Reviewed,
UniProtKB/Swiss-Prot Q16760 (DGKD_HUMAN)
Last modified
November 3, 2009.
Version 110.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Diacylglycerol kinase delta Short name=DAG kinase delta EC=2.7.1.107 Alternative name(s): Diglyceride kinase delta Short name=DGK-delta 130 kDa diacylglycerol kinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1214 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May function as signaling molecule. Isoform 2 may be involved in cell growth and tumorigenesis. Isoform 2 is involved in clathrin-dependent endocytosis. Ref.7 |
| Catalytic activity | ATP + 1,2-diacylglycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate. |
| Enzyme regulation | Partially inhibited by phosphatidylserine. |
| Subunit structure | The two isoforms are able to form homo- and hetero-oligomer structures (at least tetramers). Isoform 2 interacts with AP2A2. Ref.7 Ref.1 |
| Subcellular location | Isoform 1: Membrane; Peripheral membrane protein. Ref.1 |
| Tissue specificity | Isoform 2 is ubiquitously expressed also in tumor tissues. Isoform 1 is expressed in ovary, spleen and some tumor-derived cells. Ref.1 |
| Post-translational modification | |
| Sequence similarities | Belongs to the eukaryotic diacylglycerol kinase family. Contains 1 DAGKc domain. Contains 1 PH domain. Contains 2 phorbol-ester/DAG-type zinc fingers. Contains 1 SAM (sterile alpha motif) domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q16760-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q16760-2) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQK → MNMFLYFQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1214 | 1214 | Diacylglycerol kinase delta | PRO_0000218462 | ||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||
| Domain | 53 – 146 | 94 | PH | |||||||||||||||||||||||||||||
| Domain | 317 – 451 | 135 | DAGKc | |||||||||||||||||||||||||||||
| Domain | 1145 – 1208 | 64 | SAM | |||||||||||||||||||||||||||||
| Zinc finger | 163 – 213 | 51 | Phorbol-ester/DAG-type 1 | |||||||||||||||||||||||||||||
| Zinc finger | 235 – 286 | 52 | Phorbol-ester/DAG-type 2 | |||||||||||||||||||||||||||||
| Compositional bias | 8 – 36 | 29 | Pro-rich | |||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 52 | 52 | MAAAA…QIRQK → MNMFLYFQ in isoform 1. | VSP_012891 | ||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||
| Mutagenesis | 369 | 1 | F → A: Reduces interaction with AP2A2; when associated with A-372. Ref.7 | |||||||||||||||||||||||||||||
| Mutagenesis | 372 | 1 | F → A: Reduces interaction with AP2A2; when associated with A-369. Ref.7 | |||||||||||||||||||||||||||||
| Mutagenesis | 748 | 1 | F → A: Reduces interaction with AP2A2. Ref.7 | |||||||||||||||||||||||||||||
| Sequence conflict | 511 | 1 | V → P in BAA11134. Ref.4 | |||||||||||||||||||||||||||||
| Sequence conflict | 828 – 834 | 7 | RPIPLPS → DPSHSPV in BAA11134. Ref.4 | |||||||||||||||||||||||||||||
| Sequence conflict | 960 | 1 | L → V in BAC11809. Ref.1 | |||||||||||||||||||||||||||||
| Sequence conflict | 960 | 1 | L → V in BAA11134. Ref.4 | |||||||||||||||||||||||||||||
| Sequence conflict | 1054 | 1 | Missing in BAA11134. Ref.4 | |||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||
| Beta strand | 238 – 241 | 4 | ||||||||||||||||||||||||||||||
| Beta strand | 250 – 252 | 3 | ||||||||||||||||||||||||||||||
| Turn | 259 – 261 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 265 – 270 | 6 | ||||||||||||||||||||||||||||||
| Helix | 276 – 281 | 6 | ||||||||||||||||||||||||||||||
| Helix | 1142 – 1144 | 3 | ||||||||||||||||||||||||||||||
| Helix | 1147 – 1156 | 10 | ||||||||||||||||||||||||||||||
| Helix | 1160 – 1162 | 3 | ||||||||||||||||||||||||||||||
| Helix | 1163 – 1168 | 6 | ||||||||||||||||||||||||||||||
| Helix | 1173 – 1176 | 4 | ||||||||||||||||||||||||||||||
| Helix | 1181 – 1186 | 6 | ||||||||||||||||||||||||||||||
| Helix | 1192 – 1206 | 15 | ||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Alternative splicing of the human diacylglycerol kinase delta gene generates two isoforms differing in their expression patterns and in regulatory functions." Sakane F., Imai S., Yamada K., Murakami T., Tsushima S., Kanoh H. J. Biol. Chem. 277:43519-43526(2002) [PubMed: 12200442] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, SUBUNIT, TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N. DNA Res. 2:167-174(1995) [PubMed: 8590280] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-1214 (ISOFORM 2). Tissue: Bone marrow. |
| [3] | Ohara O., Nagase T., Kikuno R., Nomura N. Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [4] | "Molecular cloning of a novel diacylglycerol kinase isozyme with a pleckstrin homology domain and a C-terminal tail similar to those of the EPH family of protein-tyrosine kinases." Sakane F., Imai S., Kai M., Wada I., Kanoh H. J. Biol. Chem. 271:8394-8401(1996) [PubMed: 8626538] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 45-1214 (ISOFORM 1). Tissue: Hepatoma and Testis. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1068-1214. Tissue: Lymph. |
| [6] | "Phorbol ester-regulated oligomerization of diacylglycerol kinase delta linked to its phosphorylation and translocation." Imai S., Sakane F., Kanoh H. J. Biol. Chem. 277:35323-35332(2002) [PubMed: 12084710] [Abstract] Cited for: PHOSPHORYLATION. |
| [7] | "Regulation of clathrin-dependent endocytosis by diacylglycerol kinase delta: importance of kinase activity and binding to AP2alpha." Kawasaki T., Kobayashi T., Ueyama T., Shirai Y., Saito N. Biochem. J. 409:471-479(2008) [PubMed: 17880279] [Abstract] Cited for: FUNCTION, INTERACTION WITH AP2A2, MUTAGENESIS OF PHE-369; PHE-372 AND PHE-748. |
| [8] | "Solution structure of the C1 domain of the human diacylglycerol kinase delta." RIKEN structural genomics initiative (RSGI) Submitted (APR-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 216-286. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AB078966 mRNA. Translation: BAC11809.1. D63479 mRNA. Translation: BAA09766.3. D73409 mRNA. Translation: BAA11134.1. BC006561 mRNA. Translation: AAH06561.1. | |||||||||||||||||||
| IPI | IPI00303136. IPI00374804. | ||||||||||||||||||
| RefSeq | NP_003639.2. NP_690618.2. | ||||||||||||||||||
| UniGene | Hs.471675 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q16760. 2 interactions. | ||||||||||||||||||
| STRING | Q16760. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q16760. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q16760. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000264057; ENSP00000264057; ENSG00000077044; Homo sapiens. [Genome view] ENST00000409813; ENSP00000386455; ENSG00000077044; Homo sapiens. [Genome view] ENST00000427930; ENSP00000407938; ENSG00000077044; Homo sapiens. [Genome view] ENST00000430834; ENSP00000390970; ENSG00000077044; Homo sapiens. [Genome view] ENST00000447484; ENSP00000395530; ENSG00000077044; Homo sapiens. [Genome view] | ||||||||||||||||||
| GeneID | 8527. | ||||||||||||||||||
| KEGG | hsa:8527. | ||||||||||||||||||
| UCSC | uc002vui.1. human. uc002vuj.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 8527. | ||||||||||||||||||
| GeneCards | GC02P233927. | ||||||||||||||||||
| H-InvDB | HIX0002934. | ||||||||||||||||||
| HGNC | HGNC:2851. DGKD. | ||||||||||||||||||
| MIM | 601826. gene. | ||||||||||||||||||
| PharmGKB | PA27312. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOGENOM | Q16760. | ||||||||||||||||||
| HOVERGEN | Q16760. | ||||||||||||||||||
| OMA | SLCEYKD. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 2.7.1.107. 247. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q16760. | ||||||||||||||||||
| Bgee | Q16760. | ||||||||||||||||||
| CleanEx | HS_DGKD. | ||||||||||||||||||
| Genevestigator | Q16760. | ||||||||||||||||||
| GermOnline | ENSG00000077044. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000756. Diacylglycerol_kinase_access. IPR001206. Diacylglycerol_kinase_cat. IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR002219. Prot_Kinase_C-like_PE/DAG_bd. IPR001660. SAM. IPR011510. SAM_2. IPR013761. SAM_type. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:1.10.150.50. SAM_type. 1 hit. | ||||||||||||||||||
| Pfam | PF00130. C1_1. 2 hits. PF00609. DAGK_acc. 1 hit. PF00781. DAGK_cat. 1 hit. PF00169. PH. 1 hit. PF07647. SAM_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProDom | PD002939. DAGKa. 1 hit. PD005043. DAGKc. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||
| SMART | SM00109. C1. 2 hits. SM00045. DAGKa. 1 hit. SM00046. DAGKc. 1 hit. SM00233. PH. 1 hit. SM00454. SAM. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50146. DAGK. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS50105. SAM_DOMAIN. 1 hit. PS00479. ZF_DAG_PE_1. 2 hits. PS50081. ZF_DAG_PE_2. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| DrugBank | DB00144. Phosphatidylserine. | ||||||||||||||||||
| NextBio | 31928. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | DGKD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16760 Secondary accession number(s): Q14158, Q6PK55, Q8NG53 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


