Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q16760

- DGKD_HUMAN

UniProt

Q16760 - DGKD_HUMAN

Protein

Diacylglycerol kinase delta

Gene

DGKD

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 161 (01 Oct 2014)
      Sequence version 4 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as signaling molecule.1 Publication
    Isoform 2 may be involved in cell growth and tumorigenesis. Involved in clathrin-dependent endocytosis.1 Publication

    Catalytic activityi

    ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate.

    Enzyme regulationi

    Partially inhibited by phosphatidylserine.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri163 – 21351Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri235 – 28652Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. diacylglycerol binding Source: UniProtKB
    3. diacylglycerol kinase activity Source: UniProtKB
    4. metal ion binding Source: UniProtKB-KW
    5. NAD+ kinase activity Source: InterPro
    6. protein binding Source: IntAct
    7. protein heterodimerization activity Source: MGI
    8. protein homodimerization activity Source: MGI

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. cell growth Source: UniProtKB
    3. diacylglycerol metabolic process Source: UniProtKB
    4. endocytosis Source: UniProtKB-KW
    5. epidermal growth factor receptor signaling pathway Source: UniProtKB
    6. multicellular organismal development Source: UniProtKB
    7. platelet activation Source: Reactome
    8. protein homooligomerization Source: UniProtKB
    9. protein kinase C-activating G-protein coupled receptor signaling pathway Source: UniProtKB
    10. protein transport Source: UniProtKB-KW
    11. response to organic substance Source: UniProtKB
    12. second-messenger-mediated signaling Source: UniProtKB
    13. signal transduction Source: UniProtKB

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Biological processi

    Endocytosis, Protein transport, Transport

    Keywords - Ligandi

    ATP-binding, Metal-binding, Nucleotide-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_2202. Effects of PIP2 hydrolysis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Diacylglycerol kinase delta (EC:2.7.1.107)
    Short name:
    DAG kinase delta
    Alternative name(s):
    130 kDa diacylglycerol kinase
    Diglyceride kinase delta
    Short name:
    DGK-delta
    Gene namesi
    Name:DGKD
    Synonyms:KIAA0145
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:2851. DGKD.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytoplasmic membrane-bounded vesicle Source: MGI
    3. plasma membrane Source: MGI

    Keywords - Cellular componenti

    Cytoplasm, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi369 – 3691F → A: Reduces interaction with AP2A2; when associated with A-372. 1 Publication
    Mutagenesisi372 – 3721F → A: Reduces interaction with AP2A2; when associated with A-369. 1 Publication
    Mutagenesisi748 – 7481F → A: Reduces interaction with AP2A2. 1 Publication

    Organism-specific databases

    PharmGKBiPA27312.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12141214Diacylglycerol kinase deltaPRO_0000218462Add
    BLAST

    Post-translational modificationi

    Isoform 1 H domain is phosphorylated.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ16760.
    PaxDbiQ16760.
    PRIDEiQ16760.

    PTM databases

    PhosphoSiteiQ16760.

    Expressioni

    Tissue specificityi

    Isoform 2 is ubiquitously expressed also in tumor tissues. Isoform 1 is expressed in ovary, spleen and some tumor-derived cells.1 Publication

    Gene expression databases

    ArrayExpressiQ16760.
    BgeeiQ16760.
    CleanExiHS_DGKD.
    GenevestigatoriQ16760.

    Organism-specific databases

    HPAiHPA049101.

    Interactioni

    Subunit structurei

    The two isoforms are able to form homo- and hetero-oligomer structures (at least tetramers). Isoform 2 interacts with AP2A2.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DYSFO759233EBI-719333,EBI-2799016

    Protein-protein interaction databases

    BioGridi114097. 7 interactions.
    DIPiDIP-29646N.
    IntActiQ16760. 6 interactions.
    MINTiMINT-87709.
    STRINGi9606.ENSP00000264057.

    Structurei

    Secondary structure

    1
    1214
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi238 – 2414
    Beta strandi250 – 2523
    Turni259 – 2613
    Beta strandi265 – 2706
    Helixi276 – 2816
    Helixi1142 – 11443
    Helixi1147 – 115610
    Helixi1160 – 11623
    Helixi1163 – 11686
    Helixi1173 – 11764
    Helixi1181 – 11866
    Helixi1192 – 120615

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1R79NMR-A216-286[»]
    3BQ7X-ray2.90A/B/C/D/E/F1141-1208[»]
    ProteinModelPortaliQ16760.
    SMRiQ16760. Positions 51-145, 216-286, 1141-1208.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ16760.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini53 – 14694PHPROSITE-ProRule annotationAdd
    BLAST
    Domaini317 – 451135DAGKcPROSITE-ProRule annotationAdd
    BLAST
    Domaini1145 – 120864SAMPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi8 – 3629Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 DAGKc domain.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 2 phorbol-ester/DAG-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 SAM (sterile alpha motif) domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri163 – 21351Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri235 – 28652Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG328046.
    HOGENOMiHOG000234676.
    HOVERGENiHBG051346.
    InParanoidiQ16760.
    KOiK00901.
    OMAiKKCSVLK.
    OrthoDBiEOG7DVD9B.
    PhylomeDBiQ16760.
    TreeFamiTF313104.

    Family and domain databases

    Gene3Di1.10.150.50. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR016064. ATP-NAD_kinase_PpnK-typ.
    IPR000756. Diacylglycerol_kin_accessory.
    IPR001206. Diacylglycerol_kinase_cat_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR001660. SAM.
    IPR013761. SAM/pointed.
    IPR011510. SAM_2.
    [Graphical view]
    PfamiPF00130. C1_1. 2 hits.
    PF00609. DAGK_acc. 1 hit.
    PF00781. DAGK_cat. 1 hit.
    PF00169. PH. 1 hit.
    PF07647. SAM_2. 1 hit.
    [Graphical view]
    SMARTiSM00109. C1. 2 hits.
    SM00045. DAGKa. 1 hit.
    SM00046. DAGKc. 1 hit.
    SM00233. PH. 1 hit.
    SM00454. SAM. 1 hit.
    [Graphical view]
    SUPFAMiSSF111331. SSF111331. 2 hits.
    SSF47769. SSF47769. 1 hit.
    PROSITEiPS50146. DAGK. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    PS50105. SAM_DOMAIN. 1 hit.
    PS00479. ZF_DAG_PE_1. 2 hits.
    PS50081. ZF_DAG_PE_2. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: Q16760-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAAGAPPP GPPQPPPPPP PEESSDSEPE AEPGSPQKLI RKVSTSGQIR     50
    QKTIIKEGML TKQNNSFQRS KRRYFKLRGR TLYYAKTAKS IIFDEVDLTD 100
    ASVAESSTKN VNNSFTVITP CRKLILCADN RKEMEDWIAA LKTVQNREHF 150
    EPTQYSMDHF SGMHNWYACS HARPTYCNVC REALSGVTSH GLSCEVCKFK 200
    AHKRCAVRAT NNCKWTTLAS IGKDIIEDAD GIAMPHQWLE GNLPVSAKCT 250
    VCDKTCGSVL RLQDWRCLWC KAMVHTSCKE SLLTKCPLGL CKVSVIPPTA 300
    LNSIDSDGFW KASCPPSCTS PLLVFVNSKS GDNQGVKFLR RFKQLLNPAQ 350
    VFDLMNGGPH LGLRLFQKFD TFRILVCGGD GSVGWVLSEI DSLNLHKQCQ 400
    LGVLPLGTGN DLARVLGWGS ACDDDTQLPQ ILEKLERAST KMLDRWSVMA 450
    YEAKLPRQAS SSTVTEDFSE DSEVQQILFY EDSVAAHLSK ILTSDQHSVV 500
    ISSAKVLCET VKDFVARVGK AYEKTTESSE ESEVMAKKCS VLKEKLDSLL 550
    KTLDDESQAS SSLPNPPPTI AEEAEDGDGS GSICGSTGDR LVASACPARP 600
    QIFRPREQLM LRANSLKKAI RQIIEHTEKA VDEQNAQTQE QEGFVLGLSE 650
    SEEKMDHRVC PPLSHSESFG VPKGRSQRKV SKSPCEKLIS KGSLSLGSSA 700
    SLPPQPGSRD GLPALNTKIL YPNVRAGMSG SLPGGSVISR LLINADPFNS 750
    EPETLEYYTE KCVMNNYFGI GLDAKISLDF NNKRDEHPEK CRSRTKNMMW 800
    YGVLGTKELL HRTYKNLEQK VLLECDGRPI PLPSLQGIAV LNIPSYAGGT 850
    NFWGGTKEDD TFAAPSFDDK ILEVVAVFGS MQMAVSRVIR LQHHRIAQCR 900
    TVKISILGDE GVPVQVDGEA WVQPPGYIRI VHKNRAQTLT RDRAFESTLK 950
    SWEDKQKCEL PRPPSCSLHP EMLSEEEATQ MDQFGQAAGV LIHSIREIAQ 1000
    SHRDMEQELA HAVNASSKSM DRVYGKPRTT EGLNCSFVLE MVNNFRALRS 1050
    ETELLLSGKM ALQLDPPQKE QLGSALAEMD RQLRRLADTP WLCQSAEPGD 1100
    EESVMLDLAK RSRSGKFRLV TKFKKEKNNK NKEAHSSLGA PVHLWGTEEV 1150
    AAWLEHLSLC EYKDIFTRHD IRGSELLHLE RRDLKDLGVT KVGHMKRILC 1200
    GIKELSRSAP AVEA 1214
    Length:1,214
    Mass (Da):134,525
    Last modified:October 17, 2006 - v4
    Checksum:iED114429096D2112
    GO
    Isoform 1 (identifier: Q16760-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQK → MNMFLYFQ

    Show »
    Length:1,170
    Mass (Da):130,326
    Checksum:i00B7946AE15BC0A3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti511 – 5111V → P in BAA11134. (PubMed:8626538)Curated
    Sequence conflicti828 – 8347RPIPLPS → DPSHSPV in BAA11134. (PubMed:8626538)Curated
    Sequence conflicti960 – 9601L → V in BAC11809. (PubMed:12200442)Curated
    Sequence conflicti960 – 9601L → V in BAA11134. (PubMed:8626538)Curated
    Sequence conflicti1054 – 10541Missing in BAA11134. (PubMed:8626538)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5252MAAAA…QIRQK → MNMFLYFQ in isoform 1. 2 PublicationsVSP_012891Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB078966 mRNA. Translation: BAC11809.1.
    D63479 mRNA. Translation: BAA09766.3.
    D73409 mRNA. Translation: BAA11134.1.
    BC006561 mRNA. Translation: AAH06561.1.
    CCDSiCCDS2504.1. [Q16760-1]
    CCDS46546.1. [Q16760-2]
    RefSeqiNP_003639.2. NM_003648.2. [Q16760-2]
    NP_690618.2. NM_152879.2. [Q16760-1]
    UniGeneiHs.471675.

    Genome annotation databases

    EnsembliENST00000264057; ENSP00000264057; ENSG00000077044. [Q16760-1]
    ENST00000409813; ENSP00000386455; ENSG00000077044. [Q16760-2]
    GeneIDi8527.
    KEGGihsa:8527.
    UCSCiuc002vui.1. human. [Q16760-1]
    uc002vuj.1. human. [Q16760-2]

    Polymorphism databases

    DMDMi116241328.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB078966 mRNA. Translation: BAC11809.1 .
    D63479 mRNA. Translation: BAA09766.3 .
    D73409 mRNA. Translation: BAA11134.1 .
    BC006561 mRNA. Translation: AAH06561.1 .
    CCDSi CCDS2504.1. [Q16760-1 ]
    CCDS46546.1. [Q16760-2 ]
    RefSeqi NP_003639.2. NM_003648.2. [Q16760-2 ]
    NP_690618.2. NM_152879.2. [Q16760-1 ]
    UniGenei Hs.471675.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1R79 NMR - A 216-286 [» ]
    3BQ7 X-ray 2.90 A/B/C/D/E/F 1141-1208 [» ]
    ProteinModelPortali Q16760.
    SMRi Q16760. Positions 51-145, 216-286, 1141-1208.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114097. 7 interactions.
    DIPi DIP-29646N.
    IntActi Q16760. 6 interactions.
    MINTi MINT-87709.
    STRINGi 9606.ENSP00000264057.

    Chemistry

    ChEMBLi CHEMBL1075120.
    DrugBanki DB00144. Phosphatidylserine.

    PTM databases

    PhosphoSitei Q16760.

    Polymorphism databases

    DMDMi 116241328.

    Proteomic databases

    MaxQBi Q16760.
    PaxDbi Q16760.
    PRIDEi Q16760.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264057 ; ENSP00000264057 ; ENSG00000077044 . [Q16760-1 ]
    ENST00000409813 ; ENSP00000386455 ; ENSG00000077044 . [Q16760-2 ]
    GeneIDi 8527.
    KEGGi hsa:8527.
    UCSCi uc002vui.1. human. [Q16760-1 ]
    uc002vuj.1. human. [Q16760-2 ]

    Organism-specific databases

    CTDi 8527.
    GeneCardsi GC02P234279.
    H-InvDB HIX0002934.
    HGNCi HGNC:2851. DGKD.
    HPAi HPA049101.
    MIMi 601826. gene.
    neXtProti NX_Q16760.
    PharmGKBi PA27312.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG328046.
    HOGENOMi HOG000234676.
    HOVERGENi HBG051346.
    InParanoidi Q16760.
    KOi K00901.
    OMAi KKCSVLK.
    OrthoDBi EOG7DVD9B.
    PhylomeDBi Q16760.
    TreeFami TF313104.

    Enzyme and pathway databases

    Reactomei REACT_2202. Effects of PIP2 hydrolysis.

    Miscellaneous databases

    ChiTaRSi DGKD. human.
    EvolutionaryTracei Q16760.
    GeneWikii DGKD.
    GenomeRNAii 8527.
    NextBioi 31928.
    PROi Q16760.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q16760.
    Bgeei Q16760.
    CleanExi HS_DGKD.
    Genevestigatori Q16760.

    Family and domain databases

    Gene3Di 1.10.150.50. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR016064. ATP-NAD_kinase_PpnK-typ.
    IPR000756. Diacylglycerol_kin_accessory.
    IPR001206. Diacylglycerol_kinase_cat_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR001660. SAM.
    IPR013761. SAM/pointed.
    IPR011510. SAM_2.
    [Graphical view ]
    Pfami PF00130. C1_1. 2 hits.
    PF00609. DAGK_acc. 1 hit.
    PF00781. DAGK_cat. 1 hit.
    PF00169. PH. 1 hit.
    PF07647. SAM_2. 1 hit.
    [Graphical view ]
    SMARTi SM00109. C1. 2 hits.
    SM00045. DAGKa. 1 hit.
    SM00046. DAGKc. 1 hit.
    SM00233. PH. 1 hit.
    SM00454. SAM. 1 hit.
    [Graphical view ]
    SUPFAMi SSF111331. SSF111331. 2 hits.
    SSF47769. SSF47769. 1 hit.
    PROSITEi PS50146. DAGK. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    PS50105. SAM_DOMAIN. 1 hit.
    PS00479. ZF_DAG_PE_1. 2 hits.
    PS50081. ZF_DAG_PE_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Alternative splicing of the human diacylglycerol kinase delta gene generates two isoforms differing in their expression patterns and in regulatory functions."
      Sakane F., Imai S., Yamada K., Murakami T., Tsushima S., Kanoh H.
      J. Biol. Chem. 277:43519-43526(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, SUBUNIT, TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1."
      Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N.
      DNA Res. 2:167-174(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-1214 (ISOFORM 2).
      Tissue: Bone marrow.
    3. Ohara O., Nagase T., Kikuno R., Nomura N.
      Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    4. "Molecular cloning of a novel diacylglycerol kinase isozyme with a pleckstrin homology domain and a C-terminal tail similar to those of the EPH family of protein-tyrosine kinases."
      Sakane F., Imai S., Kai M., Wada I., Kanoh H.
      J. Biol. Chem. 271:8394-8401(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 45-1214 (ISOFORM 1).
      Tissue: Hepatoma and Testis.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1068-1214.
      Tissue: Lymph.
    6. "Phorbol ester-regulated oligomerization of diacylglycerol kinase delta linked to its phosphorylation and translocation."
      Imai S., Sakane F., Kanoh H.
      J. Biol. Chem. 277:35323-35332(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION.
    7. "Regulation of clathrin-dependent endocytosis by diacylglycerol kinase delta: importance of kinase activity and binding to AP2alpha."
      Kawasaki T., Kobayashi T., Ueyama T., Shirai Y., Saito N.
      Biochem. J. 409:471-479(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH AP2A2, MUTAGENESIS OF PHE-369; PHE-372 AND PHE-748.
    8. "Solution structure of the C1 domain of the human diacylglycerol kinase delta."
      RIKEN structural genomics initiative (RSGI)
      Submitted (APR-2004) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 216-286.

    Entry informationi

    Entry nameiDGKD_HUMAN
    AccessioniPrimary (citable) accession number: Q16760
    Secondary accession number(s): Q14158, Q6PK55, Q8NG53
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 161 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3