300537.

    Family and domain databases

    Gene3Di3.40.50.10380. 1 hit.
    3.40.50.720. 1 hit.
    InterProiIPR015884. Malic_enzyme_CS.
    IPR012301. Malic_N_dom.
    IPR012302. Malic_NAD-bd.
    IPR001891. Malic_OxRdtase.
    IPR016040. NAD(P)-bd_dom.
    [Graphical view]
    PfamiPF00390. malic. 1 hit.
    PF03949. Malic_M. 1 hit.
    [Graphical view]
    PIRSFiPIRSF000106. ME. 1 hit.
    PRINTSiPR00072. MALOXRDTASE.
    SMARTiSM00919. Malic_M. 1 hit.
    [Graphical view]
    PROSITEiPS00331. MALIC_ENZYMES. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q16798-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGAALGTGTR LAPWPGRACG ALPRWTPTAP AQGCHSKPGP ARPVPLKKRG    50
    YDVTRNPHLN KGMAFTLEER LQLGIHGLIP PCFLSQDVQL LRIMRYYERQ 100
    QSDLDKYIIL MTLQDRNEKL FYRVLTSDVE KFMPIVYTPT VGLACQHYGL 150
    TFRRPRGLFI TIHDKGHLAT MLNSWPEDNI KAVVVTDGER ILGLGDLGCY 200
    GMGIPVGKLA LYTACGGVNP QQCLPVLLDV GTNNEELLRD PLYIGLKHQR 250
    VHGKAYDDLL DEFMQAVTDK FGINCLIQFE DFANANAFRL LNKYRNKYCM 300
    FNDDIQGTAS VAVAGILAAL RITKNKLSNH VFVFQGAGEA AMGIAHLLVM 350
    ALEKEGVPKA EATRKIWMVD SKGLIVKGRS HLNHEKEMFA QDHPEVNSLE 400
    EVVRLVKPTA IIGVAAIAGA FTEQILRDMA SFHERPIIFA LSNPTSKAEC 450
    TAEKCYRVTE GRGIFASGSP FKSVTLEDGK TFIPGQGNNA YVFPGVALGV 500
    IAGGIRHIPD EIFLLTAEQI AQEVSEQHLS QGRLYPPLST IRDVSLRIAI 550
    KVLDYAYKHN LASYYPEPKD KEAFVRSLVY TPDYDSFTLD SYTWPKEAMN 600
    VQTV 604
    Length:604
    Mass (Da):67,068
    Last modified:November 25, 2008 - v2
    Checksum:iE0E79A75F3CAC524
    GO
    Isoform 2 (identifier: Q16798-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         309-342: ASVAVAGILAALRITKNKLSNHVFVFQGAGEAAM → TCHTFSCPWHLWAQVMFQHIPGPMGFSEWLPRNS
         343-604: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:342
    Mass (Da):38,626
    Checksum:iBC18F52DF85F2BB8
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti95 – 951R → G in AAH22472. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti85 – 851S → G.1 Publication
    Corresponds to variant rs17856661 [ dbSNP | Ensembl ].
    VAR_047369
    Natural varianti324 – 3241K → N.2 Publications
    Corresponds to variant rs1042780 [ dbSNP | Ensembl ].
    VAR_047370

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei309 – 34234ASVAV…GEAAM → TCHTFSCPWHLWAQVMFQHI PGPMGFSEWLPRNS in isoform 2. 1 PublicationVSP_056626Add
    BLAST
    Alternative sequencei343 – 604262Missing in isoform 2. 1 PublicationVSP_056627Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X79440 mRNA. Translation: CAA55956.1.
    AK300974 mRNA. Translation: BAH13386.1.
    AP001148 Genomic DNA. No translation available.
    AP001831 Genomic DNA. No translation available.
    AP002492 Genomic DNA. No translation available.
    BC022472 mRNA. Translation: AAH22472.1.
    CCDSiCCDS8277.1.
    PIRiS53351.
    RefSeqiNP_001014811.1. NM_001014811.1.
    NP_001155058.1. NM_001161586.1.
    NP_006671.2. NM_006680.2.
    XP_005273774.1. XM_005273717.1.
    UniGeneiHs.199743.

    Genome annotation databases

    EnsembliENST00000393324; ENSP00000376998; ENSG00000151376.
    ENST00000526504; ENSP00000433636; ENSG00000151376.
    ENST00000543262; ENSP00000440246; ENSG00000151376.
    GeneIDi10873.
    KEGGihsa:10873.
    UCSCiuc001pbz.3. human.

    Polymorphism databases

    DMDMi215274021.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X79440 mRNA. Translation: CAA55956.1 .
    AK300974 mRNA. Translation: BAH13386.1 .
    AP001148 Genomic DNA. No translation available.
    AP001831 Genomic DNA. No translation available.
    AP002492 Genomic DNA. No translation available.
    BC022472 mRNA. Translation: AAH22472.1 .
    CCDSi CCDS8277.1.
    PIRi S53351.
    RefSeqi NP_001014811.1. NM_001014811.1.
    NP_001155058.1. NM_001161586.1.
    NP_006671.2. NM_006680.2.
    XP_005273774.1. XM_005273717.1.
    UniGenei Hs.199743.

    3D structure databases

    ProteinModelPortali Q16798.
    SMRi Q16798. Positions 48-602.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116081. 1 interaction.
    STRINGi 9606.ENSP00000352657.

    Chemistry

    ChEMBLi CHEMBL6182.
    DrugBanki DB00157. NADH.

    PTM databases

    PhosphoSitei Q16798.

    Polymorphism databases

    DMDMi 215274021.

    Proteomic databases

    MaxQBi Q16798.
    PaxDbi Q16798.
    PRIDEi Q16798.

    Protocols and materials databases

    DNASUi 10873.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000393324 ; ENSP00000376998 ; ENSG00000151376 .
    ENST00000526504 ; ENSP00000433636 ; ENSG00000151376 .
    ENST00000543262 ; ENSP00000440246 ; ENSG00000151376 .
    GeneIDi 10873.
    KEGGi hsa:10873.
    UCSCi uc001pbz.3. human.

    Organism-specific databases

    CTDi 10873.
    GeneCardsi GC11M086152.
    H-InvDB HIX0010004.
    HGNCi HGNC:6985. ME3.
    HPAi HPA038473.
    MIMi 604626. gene.
    neXtProti NX_Q16798.
    PharmGKBi PA30725.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0281.
    HOGENOMi HOG000042486.
    HOVERGENi HBG000746.
    InParanoidi Q16798.
    KOi K00029.
    OMAi DFAYKHN.
    OrthoDBi EOG7G4QF0.
    PhylomeDBi Q16798.
    TreeFami TF300537.

    Enzyme and pathway databases

    SABIO-RK Q16798.

    Miscellaneous databases

    ChiTaRSi ME3. human.
    GenomeRNAii 10873.
    NextBioi 41285.
    PROi Q16798.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q16798.
    Bgeei Q16798.
    CleanExi HS_ME3.
    Genevestigatori Q16798.

    Family and domain databases

    Gene3Di 3.40.50.10380. 1 hit.
    3.40.50.720. 1 hit.
    InterProi IPR015884. Malic_enzyme_CS.
    IPR012301. Malic_N_dom.
    IPR012302. Malic_NAD-bd.
    IPR001891. Malic_OxRdtase.
    IPR016040. NAD(P)-bd_dom.
    [Graphical view ]
    Pfami PF00390. malic. 1 hit.
    PF03949. Malic_M. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF000106. ME. 1 hit.
    PRINTSi PR00072. MALOXRDTASE.
    SMARTi SM00919. Malic_M. 1 hit.
    [Graphical view ]
    PROSITEi PS00331. MALIC_ENZYMES. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Purification, cDNA cloning and heterologous expression of the human mitochondrial NADP(+)-dependent malic enzyme."
      Loeber G., Maurer-Fogy I., Schwendenwein R.
      Biochem. J. 304:687-692(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ASN-324.
      Tissue: Hippocampus.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Small intestine.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLY-85 AND ASN-324.
      Tissue: Brain.

    Entry informationi

    Entry nameiMAON_HUMAN
    AccessioniPrimary (citable) accession number: Q16798
    Secondary accession number(s): B7Z6V0, Q8TBJ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 131 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3