Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Diacylglycerol kinase delta

Gene

DGKD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as signaling molecule.1 Publication
Isoform 2 may be involved in cell growth and tumorigenesis. Involved in clathrin-dependent endocytosis.1 Publication

Catalytic activityi

ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate.

Enzyme regulationi

Partially inhibited by phosphatidylserine.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri163 – 213Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd BLAST51
Zinc fingeri235 – 286Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd BLAST52

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • diacylglycerol binding Source: UniProtKB
  • diacylglycerol kinase activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • protein heterodimerization activity Source: MGI
  • protein homodimerization activity Source: MGI

GO - Biological processi

  • cell growth Source: UniProtKB
  • diacylglycerol metabolic process Source: UniProtKB
  • endocytosis Source: UniProtKB-KW
  • epidermal growth factor receptor signaling pathway Source: UniProtKB
  • lipid phosphorylation Source: BHF-UCL
  • multicellular organism development Source: UniProtKB
  • platelet activation Source: Reactome
  • protein homooligomerization Source: UniProtKB
  • protein kinase C-activating G-protein coupled receptor signaling pathway Source: UniProtKB
  • protein transport Source: UniProtKB-KW
  • response to organic substance Source: UniProtKB
  • second-messenger-mediated signaling Source: UniProtKB
  • signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Endocytosis, Protein transport, Transport

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS01226-MONOMER.
BRENDAi2.7.1.107. 2681.
ReactomeiR-HSA-114508. Effects of PIP2 hydrolysis.
SIGNORiQ16760.

Chemistry databases

SwissLipidsiSLP:000000939. [Q16760-2]

Names & Taxonomyi

Protein namesi
Recommended name:
Diacylglycerol kinase delta (EC:2.7.1.107)
Short name:
DAG kinase delta
Alternative name(s):
130 kDa diacylglycerol kinase
Diglyceride kinase delta
Short name:
DGK-delta
Gene namesi
Name:DGKD
Synonyms:KIAA0145
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:2851. DGKD.

Subcellular locationi

Isoform 2 :
Isoform 1 :

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytoplasmic, membrane-bounded vesicle Source: MGI
  • nucleus Source: BHF-UCL
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi369F → A: Reduces interaction with AP2A2; when associated with A-372. 1 Publication1
Mutagenesisi372F → A: Reduces interaction with AP2A2; when associated with A-369. 1 Publication1
Mutagenesisi748F → A: Reduces interaction with AP2A2. 1 Publication1

Organism-specific databases

DisGeNETi8527.
OpenTargetsiENSG00000077044.
ENSG00000280873.
PharmGKBiPA27312.

Chemistry databases

ChEMBLiCHEMBL1075120.
DrugBankiDB00144. Phosphatidylserine.

Polymorphism and mutation databases

BioMutaiDGKD.
DMDMi116241328.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002184621 – 1214Diacylglycerol kinase deltaAdd BLAST1214

Post-translational modificationi

Isoform 1 H domain is phosphorylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ16760.
PaxDbiQ16760.
PeptideAtlasiQ16760.
PRIDEiQ16760.

PTM databases

iPTMnetiQ16760.
PhosphoSitePlusiQ16760.

Expressioni

Tissue specificityi

Isoform 2 is ubiquitously expressed also in tumor tissues. Isoform 1 is expressed in ovary, spleen and some tumor-derived cells.1 Publication

Gene expression databases

BgeeiENSG00000077044.
CleanExiHS_DGKD.
ExpressionAtlasiQ16760. baseline and differential.
GenevisibleiQ16760. HS.

Organism-specific databases

HPAiHPA049101.

Interactioni

Subunit structurei

The two isoforms are able to form homo- and hetero-oligomer structures (at least tetramers). Isoform 2 interacts with AP2A2.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DYSFO759233EBI-719333,EBI-2799016

GO - Molecular functioni

  • protein heterodimerization activity Source: MGI
  • protein homodimerization activity Source: MGI

Protein-protein interaction databases

BioGridi114097. 10 interactors.
DIPiDIP-29646N.
IntActiQ16760. 9 interactors.
MINTiMINT-87709.
STRINGi9606.ENSP00000264057.

Structurei

Secondary structure

11214
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi238 – 241Combined sources4
Beta strandi250 – 252Combined sources3
Turni259 – 261Combined sources3
Beta strandi265 – 270Combined sources6
Helixi276 – 281Combined sources6
Helixi1142 – 1144Combined sources3
Helixi1147 – 1156Combined sources10
Helixi1160 – 1162Combined sources3
Helixi1163 – 1168Combined sources6
Helixi1173 – 1176Combined sources4
Helixi1181 – 1186Combined sources6
Helixi1192 – 1206Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1R79NMR-A216-286[»]
3BQ7X-ray2.90A/B/C/D/E/F1141-1208[»]
ProteinModelPortaliQ16760.
SMRiQ16760.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ16760.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini53 – 146PHPROSITE-ProRule annotationAdd BLAST94
Domaini317 – 451DAGKcPROSITE-ProRule annotationAdd BLAST135
Domaini1145 – 1208SAMPROSITE-ProRule annotationAdd BLAST64

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi8 – 36Pro-richAdd BLAST29

Sequence similaritiesi

Contains 1 DAGKc domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 2 phorbol-ester/DAG-type zinc fingers.PROSITE-ProRule annotation
Contains 1 SAM (sterile alpha motif) domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri163 – 213Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd BLAST51
Zinc fingeri235 – 286Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd BLAST52

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1170. Eukaryota.
ENOG410XSJR. LUCA.
GeneTreeiENSGT00760000119050.
HOGENOMiHOG000234676.
HOVERGENiHBG051346.
InParanoidiQ16760.
KOiK00901.
OMAiENLEYYT.
OrthoDBiEOG091G00SK.
PhylomeDBiQ16760.
TreeFamiTF313104.

Family and domain databases

CDDicd00029. C1. 2 hits.
Gene3Di1.10.150.50. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000756. Diacylglycerol_kin_accessory.
IPR001206. Diacylglycerol_kinase_cat_dom.
IPR016064. NAD/diacylglycerol_kinase.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PfamiPF00130. C1_1. 2 hits.
PF00609. DAGK_acc. 1 hit.
PF00781. DAGK_cat. 1 hit.
PF00169. PH. 1 hit.
PF07647. SAM_2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 2 hits.
SM00045. DAGKa. 1 hit.
SM00046. DAGKc. 1 hit.
SM00233. PH. 1 hit.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF111331. SSF111331. 2 hits.
SSF47769. SSF47769. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50146. DAGK. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50105. SAM_DOMAIN. 1 hit.
PS00479. ZF_DAG_PE_1. 2 hits.
PS50081. ZF_DAG_PE_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q16760-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAGAPPP GPPQPPPPPP PEESSDSEPE AEPGSPQKLI RKVSTSGQIR
60 70 80 90 100
QKTIIKEGML TKQNNSFQRS KRRYFKLRGR TLYYAKTAKS IIFDEVDLTD
110 120 130 140 150
ASVAESSTKN VNNSFTVITP CRKLILCADN RKEMEDWIAA LKTVQNREHF
160 170 180 190 200
EPTQYSMDHF SGMHNWYACS HARPTYCNVC REALSGVTSH GLSCEVCKFK
210 220 230 240 250
AHKRCAVRAT NNCKWTTLAS IGKDIIEDAD GIAMPHQWLE GNLPVSAKCT
260 270 280 290 300
VCDKTCGSVL RLQDWRCLWC KAMVHTSCKE SLLTKCPLGL CKVSVIPPTA
310 320 330 340 350
LNSIDSDGFW KASCPPSCTS PLLVFVNSKS GDNQGVKFLR RFKQLLNPAQ
360 370 380 390 400
VFDLMNGGPH LGLRLFQKFD TFRILVCGGD GSVGWVLSEI DSLNLHKQCQ
410 420 430 440 450
LGVLPLGTGN DLARVLGWGS ACDDDTQLPQ ILEKLERAST KMLDRWSVMA
460 470 480 490 500
YEAKLPRQAS SSTVTEDFSE DSEVQQILFY EDSVAAHLSK ILTSDQHSVV
510 520 530 540 550
ISSAKVLCET VKDFVARVGK AYEKTTESSE ESEVMAKKCS VLKEKLDSLL
560 570 580 590 600
KTLDDESQAS SSLPNPPPTI AEEAEDGDGS GSICGSTGDR LVASACPARP
610 620 630 640 650
QIFRPREQLM LRANSLKKAI RQIIEHTEKA VDEQNAQTQE QEGFVLGLSE
660 670 680 690 700
SEEKMDHRVC PPLSHSESFG VPKGRSQRKV SKSPCEKLIS KGSLSLGSSA
710 720 730 740 750
SLPPQPGSRD GLPALNTKIL YPNVRAGMSG SLPGGSVISR LLINADPFNS
760 770 780 790 800
EPETLEYYTE KCVMNNYFGI GLDAKISLDF NNKRDEHPEK CRSRTKNMMW
810 820 830 840 850
YGVLGTKELL HRTYKNLEQK VLLECDGRPI PLPSLQGIAV LNIPSYAGGT
860 870 880 890 900
NFWGGTKEDD TFAAPSFDDK ILEVVAVFGS MQMAVSRVIR LQHHRIAQCR
910 920 930 940 950
TVKISILGDE GVPVQVDGEA WVQPPGYIRI VHKNRAQTLT RDRAFESTLK
960 970 980 990 1000
SWEDKQKCEL PRPPSCSLHP EMLSEEEATQ MDQFGQAAGV LIHSIREIAQ
1010 1020 1030 1040 1050
SHRDMEQELA HAVNASSKSM DRVYGKPRTT EGLNCSFVLE MVNNFRALRS
1060 1070 1080 1090 1100
ETELLLSGKM ALQLDPPQKE QLGSALAEMD RQLRRLADTP WLCQSAEPGD
1110 1120 1130 1140 1150
EESVMLDLAK RSRSGKFRLV TKFKKEKNNK NKEAHSSLGA PVHLWGTEEV
1160 1170 1180 1190 1200
AAWLEHLSLC EYKDIFTRHD IRGSELLHLE RRDLKDLGVT KVGHMKRILC
1210
GIKELSRSAP AVEA
Length:1,214
Mass (Da):134,525
Last modified:October 17, 2006 - v4
Checksum:iED114429096D2112
GO
Isoform 1 (identifier: Q16760-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQK → MNMFLYFQ

Show »
Length:1,170
Mass (Da):130,326
Checksum:i00B7946AE15BC0A3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti511V → P in BAA11134 (PubMed:8626538).Curated1
Sequence conflicti828 – 834RPIPLPS → DPSHSPV in BAA11134 (PubMed:8626538).Curated7
Sequence conflicti960L → V in BAC11809 (PubMed:12200442).Curated1
Sequence conflicti960L → V in BAA11134 (PubMed:8626538).Curated1
Sequence conflicti1054Missing in BAA11134 (PubMed:8626538).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128911 – 52MAAAA…QIRQK → MNMFLYFQ in isoform 1. 2 PublicationsAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB078966 mRNA. Translation: BAC11809.1.
D63479 mRNA. Translation: BAA09766.3.
D73409 mRNA. Translation: BAA11134.1.
BC006561 mRNA. Translation: AAH06561.1.
CCDSiCCDS2504.1. [Q16760-1]
CCDS46546.1. [Q16760-2]
RefSeqiNP_003639.2. NM_003648.2. [Q16760-2]
NP_690618.2. NM_152879.2. [Q16760-1]
UniGeneiHs.471675.

Genome annotation databases

EnsembliENST00000264057; ENSP00000264057; ENSG00000077044. [Q16760-1]
ENST00000409813; ENSP00000386455; ENSG00000077044. [Q16760-2]
ENST00000628356; ENSP00000487220; ENSG00000280873. [Q16760-1]
ENST00000628527; ENSP00000487423; ENSG00000280873. [Q16760-2]
GeneIDi8527.
KEGGihsa:8527.
UCSCiuc002vui.2. human. [Q16760-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB078966 mRNA. Translation: BAC11809.1.
D63479 mRNA. Translation: BAA09766.3.
D73409 mRNA. Translation: BAA11134.1.
BC006561 mRNA. Translation: AAH06561.1.
CCDSiCCDS2504.1. [Q16760-1]
CCDS46546.1. [Q16760-2]
RefSeqiNP_003639.2. NM_003648.2. [Q16760-2]
NP_690618.2. NM_152879.2. [Q16760-1]
UniGeneiHs.471675.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1R79NMR-A216-286[»]
3BQ7X-ray2.90A/B/C/D/E/F1141-1208[»]
ProteinModelPortaliQ16760.
SMRiQ16760.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114097. 10 interactors.
DIPiDIP-29646N.
IntActiQ16760. 9 interactors.
MINTiMINT-87709.
STRINGi9606.ENSP00000264057.

Chemistry databases

ChEMBLiCHEMBL1075120.
DrugBankiDB00144. Phosphatidylserine.
SwissLipidsiSLP:000000939. [Q16760-2]

PTM databases

iPTMnetiQ16760.
PhosphoSitePlusiQ16760.

Polymorphism and mutation databases

BioMutaiDGKD.
DMDMi116241328.

Proteomic databases

MaxQBiQ16760.
PaxDbiQ16760.
PeptideAtlasiQ16760.
PRIDEiQ16760.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264057; ENSP00000264057; ENSG00000077044. [Q16760-1]
ENST00000409813; ENSP00000386455; ENSG00000077044. [Q16760-2]
ENST00000628356; ENSP00000487220; ENSG00000280873. [Q16760-1]
ENST00000628527; ENSP00000487423; ENSG00000280873. [Q16760-2]
GeneIDi8527.
KEGGihsa:8527.
UCSCiuc002vui.2. human. [Q16760-1]

Organism-specific databases

CTDi8527.
DisGeNETi8527.
GeneCardsiDGKD.
H-InvDBHIX0002934.
HGNCiHGNC:2851. DGKD.
HPAiHPA049101.
MIMi601826. gene.
neXtProtiNX_Q16760.
OpenTargetsiENSG00000077044.
ENSG00000280873.
PharmGKBiPA27312.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1170. Eukaryota.
ENOG410XSJR. LUCA.
GeneTreeiENSGT00760000119050.
HOGENOMiHOG000234676.
HOVERGENiHBG051346.
InParanoidiQ16760.
KOiK00901.
OMAiENLEYYT.
OrthoDBiEOG091G00SK.
PhylomeDBiQ16760.
TreeFamiTF313104.

Enzyme and pathway databases

BioCyciZFISH:HS01226-MONOMER.
BRENDAi2.7.1.107. 2681.
ReactomeiR-HSA-114508. Effects of PIP2 hydrolysis.
SIGNORiQ16760.

Miscellaneous databases

ChiTaRSiDGKD. human.
EvolutionaryTraceiQ16760.
GeneWikiiDGKD.
GenomeRNAii8527.
PROiQ16760.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000077044.
CleanExiHS_DGKD.
ExpressionAtlasiQ16760. baseline and differential.
GenevisibleiQ16760. HS.

Family and domain databases

CDDicd00029. C1. 2 hits.
Gene3Di1.10.150.50. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000756. Diacylglycerol_kin_accessory.
IPR001206. Diacylglycerol_kinase_cat_dom.
IPR016064. NAD/diacylglycerol_kinase.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PfamiPF00130. C1_1. 2 hits.
PF00609. DAGK_acc. 1 hit.
PF00781. DAGK_cat. 1 hit.
PF00169. PH. 1 hit.
PF07647. SAM_2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 2 hits.
SM00045. DAGKa. 1 hit.
SM00046. DAGKc. 1 hit.
SM00233. PH. 1 hit.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF111331. SSF111331. 2 hits.
SSF47769. SSF47769. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50146. DAGK. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50105. SAM_DOMAIN. 1 hit.
PS00479. ZF_DAG_PE_1. 2 hits.
PS50081. ZF_DAG_PE_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDGKD_HUMAN
AccessioniPrimary (citable) accession number: Q16760
Secondary accession number(s): Q14158, Q6PK55, Q8NG53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 183 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.