SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q16760

- DGKD_HUMAN

UniProt

Q16760 - DGKD_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Diacylglycerol kinase delta
Gene
DGKD, KIAA0145
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May function as signaling molecule.1 Publication
Isoform 2 may be involved in cell growth and tumorigenesis. Involved in clathrin-dependent endocytosis.1 Publication

Catalytic activityi

ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate.

Enzyme regulationi

Partially inhibited by phosphatidylserine.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri163 – 21351Phorbol-ester/DAG-type 1
Add
BLAST
Zinc fingeri235 – 28652Phorbol-ester/DAG-type 2
Add
BLAST

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. NAD+ kinase activity Source: InterPro
  3. diacylglycerol binding Source: UniProtKB
  4. diacylglycerol kinase activity Source: UniProtKB
  5. metal ion binding Source: UniProtKB-KW
  6. protein binding Source: IntAct
  7. protein heterodimerization activity Source: MGI
  8. protein homodimerization activity Source: MGI

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. cell growth Source: UniProtKB
  3. diacylglycerol metabolic process Source: UniProtKB
  4. endocytosis Source: UniProtKB-KW
  5. epidermal growth factor receptor signaling pathway Source: UniProtKB
  6. multicellular organismal development Source: UniProtKB
  7. platelet activation Source: Reactome
  8. protein homooligomerization Source: UniProtKB
  9. protein kinase C-activating G-protein coupled receptor signaling pathway Source: UniProtKB
  10. protein transport Source: UniProtKB-KW
  11. response to organic substance Source: UniProtKB
  12. second-messenger-mediated signaling Source: UniProtKB
  13. signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Endocytosis, Protein transport, Transport

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_2202. Effects of PIP2 hydrolysis.

Names & Taxonomyi

Protein namesi
Recommended name:
Diacylglycerol kinase delta (EC:2.7.1.107)
Short name:
DAG kinase delta
Alternative name(s):
130 kDa diacylglycerol kinase
Diglyceride kinase delta
Short name:
DGK-delta
Gene namesi
Name:DGKD
Synonyms:KIAA0145
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:2851. DGKD.

Subcellular locationi

Isoform 2 : Cytoplasm 1 Publication
Isoform 1 : Membrane; Peripheral membrane protein 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytoplasmic membrane-bounded vesicle Source: MGI
  3. plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi369 – 3691F → A: Reduces interaction with AP2A2; when associated with A-372. 1 Publication
Mutagenesisi372 – 3721F → A: Reduces interaction with AP2A2; when associated with A-369. 1 Publication
Mutagenesisi748 – 7481F → A: Reduces interaction with AP2A2. 1 Publication

Organism-specific databases

PharmGKBiPA27312.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12141214Diacylglycerol kinase delta
PRO_0000218462Add
BLAST

Post-translational modificationi

Isoform 1 H domain is phosphorylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ16760.
PaxDbiQ16760.
PRIDEiQ16760.

PTM databases

PhosphoSiteiQ16760.

Expressioni

Tissue specificityi

Isoform 2 is ubiquitously expressed also in tumor tissues. Isoform 1 is expressed in ovary, spleen and some tumor-derived cells.1 Publication

Gene expression databases

ArrayExpressiQ16760.
BgeeiQ16760.
CleanExiHS_DGKD.
GenevestigatoriQ16760.

Organism-specific databases

HPAiHPA049101.

Interactioni

Subunit structurei

The two isoforms are able to form homo- and hetero-oligomer structures (at least tetramers). Isoform 2 interacts with AP2A2.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DYSFO759233EBI-719333,EBI-2799016

Protein-protein interaction databases

BioGridi114097. 7 interactions.
DIPiDIP-29646N.
IntActiQ16760. 6 interactions.
MINTiMINT-87709.
STRINGi9606.ENSP00000264057.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi238 – 2414
Beta strandi250 – 2523
Turni259 – 2613
Beta strandi265 – 2706
Helixi276 – 2816
Helixi1142 – 11443
Helixi1147 – 115610
Helixi1160 – 11623
Helixi1163 – 11686
Helixi1173 – 11764
Helixi1181 – 11866
Helixi1192 – 120615

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1R79NMR-A216-286[»]
3BQ7X-ray2.90A/B/C/D/E/F1141-1208[»]
ProteinModelPortaliQ16760.
SMRiQ16760. Positions 51-145, 216-286, 1141-1208.

Miscellaneous databases

EvolutionaryTraceiQ16760.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini53 – 14694PH
Add
BLAST
Domaini317 – 451135DAGKc
Add
BLAST
Domaini1145 – 120864SAM
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi8 – 3629Pro-rich
Add
BLAST

Sequence similaritiesi

Contains 1 DAGKc domain.
Contains 1 PH domain.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG328046.
HOGENOMiHOG000234676.
HOVERGENiHBG051346.
InParanoidiQ16760.
KOiK00901.
OMAiKKCSVLK.
OrthoDBiEOG7DVD9B.
PhylomeDBiQ16760.
TreeFamiTF313104.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR016064. ATP-NAD_kinase_PpnK-typ.
IPR000756. Diacylglycerol_kin_accessory.
IPR001206. Diacylglycerol_kinase_cat_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR011510. SAM_2.
[Graphical view]
PfamiPF00130. C1_1. 2 hits.
PF00609. DAGK_acc. 1 hit.
PF00781. DAGK_cat. 1 hit.
PF00169. PH. 1 hit.
PF07647. SAM_2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 2 hits.
SM00045. DAGKa. 1 hit.
SM00046. DAGKc. 1 hit.
SM00233. PH. 1 hit.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF111331. SSF111331. 2 hits.
SSF47769. SSF47769. 1 hit.
PROSITEiPS50146. DAGK. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50105. SAM_DOMAIN. 1 hit.
PS00479. ZF_DAG_PE_1. 2 hits.
PS50081. ZF_DAG_PE_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: Q16760-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAAAGAPPP GPPQPPPPPP PEESSDSEPE AEPGSPQKLI RKVSTSGQIR     50
QKTIIKEGML TKQNNSFQRS KRRYFKLRGR TLYYAKTAKS IIFDEVDLTD 100
ASVAESSTKN VNNSFTVITP CRKLILCADN RKEMEDWIAA LKTVQNREHF 150
EPTQYSMDHF SGMHNWYACS HARPTYCNVC REALSGVTSH GLSCEVCKFK 200
AHKRCAVRAT NNCKWTTLAS IGKDIIEDAD GIAMPHQWLE GNLPVSAKCT 250
VCDKTCGSVL RLQDWRCLWC KAMVHTSCKE SLLTKCPLGL CKVSVIPPTA 300
LNSIDSDGFW KASCPPSCTS PLLVFVNSKS GDNQGVKFLR RFKQLLNPAQ 350
VFDLMNGGPH LGLRLFQKFD TFRILVCGGD GSVGWVLSEI DSLNLHKQCQ 400
LGVLPLGTGN DLARVLGWGS ACDDDTQLPQ ILEKLERAST KMLDRWSVMA 450
YEAKLPRQAS SSTVTEDFSE DSEVQQILFY EDSVAAHLSK ILTSDQHSVV 500
ISSAKVLCET VKDFVARVGK AYEKTTESSE ESEVMAKKCS VLKEKLDSLL 550
KTLDDESQAS SSLPNPPPTI AEEAEDGDGS GSICGSTGDR LVASACPARP 600
QIFRPREQLM LRANSLKKAI RQIIEHTEKA VDEQNAQTQE QEGFVLGLSE 650
SEEKMDHRVC PPLSHSESFG VPKGRSQRKV SKSPCEKLIS KGSLSLGSSA 700
SLPPQPGSRD GLPALNTKIL YPNVRAGMSG SLPGGSVISR LLINADPFNS 750
EPETLEYYTE KCVMNNYFGI GLDAKISLDF NNKRDEHPEK CRSRTKNMMW 800
YGVLGTKELL HRTYKNLEQK VLLECDGRPI PLPSLQGIAV LNIPSYAGGT 850
NFWGGTKEDD TFAAPSFDDK ILEVVAVFGS MQMAVSRVIR LQHHRIAQCR 900
TVKISILGDE GVPVQVDGEA WVQPPGYIRI VHKNRAQTLT RDRAFESTLK 950
SWEDKQKCEL PRPPSCSLHP EMLSEEEATQ MDQFGQAAGV LIHSIREIAQ 1000
SHRDMEQELA HAVNASSKSM DRVYGKPRTT EGLNCSFVLE MVNNFRALRS 1050
ETELLLSGKM ALQLDPPQKE QLGSALAEMD RQLRRLADTP WLCQSAEPGD 1100
EESVMLDLAK RSRSGKFRLV TKFKKEKNNK NKEAHSSLGA PVHLWGTEEV 1150
AAWLEHLSLC EYKDIFTRHD IRGSELLHLE RRDLKDLGVT KVGHMKRILC 1200
GIKELSRSAP AVEA 1214
Length:1,214
Mass (Da):134,525
Last modified:October 17, 2006 - v4
Checksum:iED114429096D2112
GO
Isoform 1 (identifier: Q16760-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQK → MNMFLYFQ

Show »
Length:1,170
Mass (Da):130,326
Checksum:i00B7946AE15BC0A3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5252MAAAA…QIRQK → MNMFLYFQ in isoform 1.
VSP_012891Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti511 – 5111V → P in BAA11134. 1 Publication
Sequence conflicti828 – 8347RPIPLPS → DPSHSPV in BAA11134. 1 Publication
Sequence conflicti960 – 9601L → V in BAC11809. 1 Publication
Sequence conflicti960 – 9601L → V in BAA11134. 1 Publication
Sequence conflicti1054 – 10541Missing in BAA11134. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB078966 mRNA. Translation: BAC11809.1.
D63479 mRNA. Translation: BAA09766.3.
D73409 mRNA. Translation: BAA11134.1.
BC006561 mRNA. Translation: AAH06561.1.
CCDSiCCDS2504.1. [Q16760-1]
CCDS46546.1. [Q16760-2]
RefSeqiNP_003639.2. NM_003648.2. [Q16760-2]
NP_690618.2. NM_152879.2. [Q16760-1]
UniGeneiHs.471675.

Genome annotation databases

EnsembliENST00000264057; ENSP00000264057; ENSG00000077044. [Q16760-1]
ENST00000409813; ENSP00000386455; ENSG00000077044. [Q16760-2]
GeneIDi8527.
KEGGihsa:8527.
UCSCiuc002vui.1. human. [Q16760-1]
uc002vuj.1. human. [Q16760-2]

Polymorphism databases

DMDMi116241328.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB078966 mRNA. Translation: BAC11809.1 .
D63479 mRNA. Translation: BAA09766.3 .
D73409 mRNA. Translation: BAA11134.1 .
BC006561 mRNA. Translation: AAH06561.1 .
CCDSi CCDS2504.1. [Q16760-1 ]
CCDS46546.1. [Q16760-2 ]
RefSeqi NP_003639.2. NM_003648.2. [Q16760-2 ]
NP_690618.2. NM_152879.2. [Q16760-1 ]
UniGenei Hs.471675.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1R79 NMR - A 216-286 [» ]
3BQ7 X-ray 2.90 A/B/C/D/E/F 1141-1208 [» ]
ProteinModelPortali Q16760.
SMRi Q16760. Positions 51-145, 216-286, 1141-1208.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114097. 7 interactions.
DIPi DIP-29646N.
IntActi Q16760. 6 interactions.
MINTi MINT-87709.
STRINGi 9606.ENSP00000264057.

Chemistry

ChEMBLi CHEMBL1075120.
DrugBanki DB00144. Phosphatidylserine.

PTM databases

PhosphoSitei Q16760.

Polymorphism databases

DMDMi 116241328.

Proteomic databases

MaxQBi Q16760.
PaxDbi Q16760.
PRIDEi Q16760.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264057 ; ENSP00000264057 ; ENSG00000077044 . [Q16760-1 ]
ENST00000409813 ; ENSP00000386455 ; ENSG00000077044 . [Q16760-2 ]
GeneIDi 8527.
KEGGi hsa:8527.
UCSCi uc002vui.1. human. [Q16760-1 ]
uc002vuj.1. human. [Q16760-2 ]

Organism-specific databases

CTDi 8527.
GeneCardsi GC02P234279.
H-InvDB HIX0002934.
HGNCi HGNC:2851. DGKD.
HPAi HPA049101.
MIMi 601826. gene.
neXtProti NX_Q16760.
PharmGKBi PA27312.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG328046.
HOGENOMi HOG000234676.
HOVERGENi HBG051346.
InParanoidi Q16760.
KOi K00901.
OMAi KKCSVLK.
OrthoDBi EOG7DVD9B.
PhylomeDBi Q16760.
TreeFami TF313104.

Enzyme and pathway databases

Reactomei REACT_2202. Effects of PIP2 hydrolysis.

Miscellaneous databases

ChiTaRSi DGKD. human.
EvolutionaryTracei Q16760.
GeneWikii DGKD.
GenomeRNAii 8527.
NextBioi 31928.
PROi Q16760.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q16760.
Bgeei Q16760.
CleanExi HS_DGKD.
Genevestigatori Q16760.

Family and domain databases

Gene3Di 1.10.150.50. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR016064. ATP-NAD_kinase_PpnK-typ.
IPR000756. Diacylglycerol_kin_accessory.
IPR001206. Diacylglycerol_kinase_cat_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR011510. SAM_2.
[Graphical view ]
Pfami PF00130. C1_1. 2 hits.
PF00609. DAGK_acc. 1 hit.
PF00781. DAGK_cat. 1 hit.
PF00169. PH. 1 hit.
PF07647. SAM_2. 1 hit.
[Graphical view ]
SMARTi SM00109. C1. 2 hits.
SM00045. DAGKa. 1 hit.
SM00046. DAGKc. 1 hit.
SM00233. PH. 1 hit.
SM00454. SAM. 1 hit.
[Graphical view ]
SUPFAMi SSF111331. SSF111331. 2 hits.
SSF47769. SSF47769. 1 hit.
PROSITEi PS50146. DAGK. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50105. SAM_DOMAIN. 1 hit.
PS00479. ZF_DAG_PE_1. 2 hits.
PS50081. ZF_DAG_PE_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Alternative splicing of the human diacylglycerol kinase delta gene generates two isoforms differing in their expression patterns and in regulatory functions."
    Sakane F., Imai S., Yamada K., Murakami T., Tsushima S., Kanoh H.
    J. Biol. Chem. 277:43519-43526(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, SUBUNIT, TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1."
    Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N.
    DNA Res. 2:167-174(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-1214 (ISOFORM 2).
    Tissue: Bone marrow.
  3. Ohara O., Nagase T., Kikuno R., Nomura N.
    Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  4. "Molecular cloning of a novel diacylglycerol kinase isozyme with a pleckstrin homology domain and a C-terminal tail similar to those of the EPH family of protein-tyrosine kinases."
    Sakane F., Imai S., Kai M., Wada I., Kanoh H.
    J. Biol. Chem. 271:8394-8401(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 45-1214 (ISOFORM 1).
    Tissue: Hepatoma and Testis.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1068-1214.
    Tissue: Lymph.
  6. "Phorbol ester-regulated oligomerization of diacylglycerol kinase delta linked to its phosphorylation and translocation."
    Imai S., Sakane F., Kanoh H.
    J. Biol. Chem. 277:35323-35332(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION.
  7. "Regulation of clathrin-dependent endocytosis by diacylglycerol kinase delta: importance of kinase activity and binding to AP2alpha."
    Kawasaki T., Kobayashi T., Ueyama T., Shirai Y., Saito N.
    Biochem. J. 409:471-479(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH AP2A2, MUTAGENESIS OF PHE-369; PHE-372 AND PHE-748.
  8. "Solution structure of the C1 domain of the human diacylglycerol kinase delta."
    RIKEN structural genomics initiative (RSGI)
    Submitted (APR-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 216-286.

Entry informationi

Entry nameiDGKD_HUMAN
AccessioniPrimary (citable) accession number: Q16760
Secondary accession number(s): Q14158, Q6PK55, Q8NG53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 17, 2006
Last modified: September 3, 2014
This is version 160 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi