UniProtKB - Q16665 (HIF1A_HUMAN)
(max 400 entries)x
Your basket is currently empty.
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
Protein
Hypoxia-inducible factor 1-alpha
Gene
HIF1A
Organism
Homo sapiens (Human)
Status
Functioni
Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBBP and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP. Involved in the axonal distribution and transport of mitochondria in neurons during hypoxia.10 Publications
GO - Molecular functioni
- E-box binding Source: Ensembl
- enzyme binding Source: UniProtKB
- histone acetyltransferase binding Source: UniProtKB
- histone deacetylase binding Source: Ensembl
- Hsp90 protein binding Source: BHF-UCL
- nuclear hormone receptor binding Source: UniProtKB
- p53 binding Source: CAFA
- protein domain specific binding Source: CAFA
- protein heterodimerization activity Source: UniProtKB
- protein kinase binding Source: UniProtKB
- sequence-specific DNA binding Source: Ensembl
- transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding Source: Ensembl
- transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding Source: BHF-UCL
- transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding Source: BHF-UCL
- transcription factor activity, RNA polymerase II transcription factor binding Source: Ensembl
- transcription factor activity, sequence-specific DNA binding Source: UniProtKB
- transcription factor activity, transcription factor binding Source: BHF-UCL
- transcription factor binding Source: BHF-UCL
- ubiquitin protein ligase binding Source: UniProtKB
GO - Biological processi
- angiogenesis Source: Ensembl
- axonal transport of mitochondrion Source: UniProtKB
- B-1 B cell homeostasis Source: Ensembl
- cardiac ventricle morphogenesis Source: Ensembl
- cartilage development Source: Ensembl
- cellular iron ion homeostasis Source: Ensembl
- cellular response to hypoxia Source: UniProtKB
- cellular response to interleukin-1 Source: BHF-UCL
- cerebral cortex development Source: Ensembl
- collagen metabolic process Source: BHF-UCL
- connective tissue replacement involved in inflammatory response wound healing Source: BHF-UCL
- digestive tract morphogenesis Source: Ensembl
- dopaminergic neuron differentiation Source: Ensembl
- elastin metabolic process Source: BHF-UCL
- embryonic hemopoiesis Source: Ensembl
- embryonic placenta development Source: Ensembl
- epithelial cell differentiation involved in mammary gland alveolus development Source: Ensembl
- epithelial to mesenchymal transition Source: BHF-UCL
- glucose homeostasis Source: Ensembl
- heart looping Source: Ensembl
- hemoglobin biosynthetic process Source: Ensembl
- hypoxia-inducible factor-1alpha signaling pathway Source: Ensembl
- intestinal epithelial cell maturation Source: Ensembl
- iris morphogenesis Source: Ensembl
- lactate metabolic process Source: Ensembl
- lactation Source: Ensembl
- mRNA transcription from RNA polymerase II promoter Source: BHF-UCL
- muscle cell cellular homeostasis Source: Ensembl
- negative regulation of bone mineralization Source: Ensembl
- negative regulation of growth Source: Ensembl
- negative regulation of mesenchymal cell apoptotic process Source: Ensembl
- negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway Source: ParkinsonsUK-UCL
- negative regulation of reactive oxygen species metabolic process Source: Ensembl
- negative regulation of thymocyte apoptotic process Source: Ensembl
- negative regulation of TOR signaling Source: Ensembl
- neural crest cell migration Source: Ensembl
- neural fold elevation formation Source: Ensembl
- outflow tract morphogenesis Source: Ensembl
- oxygen homeostasis Source: HGNC
- positive regulation of angiogenesis Source: UniProtKB
- positive regulation of chemokine-mediated signaling pathway Source: BHF-UCL
- positive regulation of chemokine production Source: BHF-UCL
- positive regulation of endothelial cell proliferation Source: BHF-UCL
- positive regulation of epithelial cell migration Source: BHF-UCL
- positive regulation of erythrocyte differentiation Source: BHF-UCL
- positive regulation of gene expression Source: CAFA
- positive regulation of glycolytic process Source: BHF-UCL
- positive regulation of hormone biosynthetic process Source: BHF-UCL
- positive regulation of insulin secretion involved in cellular response to glucose stimulus Source: Ensembl
- positive regulation of macroautophagy Source: Ensembl
- positive regulation of mitophagy Source: Ensembl
- positive regulation of neuroblast proliferation Source: Ensembl
- positive regulation of nitric-oxide synthase activity Source: BHF-UCL
- positive regulation of pri-miRNA transcription from RNA polymerase II promoter Source: BHF-UCL
- positive regulation of receptor biosynthetic process Source: BHF-UCL
- positive regulation of transcription, DNA-templated Source: UniProtKB
- positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
- positive regulation of transcription from RNA polymerase II promoter in response to hypoxia Source: BHF-UCL
- positive regulation of vascular endothelial growth factor production Source: BHF-UCL
- positive regulation of vascular endothelial growth factor receptor signaling pathway Source: BHF-UCL
- post-translational protein modification Source: Reactome
- protein deubiquitination Source: Reactome
- protein ubiquitination Source: Reactome
- regulation of aerobic respiration Source: Ensembl
- regulation of gene expression Source: UniProtKB
- regulation of transcription, DNA-templated Source: UniProtKB
- regulation of transcription from RNA polymerase II promoter in response to hypoxia Source: Reactome
- regulation of transcription from RNA polymerase II promoter in response to oxidative stress Source: BHF-UCL
- regulation of transforming growth factor beta2 production Source: BHF-UCL
- response to hypoxia Source: UniProtKB
- response to muscle activity Source: Ensembl
- retina vasculature development in camera-type eye Source: Ensembl
- signal transduction Source: BHF-UCL
- transcription from RNA polymerase II promoter Source: UniProtKB
- vascular endothelial growth factor production Source: BHF-UCL
- visual learning Source: Ensembl
Keywordsi
| Molecular function | Activator, DNA-binding |
| Biological process | Transcription, Transcription regulation |
Enzyme and pathway databases
| Reactomei | R-HSA-1234158. Regulation of gene expression by Hypoxia-inducible Factor. R-HSA-1234162. Oxygen-dependent asparagine hydroxylation of Hypoxia-inducible Factor Alpha. R-HSA-1234176. Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha. R-HSA-1368108. BMAL1:CLOCK,NPAS2 activates circadian gene expression. R-HSA-2122947. NOTCH1 Intracellular Domain Regulates Transcription. R-HSA-400253. Circadian Clock. R-HSA-5689880. Ub-specific processing proteases. R-HSA-6785807. Interleukin-4 and 13 signaling. R-HSA-8849473. PTK6 Expression. R-HSA-8857538. PTK6 promotes HIF1A stabilization. R-HSA-8951664. Neddylation. |
| SignaLinki | Q16665. |
| SIGNORi | Q16665. |
Names & Taxonomyi
| Protein namesi | Recommended name: Hypoxia-inducible factor 1-alphaShort name: HIF-1-alpha Short name: HIF1-alpha Alternative name(s): ARNT-interacting protein Basic-helix-loop-helix-PAS protein MOP1 Class E basic helix-loop-helix protein 78 Short name: bHLHe78 Member of PAS protein 1 PAS domain-containing protein 8 |
| Gene namesi | Name:HIF1A Synonyms:BHLHE78, MOP1, PASD8 |
| Organismi | Homo sapiens (Human) |
| Taxonomic identifieri | 9606 [NCBI] |
| Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
| Proteomesi |
|
Organism-specific databases
| HGNCi | HGNC:4910. HIF1A. |
Subcellular locationi
- Cytoplasm 1 Publication
- Nucleus 2 Publications
- Nucleus speckle By similarity
Note: Colocalizes with HIF3A in the nucleus and speckles (By similarity). Cytoplasmic in normoxia, nuclear translocation in response to hypoxia (PubMed:9822602).By similarity
GO - Cellular componenti
- axon cytoplasm Source: GOC
- cytoplasm Source: UniProtKB
- cytosol Source: UniProtKB
- motile cilium Source: Ensembl
- nuclear body Source: HPA
- nuclear speck Source: UniProtKB
- nucleoplasm Source: HPA
- nucleus Source: UniProtKB
- protein complex Source: CAFA
- RNA polymerase II transcription factor complex Source: BHF-UCL
- transcription factor complex Source: MGI
Keywords - Cellular componenti
Cytoplasm, NucleusPathology & Biotechi
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Mutagenesisi | 247 | S → A: Constitutive kinase activity. 1 Publication | 1 | |
| Mutagenesisi | 247 | S → D: Impaired kinase activity. 1 Publication | 1 | |
| Mutagenesisi | 377 | K → R: No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-391; R-477 and R-532. 1 Publication | 1 | |
| Mutagenesisi | 389 | K → R: No change in sumoylation. 1 Publication | 1 | |
| Mutagenesisi | 391 | K → R: Abolishes 1 sumoylation. Abolishes 1 sumoylation; when associated with R-532. Abolishes 2 sumoylations; when associated with R-477. No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-377; R-477 and R-532. 2 Publications | 1 | |
| Mutagenesisi | 392 | K → R: No change in sumoylation. 1 Publication | 1 | |
| Mutagenesisi | 394 | P → A: No change in VHLE3-dependent ubiquitination. 1 Publication | 1 | |
| Mutagenesisi | 397 | L → A: Abolishes VHLE3-dependent ubiquitination; when associated with A-400. 1 Publication | 1 | |
| Mutagenesisi | 400 | L → A: Abolishes VHLE3-dependent ubiquitination; when associated with A-397. 1 Publication | 1 | |
| Mutagenesisi | 402 | P → A: Abolishes in VHLE3-dependent ubiquitination, abolishes oxygen-dependent regulation of VP16, partially reduced VHLE target site ubiquitination and no interaction with VHL. No VHLE target site ubiquitination; when associated with G-564. Increases HIF1A instability and reduces HIF1A-induced target gene transcriptional activation; when associated with A-564. 3 Publications | 1 | |
| Mutagenesisi | 442 | K → R: No change in sumoylation. 1 Publication | 1 | |
| Mutagenesisi | 460 | K → R: No change in sumoylation nor in ARD1-mediated acetylation. 1 Publication | 1 | |
| Mutagenesisi | 477 | K → R: Abolishes 1 sumoylation. Abolishes 2 sumoylations; when associated with R-391. No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-377; R-391 and R-532. 2 Publications | 1 | |
| Mutagenesisi | 532 | K → R: Reduced ubiquitination. No change in sumoylation nor on interaction with ARD1A. No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-377; R-391 and R-477. Complete loss of ubiquitination, but no change in VHL binding; when associated with K-538 and K-547. 5 Publications | 1 | |
| Mutagenesisi | 538 | K → R: No change in sumoylation, but reduced ubiquitination. Complete loss of ubiquitination, but no change in VHL binding; when associated with K-532 and K-547. 3 Publications | 1 | |
| Mutagenesisi | 547 | K → R: No change in sumoylation, but reduced ubiquitination. Complete loss of ubiquitination, but no change in VHL binding; when associated with K-532 and K-538. 3 Publications | 1 | |
| Mutagenesisi | 551 | S → G: Constitutive expression under nonhypoxic conditions by decreasing ubiquitination. 1 Publication | 1 | |
| Mutagenesisi | 552 | T → A: Constitutive expression under nonhypoxic conditions by decreasing ubiquitination. 1 Publication | 1 | |
| Mutagenesisi | 564 | P → A: Increases HIF1A instability and reduces HIF1A-induced target gene transcriptional activation; when associated with A-402. 3 Publications | 1 | |
| Mutagenesisi | 564 | P → G: No change in VHL-dependent ubiquitination. Partially reduced VHLE target site ubiquitination. No VHLE target site ubiquitination; when associated with A-402. 3 Publications | 1 | |
| Mutagenesisi | 576 | S → A: Induces stabilization of the protein. 1 Publication | 1 | |
| Mutagenesisi | 657 | S → A: Induces stabilization of the protein. 1 Publication | 1 | |
| Mutagenesisi | 709 | K → R: Abolishes SIRT2-mediated deacetylation, increases HIF1A instability and reduces HIF1A-induced target gene transcriptional activation. Increases interaction with EGLN1. 1 Publication | 1 | |
| Mutagenesisi | 719 | K → T: Dramatic reduction of accumulation in the nucleus in response to hypoxia. 2 Publications | 1 | |
| Mutagenesisi | 795 | L → A: Inhibits interaction with EP300 and transactivation activity. 1 Publication | 1 | |
| Mutagenesisi | 800 | C → A: Blocks increase in transcriptional activation caused by nitrosylation. 2 Publications | 1 | |
| Mutagenesisi | 800 | C → S: Abolishes hypoxia-inducible transcriptional activation of ctaD. 2 Publications | 1 | |
| Mutagenesisi | 803 | N → A: Recruits CREBBP. No enhancement of CREBBP by Clioquinol in the presence of FIH1. No change in nuclear location nor on repression of transcriptional activity in the presence of histone deacetylase inhibitor. 2 Publications | 1 |
Organism-specific databases
| DisGeNETi | 3091. |
| OpenTargetsi | ENSG00000100644. |
| PharmGKBi | PA29283. |
Chemistry databases
| ChEMBLi | CHEMBL4261. |
| DrugBanki | DB02342. 2-Methoxyestradiol. DB01136. Carvedilol. DB08687. N-[(1-CHLORO-4-HYDROXYISOQUINOLIN-3-YL)CARBONYL]GLYCINE. |
Polymorphism and mutation databases
| BioMutai | HIF-1A. |
| DMDMi | 2498017. |
PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| ChainiPRO_0000127220 | 1 – 826 | Hypoxia-inducible factor 1-alphaAdd BLAST | 826 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Modified residuei | 247 | Phosphoserine; by CK11 Publication | 1 | |
| Cross-linki | 391 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)2 Publications | ||
| Modified residuei | 402 | 4-hydroxyproline1 Publication | 1 | |
| Cross-linki | 477 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)2 Publications | ||
| Modified residuei | 532 | N6-acetyllysine1 Publication | 1 | |
| Cross-linki | 532 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication | ||
| Cross-linki | 538 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication | ||
| Cross-linki | 547 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication | ||
| Modified residuei | 551 | Phosphoserine; by GSK3-beta1 Publication | 1 | |
| Modified residuei | 555 | Phosphothreonine; by GSK3-beta1 Publication | 1 | |
| Modified residuei | 564 | 4-hydroxyproline4 Publications | 1 | |
| Modified residuei | 576 | Phosphoserine; by PLK31 Publication | 1 | |
| Modified residuei | 589 | Phosphoserine; by GSK3-beta1 Publication | 1 | |
| Modified residuei | 657 | Phosphoserine; by PLK31 Publication | 1 | |
| Modified residuei | 709 | N6-acetyllysine1 Publication | 1 | |
| Modified residuei | 800 | S-nitrosocysteine1 Publication | 1 | |
| Modified residuei | 803 | (3S)-3-hydroxyasparagine1 Publication | 1 |
Post-translational modificationi
In normoxia, is hydroxylated on Pro-402 and Pro-564 in the oxygen-dependent degradation domain (ODD) by EGLN1/PHD2 and EGLN2/PHD1. EGLN3/PHD3 has also been shown to hydroxylate Pro-564. The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation. Deubiquitinated by USP20. Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization.5 Publications
In normoxia, is hydroxylated on Asn-803 by HIF1AN, thus abrogating interaction with CREBBP and EP300 and preventing transcriptional activation. This hydroxylation is inhibited by the Cu/Zn-chelator, Clioquinol.1 Publication
S-nitrosylation of Cys-800 may be responsible for increased recruitment of p300 coactivator necessary for transcriptional activity of HIF-1 complex.2 Publications
Requires phosphorylation for DNA-binding. Phosphorylation at Ser-247 by CSNK1D/CK1 represses kinase activity and impairs ARNT binding. Phosphorylation by GSK3-beta and PLK3 promote degradation by the proteasome.2 Publications
Sumoylated; with SUMO1 under hypoxia. Sumoylation is enhanced through interaction with RWDD3. Both sumoylation and desumoylation seem to be involved in the regulation of its stability during hypoxia. Sumoylation can promote either its stabilization or its VHL-dependent degradation by promoting hydroxyproline-independent HIF1A-VHL complex binding, thus leading to HIF1A ubiquitination and proteasomal degradation. Desumoylation by SENP1 increases its stability amd transcriptional activity. There is a disaccord between various publications on the effect of sumoylation and desumoylation on its stability and transcriptional activity.4 Publications
Acetylation of Lys-532 by ARD1 increases interaction with VHL and stimulates subsequent proteasomal degradation (PubMed:12464182). Deacetylation of Lys-709 by SIRT2 increases its interaction with and hydroxylation by EGLN1 thereby inactivating HIF1A activity by inducing its proteasomal degradation (PubMed:24681946).2 Publications
Polyubiquitinated; in normoxia, following hydroxylation and interaction with VHL. Lys-532 appears to be the principal site of ubiquitination. Clioquinol, the Cu/Zn-chelator, inhibits ubiquitination through preventing hydroxylation at Asn-803. Ubiquitinated by a CUL2-based E3 ligase.5 Publications
The iron and 2-oxoglutarate dependent 3-hydroxylation of asparagine is (S) stereospecific within HIF CTAD domains.
Keywords - PTMi
Acetylation, Hydroxylation, Isopeptide bond, Phosphoprotein, S-nitrosylation, Ubl conjugationProteomic databases
| MaxQBi | Q16665. |
| PaxDbi | Q16665. |
| PeptideAtlasi | Q16665. |
| PRIDEi | Q16665. |
PTM databases
| iPTMneti | Q16665. |
| PhosphoSitePlusi | Q16665. |
Expressioni
Tissue specificityi
Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors. A higher level expression seen in pituitary tumors as compared to the pituitary gland.1 Publication
Inductioni
Under reduced oxygen tension. Induced also by various receptor-mediated factors such as growth factors, cytokines, and circulatory factors such as PDGF, EGF, FGF2, IGF2, TGFB1, HGF, TNF, IL1B/interleukin-1 beta, angiotensin-2 and thrombin. However, this induction is less intense than that stimulated by hypoxia. Repressed by HIPK2 and LIMD1.3 Publications
Gene expression databases
| Bgeei | ENSG00000100644. |
| CleanExi | HS_HIF1A. |
| ExpressionAtlasi | Q16665. baseline and differential. |
| Genevisiblei | Q16665. HS. |
Organism-specific databases
| HPAi | CAB017442. HPA000907. HPA001275. |
Interactioni
Subunit structurei
Interacts with the HIF1A beta/ARNT subunit; heterodimerization is required for DNA binding. Interacts with COPS5; the interaction increases the transcriptional activity of HIF1A through increased stability (By similarity). Interacts with EP300 (via TAZ-type 1 domains); the interaction is stimulated in response to hypoxia and inhibited by CITED2. Interacts with CREBBP (via TAZ-type 1 domains). Interacts with NCOA1, NCOA2, APEX and HSP90. Interacts (hydroxylated within the ODD domain) with VHLL (via beta domain); the interaction, leads to polyubiquitination and subsequent HIF1A proteasomal degradation. During hypoxia, sumoylated HIF1A also binds VHL; the interaction promotes the ubiquitination of HIF1A. Interacts with SENP1; the interaction desumoylates HIF1A resulting in stabilization and activation of transcription. Interacts (Via the ODD domain) with ARD1A; the interaction appears not to acetylate HIF1A nor have any affect on protein stability, during hypoxia. Interacts with RWDD3; the interaction enhances HIF1A sumoylation. Interacts with TSGA10 (By similarity). Interacts with HIF3A (By similarity). Interacts with RORA (via the DNA binding domain); the interaction enhances HIF1A transcription under hypoxia through increasing protein stability. Interaction with PSMA7 inhibits the transactivation activity of HIF1A under both normoxic and hypoxia-mimicking conditions. Interacts with USP20. Interacts with RACK1; promotes HIF1A ubiquitination and proteasome-mediated degradation. Interacts (via N-terminus) with USP19. Interacts with SIRT2. Interacts (deacetylated form) with EGLN1. Interacts with CBFA2T3. Interacts with HSP90AA1 and HSP90AB1 (PubMed:26517842).By similarity30 Publications
Binary interactionsi
GO - Molecular functioni
- enzyme binding Source: UniProtKB
- histone acetyltransferase binding Source: UniProtKB
- histone deacetylase binding Source: Ensembl
- Hsp90 protein binding Source: BHF-UCL
- nuclear hormone receptor binding Source: UniProtKB
- p53 binding Source: CAFA
- protein domain specific binding Source: CAFA
- protein heterodimerization activity Source: UniProtKB
- protein kinase binding Source: UniProtKB
- transcription factor binding Source: BHF-UCL
- ubiquitin protein ligase binding Source: UniProtKB
Protein-protein interaction databases
| BioGridi | 109338. 160 interactors. |
| DIPi | DIP-29722N. |
| IntActi | Q16665. 79 interactors. |
| MINTi | MINT-133270. |
| STRINGi | 9606.ENSP00000338018. |
Chemistry databases
| BindingDBi | Q16665. |
Structurei
Secondary structure
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Beta strandi | 241 – 246 | Combined sources | 6 | |
| Beta strandi | 251 – 255 | Combined sources | 5 | |
| Helixi | 258 – 263 | Combined sources | 6 | |
| Helixi | 267 – 270 | Combined sources | 4 | |
| Helixi | 275 – 277 | Combined sources | 3 | |
| Turni | 281 – 283 | Combined sources | 3 | |
| Helixi | 284 – 297 | Combined sources | 14 | |
| Beta strandi | 298 – 301 | Combined sources | 4 | |
| Beta strandi | 305 – 308 | Combined sources | 4 | |
| Beta strandi | 310 – 325 | Combined sources | 16 | |
| Turni | 327 – 329 | Combined sources | 3 | |
| Beta strandi | 332 – 341 | Combined sources | 10 | |
| Helixi | 397 – 400 | Combined sources | 4 | |
| Beta strandi | 408 – 410 | Combined sources | 3 | |
| Helixi | 559 – 562 | Combined sources | 4 | |
| Turni | 779 – 783 | Combined sources | 5 | |
| Helixi | 784 – 787 | Combined sources | 4 | |
| Beta strandi | 789 – 792 | Combined sources | 4 | |
| Helixi | 797 – 803 | Combined sources | 7 | |
| Beta strandi | 807 – 809 | Combined sources | 3 | |
| Helixi | 815 – 822 | Combined sources | 8 |
3D structure databases
| Select the link destinations: PDBei RCSB PDBi PDBji Links Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1D7G | model | - | D | 15-73 | [»] | |
| 1H2K | X-ray | 2.15 | S | 786-826 | [»] | |
| 1H2L | X-ray | 2.25 | S | 786-826 | [»] | |
| 1H2M | X-ray | 2.50 | S | 775-826 | [»] | |
| 1L3E | NMR | - | A | 786-826 | [»] | |
| 1L8C | NMR | - | B | 776-826 | [»] | |
| 1LM8 | X-ray | 1.85 | H | 556-575 | [»] | |
| 1LQB | X-ray | 2.00 | D | 549-582 | [»] | |
| 2ILM | X-ray | 2.30 | S | 786-826 | [»] | |
| 3HQR | X-ray | 2.00 | S | 558-574 | [»] | |
| 3HQU | X-ray | 2.30 | S | 558-574 | [»] | |
| 4AJY | X-ray | 1.73 | H | 559-577 | [»] | |
| 4H6J | X-ray | 1.52 | A | 238-348 | [»] | |
| 5JWP | X-ray | 2.10 | B | 788-806 | [»] | |
| 5L9B | X-ray | 1.95 | C/D | 556-574 | [»] | |
| 5L9V | X-ray | 1.83 | C/D | 395-411 | [»] | |
| 5LA9 | X-ray | 2.81 | C/D | 395-411 | [»] | |
| 5LAS | X-ray | 2.10 | C/D | 395-411 | [»] | |
| DisProti | DP00262. | |||||
| ProteinModelPortali | Q16665. | |||||
| SMRi | Q16665. | |||||
| ModBasei | Search... | |||||
| MobiDBi | Search... | |||||
Miscellaneous databases
| EvolutionaryTracei | Q16665. |
Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Domaini | 17 – 70 | bHLHPROSITE-ProRule annotationAdd BLAST | 54 | |
| Domaini | 85 – 158 | PAS 1PROSITE-ProRule annotationAdd BLAST | 74 | |
| Domaini | 228 – 298 | PAS 2PROSITE-ProRule annotationAdd BLAST | 71 | |
| Domaini | 302 – 345 | PACAdd BLAST | 44 |
Region
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Regioni | 1 – 401 | Interaction with TSGA10By similarityAdd BLAST | 401 | |
| Regioni | 380 – 417 | N-terminal VHL recognition siteAdd BLAST | 38 | |
| Regioni | 401 – 603 | ODDAdd BLAST | 203 | |
| Regioni | 531 – 575 | NTADAdd BLAST | 45 | |
| Regioni | 556 – 572 | C-terminal VHL recognition siteAdd BLAST | 17 | |
| Regioni | 576 – 785 | IDAdd BLAST | 210 | |
| Regioni | 786 – 826 | CTADAdd BLAST | 41 |
Motif
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Motifi | 718 – 721 | Nuclear localization signalSequence analysis | 4 |
Compositional bias
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Compositional biasi | 615 – 621 | Poly-Thr | 7 |
Domaini
Contains two independent C-terminal transactivation domains, NTAD and CTAD, which function synergistically. Their transcriptional activity is repressed by an intervening inhibitory domain (ID).
Keywords - Domaini
RepeatPhylogenomic databases
| eggNOGi | KOG3558. Eukaryota. ENOG410YK57. LUCA. |
| GeneTreei | ENSGT00760000118788. |
| HOGENOMi | HOG000234306. |
| HOVERGENi | HBG060456. |
| InParanoidi | Q16665. |
| KOi | K08268. |
| OMAi | YCFDVDS. |
| OrthoDBi | EOG091G0486. |
| PhylomeDBi | Q16665. |
| TreeFami | TF317772. |
Family and domain databases
| CDDi | cd00083. HLH. 1 hit. cd00130. PAS. 2 hits. |
| Gene3Di | 4.10.280.10. 1 hit. |
| InterProi | View protein in InterPro IPR011598. bHLH_dom. IPR001321. HIF-1_alpha. IPR014887. HIF-1_TAD_C. IPR021537. HIF_alpha_subunit. IPR001610. PAC. IPR000014. PAS. IPR013767. PAS_fold. IPR013655. PAS_fold_3. |
| Pfami | View protein in Pfam PF11413. HIF-1. 1 hit. PF08778. HIF-1a_CTAD. 1 hit. PF00989. PAS. 1 hit. PF08447. PAS_3. 1 hit. |
| PRINTSi | PR01080. HYPOXIAIF1A. |
| SMARTi | View protein in SMART SM00353. HLH. 1 hit. SM00086. PAC. 1 hit. SM00091. PAS. 2 hits. |
| SUPFAMi | SSF47459. SSF47459. 1 hit. SSF55785. SSF55785. 2 hits. |
| TIGRFAMsi | TIGR00229. sensory_box. 2 hits. |
| PROSITEi | View protein in PROSITE PS50888. BHLH. 1 hit. PS50112. PAS. 2 hits. |
Sequences (3)i
Sequence statusi: Complete.
This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q16665-1) [UniParc]FASTAAdd to basket
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MEGAGGANDK KKISSERRKE KSRDAARSRR SKESEVFYEL AHQLPLPHNV
60 70 80 90 100
SSHLDKASVM RLTISYLRVR KLLDAGDLDI EDDMKAQMNC FYLKALDGFV
110 120 130 140 150
MVLTDDGDMI YISDNVNKYM GLTQFELTGH SVFDFTHPCD HEEMREMLTH
160 170 180 190 200
RNGLVKKGKE QNTQRSFFLR MKCTLTSRGR TMNIKSATWK VLHCTGHIHV
210 220 230 240 250
YDTNSNQPQC GYKKPPMTCL VLICEPIPHP SNIEIPLDSK TFLSRHSLDM
260 270 280 290 300
KFSYCDERIT ELMGYEPEEL LGRSIYEYYH ALDSDHLTKT HHDMFTKGQV
310 320 330 340 350
TTGQYRMLAK RGGYVWVETQ ATVIYNTKNS QPQCIVCVNY VVSGIIQHDL
360 370 380 390 400
IFSLQQTECV LKPVESSDMK MTQLFTKVES EDTSSLFDKL KKEPDALTLL
410 420 430 440 450
APAAGDTIIS LDFGSNDTET DDQQLEEVPL YNDVMLPSPN EKLQNINLAM
460 470 480 490 500
SPLPTAETPK PLRSSADPAL NQEVALKLEP NPESLELSFT MPQIQDQTPS
510 520 530 540 550
PSDGSTRQSS PEPNSPSEYC FYVDSDMVNE FKLELVEKLF AEDTEAKNPF
560 570 580 590 600
STQDTDLDLE MLAPYIPMDD DFQLRSFDQL SPLESSSASP ESASPQSTVT
610 620 630 640 650
VFQQTQIQEP TANATTTTAT TDELKTVTKD RMEDIKILIA SPSPTHIHKE
660 670 680 690 700
TTSATSSPYR DTQSRTASPN RAGKGVIEQT EKSHPRSPNV LSVALSQRTT
710 720 730 740 750
VPEEELNPKI LALQNAQRKR KMEHDGSLFQ AVGIGTLLQQ PDDHAATTSL
760 770 780 790 800
SWKRVKGCKS SEQNGMEQKT IILIPSDLAC RLLGQSMDES GLPQLTSYDC
810 820
EVNAPIQGSR NLLQGEELLR ALDQVN
Isoform 3 (identifier: Q16665-3) [UniParc]FASTAAdd to basket
Also known as: I.3
The sequence of this isoform differs from the canonical sequence as follows:
1-12: MEGAGGANDKKK → MSSQCRSLENKFVFLKEGLGNSKPEELEEIRIENGR
Note: Up-regulated in peripheral T-lymphocytes after T-cell receptor stimulation. Highest expression in peripheral blood leukocytes and thymus.
Show »Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Sequence conflicti | 572 | F → L in AAC68568 (PubMed:9782081).Curated | 1 |
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Natural variantiVAR_049541 | 582 | P → S. Corresponds to variant dbSNP:rs11549465Ensembl. | 1 | |
| Natural variantiVAR_049542 | 588 | A → T. Corresponds to variant dbSNP:rs11549467Ensembl. | 1 | |
| Natural variantiVAR_015854 | 796 | T → A. Corresponds to variant dbSNP:rs1802821Ensembl. | 1 |
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| Alternative sequenceiVSP_044942 | 1 – 12 | MEGAG…NDKKK → MSSQCRSLENKFVFLKEGLG NSKPEELEEIRIENGR in isoform 3. 1 PublicationAdd BLAST | 12 | |
| Alternative sequenceiVSP_047335 | 735 | G → I in isoform 2. 1 Publication | 1 | |
| Alternative sequenceiVSP_007738 | 736 – 826 | Missing in isoform 2. 1 PublicationAdd BLAST | 91 |
Sequence databases
| Select the link destinations: EMBLi GenBanki DDBJi Links Updated | U22431 mRNA. Translation: AAC50152.1. U29165 mRNA. Translation: AAC51210.1. AF050127 AF050126 Genomic DNA. Translation: AAC68568.1. FJ790247 mRNA. Translation: ACN88547.1. AF207601 mRNA. Translation: AAF20139.1. AF207602 mRNA. Translation: AAF20140.1. AF208487 Genomic DNA. Translation: AAF20149.1. AF304431 mRNA. Translation: AAG43026.1. AB073325 mRNA. Translation: BAB70608.1. BT009776 mRNA. Translation: AAP88778.1. AL137129 Genomic DNA. No translation available. BC012527 mRNA. Translation: AAH12527.1. |
| CCDSi | CCDS58324.1. [Q16665-3] CCDS9753.1. [Q16665-1] CCDS9754.1. [Q16665-2] |
| PIRi | I38972. |
| RefSeqi | NP_001230013.1. NM_001243084.1. [Q16665-3] NP_001521.1. NM_001530.3. [Q16665-1] NP_851397.1. NM_181054.2. [Q16665-2] |
| UniGenei | Hs.597216. Hs.719495. |
Genome annotation databases
| Ensembli | ENST00000323441; ENSP00000323326; ENSG00000100644. [Q16665-2] ENST00000337138; ENSP00000338018; ENSG00000100644. [Q16665-1] ENST00000539097; ENSP00000437955; ENSG00000100644. [Q16665-3] |
| GeneIDi | 3091. |
| KEGGi | hsa:3091. |
| UCSCi | uc001xfq.3. human. [Q16665-1] |
Keywords - Coding sequence diversityi
Alternative splicing, PolymorphismSimilar proteinsi
Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:| 100% | UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry. |
| 90% | UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence). |
| 50% | UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster. |
Entry informationi
| Entry namei | HIF1A_HUMAN | |
| Accessioni | Q16665Primary (citable) accession number: Q16665 Secondary accession number(s): C0LZJ3 Q9UPB1 | |
| Entry historyi | Integrated into UniProtKB/Swiss-Prot: | November 1, 1997 |
| Last sequence update: | November 1, 1996 | |
| Last modified: | July 5, 2017 | |
| This is version 206 of the entry and version 1 of the sequence. See complete history. | ||
| Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
Miscellaneousi
Keywords - Technical termi
3D-structure, Complete proteome, Direct protein sequencing, Reference proteomeDocuments
- Human chromosome 14
Human chromosome 14: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references
