Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q16798

- MAON_HUMAN

UniProt

Q16798 - MAON_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

NADP-dependent malic enzyme, mitochondrial

Gene

ME3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

(S)-malate + NADP+ = pyruvate + CO2 + NADPH.
Oxaloacetate = pyruvate + CO2.

Cofactori

Divalent metal cations. Prefers magnesium or manganese (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei137 – 1371Proton donorBy similarity
Binding sitei190 – 1901NADBy similarity
Active sitei208 – 2081Proton acceptorBy similarity
Metal bindingi280 – 2801Divalent metal cationBy similarity
Metal bindingi281 – 2811Divalent metal cationBy similarity
Metal bindingi304 – 3041Divalent metal cationBy similarity
Binding sitei304 – 3041NADBy similarity
Sitei304 – 3041Important for activityBy similarity
Binding sitei443 – 4431NADBy similarity

GO - Molecular functioni

  1. cofactor binding Source: UniProtKB
  2. malate dehydrogenase (decarboxylating) (NAD+) activity Source: InterPro
  3. malate dehydrogenase (decarboxylating) (NADP+) activity Source: UniProtKB
  4. malic enzyme activity Source: UniProtKB
  5. metal ion binding Source: UniProtKB-KW
  6. NAD binding Source: InterPro
  7. oxaloacetate decarboxylase activity Source: UniProtKB-EC

GO - Biological processi

  1. aerobic respiration Source: UniProtKB
  2. malate metabolic process Source: UniProtKB
  3. oxidation-reduction process Source: UniProtKB
  4. oxygen metabolic process Source: UniProtKB
  5. pyruvate metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

Metal-binding, NADP

Enzyme and pathway databases

SABIO-RKQ16798.

Names & Taxonomyi

Protein namesi
Recommended name:
NADP-dependent malic enzyme, mitochondrial (EC:1.1.1.40)
Short name:
NADP-ME
Alternative name(s):
Malic enzyme 3
Gene namesi
Name:ME3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:6985. ME3.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30725.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini? – 604NADP-dependent malic enzyme, mitochondrialPRO_0000018539
Transit peptidei1 – ?MitochondrionSequence Analysis

Proteomic databases

MaxQBiQ16798.
PaxDbiQ16798.
PRIDEiQ16798.

PTM databases

PhosphoSiteiQ16798.

Expressioni

Tissue specificityi

Expressed predominantly in organs with a low-division rate.

Gene expression databases

BgeeiQ16798.
CleanExiHS_ME3.
ExpressionAtlasiQ16798. baseline and differential.
GenevestigatoriQ16798.

Organism-specific databases

HPAiHPA038473.

Interactioni

Protein-protein interaction databases

BioGridi116081. 1 interaction.
STRINGi9606.ENSP00000352657.

Structurei

3D structure databases

ProteinModelPortaliQ16798.
SMRiQ16798. Positions 48-602.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the malic enzymes family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG0281.
GeneTreeiENSGT00390000000754.
HOGENOMiHOG000042486.
HOVERGENiHBG000746.
InParanoidiQ16798.
KOiK00029.
OMAiDFAYKHN.
OrthoDBiEOG7G4QF0.
PhylomeDBiQ16798.
TreeFamiTF300537.

Family and domain databases

Gene3Di3.40.50.10380. 1 hit.
3.40.50.720. 1 hit.
InterProiIPR015884. Malic_enzyme_CS.
IPR012301. Malic_N_dom.
IPR012302. Malic_NAD-bd.
IPR001891. Malic_OxRdtase.
IPR016040. NAD(P)-bd_dom.
[Graphical view]
PfamiPF00390. malic. 1 hit.
PF03949. Malic_M. 1 hit.
[Graphical view]
PIRSFiPIRSF000106. ME. 1 hit.
PRINTSiPR00072. MALOXRDTASE.
SMARTiSM00919. Malic_M. 1 hit.
[Graphical view]
PROSITEiPS00331. MALIC_ENZYMES. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q16798-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAALGTGTR LAPWPGRACG ALPRWTPTAP AQGCHSKPGP ARPVPLKKRG
60 70 80 90 100
YDVTRNPHLN KGMAFTLEER LQLGIHGLIP PCFLSQDVQL LRIMRYYERQ
110 120 130 140 150
QSDLDKYIIL MTLQDRNEKL FYRVLTSDVE KFMPIVYTPT VGLACQHYGL
160 170 180 190 200
TFRRPRGLFI TIHDKGHLAT MLNSWPEDNI KAVVVTDGER ILGLGDLGCY
210 220 230 240 250
GMGIPVGKLA LYTACGGVNP QQCLPVLLDV GTNNEELLRD PLYIGLKHQR
260 270 280 290 300
VHGKAYDDLL DEFMQAVTDK FGINCLIQFE DFANANAFRL LNKYRNKYCM
310 320 330 340 350
FNDDIQGTAS VAVAGILAAL RITKNKLSNH VFVFQGAGEA AMGIAHLLVM
360 370 380 390 400
ALEKEGVPKA EATRKIWMVD SKGLIVKGRS HLNHEKEMFA QDHPEVNSLE
410 420 430 440 450
EVVRLVKPTA IIGVAAIAGA FTEQILRDMA SFHERPIIFA LSNPTSKAEC
460 470 480 490 500
TAEKCYRVTE GRGIFASGSP FKSVTLEDGK TFIPGQGNNA YVFPGVALGV
510 520 530 540 550
IAGGIRHIPD EIFLLTAEQI AQEVSEQHLS QGRLYPPLST IRDVSLRIAI
560 570 580 590 600
KVLDYAYKHN LASYYPEPKD KEAFVRSLVY TPDYDSFTLD SYTWPKEAMN

VQTV
Length:604
Mass (Da):67,068
Last modified:November 25, 2008 - v2
Checksum:iE0E79A75F3CAC524
GO
Isoform 2 (identifier: Q16798-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     309-342: ASVAVAGILAALRITKNKLSNHVFVFQGAGEAAM → TCHTFSCPWHLWAQVMFQHIPGPMGFSEWLPRNS
     343-604: Missing.

Note: No experimental confirmation available.

Show »
Length:342
Mass (Da):38,626
Checksum:iBC18F52DF85F2BB8
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti95 – 951R → G in AAH22472. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti85 – 851S → G.1 Publication
Corresponds to variant rs17856661 [ dbSNP | Ensembl ].
VAR_047369
Natural varianti324 – 3241K → N.2 Publications
Corresponds to variant rs1042780 [ dbSNP | Ensembl ].
VAR_047370

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei309 – 34234ASVAV…GEAAM → TCHTFSCPWHLWAQVMFQHI PGPMGFSEWLPRNS in isoform 2. 1 PublicationVSP_056626Add
BLAST
Alternative sequencei343 – 604262Missing in isoform 2. 1 PublicationVSP_056627Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X79440 mRNA. Translation: CAA55956.1.
AK300974 mRNA. Translation: BAH13386.1.
AP001148 Genomic DNA. No translation available.
AP001831 Genomic DNA. No translation available.
AP002492 Genomic DNA. No translation available.
BC022472 mRNA. Translation: AAH22472.1.
CCDSiCCDS8277.1. [Q16798-1]
PIRiS53351.
RefSeqiNP_001014811.1. NM_001014811.1.
NP_001155058.1. NM_001161586.1.
NP_006671.2. NM_006680.2.
XP_005273774.1. XM_005273717.1.
UniGeneiHs.199743.

Genome annotation databases

EnsembliENST00000393324; ENSP00000376998; ENSG00000151376. [Q16798-1]
ENST00000526504; ENSP00000433636; ENSG00000151376. [Q16798-2]
ENST00000543262; ENSP00000440246; ENSG00000151376. [Q16798-1]
GeneIDi10873.
KEGGihsa:10873.
UCSCiuc001pbz.3. human. [Q16798-1]

Polymorphism databases

DMDMi215274021.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X79440 mRNA. Translation: CAA55956.1 .
AK300974 mRNA. Translation: BAH13386.1 .
AP001148 Genomic DNA. No translation available.
AP001831 Genomic DNA. No translation available.
AP002492 Genomic DNA. No translation available.
BC022472 mRNA. Translation: AAH22472.1 .
CCDSi CCDS8277.1. [Q16798-1 ]
PIRi S53351.
RefSeqi NP_001014811.1. NM_001014811.1.
NP_001155058.1. NM_001161586.1.
NP_006671.2. NM_006680.2.
XP_005273774.1. XM_005273717.1.
UniGenei Hs.199743.

3D structure databases

ProteinModelPortali Q16798.
SMRi Q16798. Positions 48-602.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116081. 1 interaction.
STRINGi 9606.ENSP00000352657.

Chemistry

ChEMBLi CHEMBL6182.

PTM databases

PhosphoSitei Q16798.

Polymorphism databases

DMDMi 215274021.

Proteomic databases

MaxQBi Q16798.
PaxDbi Q16798.
PRIDEi Q16798.

Protocols and materials databases

DNASUi 10873.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000393324 ; ENSP00000376998 ; ENSG00000151376 . [Q16798-1 ]
ENST00000526504 ; ENSP00000433636 ; ENSG00000151376 . [Q16798-2 ]
ENST00000543262 ; ENSP00000440246 ; ENSG00000151376 . [Q16798-1 ]
GeneIDi 10873.
KEGGi hsa:10873.
UCSCi uc001pbz.3. human. [Q16798-1 ]

Organism-specific databases

CTDi 10873.
GeneCardsi GC11M086152.
H-InvDB HIX0010004.
HGNCi HGNC:6985. ME3.
HPAi HPA038473.
MIMi 604626. gene.
neXtProti NX_Q16798.
PharmGKBi PA30725.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0281.
GeneTreei ENSGT00390000000754.
HOGENOMi HOG000042486.
HOVERGENi HBG000746.
InParanoidi Q16798.
KOi K00029.
OMAi DFAYKHN.
OrthoDBi EOG7G4QF0.
PhylomeDBi Q16798.
TreeFami TF300537.

Enzyme and pathway databases

SABIO-RK Q16798.

Miscellaneous databases

ChiTaRSi ME3. human.
GenomeRNAii 10873.
NextBioi 35480068.
PROi Q16798.
SOURCEi Search...

Gene expression databases

Bgeei Q16798.
CleanExi HS_ME3.
ExpressionAtlasi Q16798. baseline and differential.
Genevestigatori Q16798.

Family and domain databases

Gene3Di 3.40.50.10380. 1 hit.
3.40.50.720. 1 hit.
InterProi IPR015884. Malic_enzyme_CS.
IPR012301. Malic_N_dom.
IPR012302. Malic_NAD-bd.
IPR001891. Malic_OxRdtase.
IPR016040. NAD(P)-bd_dom.
[Graphical view ]
Pfami PF00390. malic. 1 hit.
PF03949. Malic_M. 1 hit.
[Graphical view ]
PIRSFi PIRSF000106. ME. 1 hit.
PRINTSi PR00072. MALOXRDTASE.
SMARTi SM00919. Malic_M. 1 hit.
[Graphical view ]
PROSITEi PS00331. MALIC_ENZYMES. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Purification, cDNA cloning and heterologous expression of the human mitochondrial NADP(+)-dependent malic enzyme."
    Loeber G., Maurer-Fogy I., Schwendenwein R.
    Biochem. J. 304:687-692(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ASN-324.
    Tissue: Hippocampus.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Small intestine.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLY-85 AND ASN-324.
    Tissue: Brain.

Entry informationi

Entry nameiMAON_HUMAN
AccessioniPrimary (citable) accession number: Q16798
Secondary accession number(s): B7Z6V0, Q8TBJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: October 29, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3