Q16665 (HIF1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 160.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Hypoxia-inducible factor 1-alpha Short name=HIF-1-alpha Short name=HIF1-alpha Alternative name(s): ARNT-interacting protein Basic-helix-loop-helix-PAS protein MOP1 Class E basic helix-loop-helix protein 78 Short name=bHLHe78 Member of PAS protein 1 PAS domain-containing protein 8 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 826 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBPB and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP. Involved in the axonal distribution and transport of mitochondria in neurons during hypoxia. Ref.16 Ref.21 Ref.23 Ref.30 Ref.34 Ref.35 Ref.36 Ref.43 Ref.44 |
| Subunit structure | Interacts with the HIF1A beta/ARNT subunit; heterodimerization is required for DNA binding. Interacts with COPS5; the interaction increases the transcriptional activity of HIF1A through increased stability By similarity. Interacts with EP300 (via TAZ-type 1 domains); the interaction is stimulated in response to hypoxia and inhibited by CITED2. Interacts with CREBBP (via TAZ-type 1 domains). Interacts with NCOA1, NCOA2, APEX and HSP90. Interacts (hydroxylated within the ODD domain) with VHLL (via beta domain); the interaction, leads to polyubiquitination and subsequent HIF1A proteasomal degradation. During hypoxia, sumoylated HIF1A also binds VHL; the interaction promotes the ubiquitination of HIF1A. Interacts with SENP1; the interaction desumoylates HIF1A resulting in stabilization and activation of transcription. Interacts (Via the ODD domain) with ARD1A; the interaction appears not to acetylate HIF1A nor have any affect on protein stability, during hypoxia. Interacts with RWDD3; the interaction enhances HIF1A sumoylation. Interacts with TSGA10 By similarity. Interacts with RORA (via the DNA binding domain); the interaction enhances HIF1A transcription under hypoxia through increasing protein stability. Interaction with PSMA7 inhibits the transactivation activity of HIF1A under both normoxic and hypoxia-mimicking conditions. Interacts with USP20. Interacts with GNB2L1/RACK1; promotes HIF1A ubiquitination and proteasome-mediated degradation. Interacts (via N-terminus) with USP19. Ref.11 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.21 Ref.22 Ref.24 Ref.29 Ref.31 Ref.32 Ref.33 Ref.34 Ref.35 Ref.37 Ref.38 Ref.39 Ref.40 Ref.46 Ref.47 |
| Subcellular location | Cytoplasm. Nucleus. Note: Cytoplasmic in normoxia, nuclear translocation in response to hypoxia. Colocalizes with SUMO1 in the nucleus, under hypoxia. Ref.13 |
| Tissue specificity | Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors. |
| Induction | Under reduced oxygen tension. Induced also by various receptor-mediated factors such as growth factors, cytokines, and circulatory factors such as PDGF, EGF, FGF2, IGF2, TGFB1, HGF, TNF, IL1B/interleukin-1 beta, angiotensin-2 and thrombin. However, this induction is less intense than that stimulated by hypoxia. Repressed by HIPK2 and LIMD1. Ref.42 Ref.48 |
| Domain | Contains two independent C-terminal transactivation domains, NTAD and CTAD, which function synergistically. Their transcriptional activity is repressed by an intervening inhibitory domain (ID). Ref.12 Ref.14 Ref.15 |
| Post-translational modification | In normoxia, is hydroxylated on Pro-402 and Pro-564 in the oxygen-dependent degradation domain (ODD) by EGLN1/PHD1 and EGLN2/PHD2. EGLN3/PHD3 has also been shown to hydroxylate Pro-564. The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation. Deubiquitinated by USP20. Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization. In normoxia, is hydroxylated on Asn-803 by HIF1AN, thus abrogating interaction with CREBBP and EP300 and preventing transcriptional activation. This hydroxylation is inhibited by the Cu/Zn-chelator, Clioquinol. S-nitrosylation of Cys-800 may be responsible for increased recruitment of p300 coactivator necessary for transcriptional activity of HIF-1 complex. Requires phosphorylation for DNA-binding. Phosphorylation at Ser-247 by CSNK1D/CK1 represses kinase activity and impairs ARNT binding. Phosphorylation by GSK3-beta and PLK3 promote degradation by the proteasome. Sumoylated; with SUMO1 under hypoxia. Sumoylation is enhanced through interaction with RWDD3. Desumoylation by SENP1 leads to increased HIF1A stability and transriptional activity By similarity. Ref.30 Ref.36 Ref.37 Ubiquitinated; in normoxia, following hydroxylation and interaction with VHL. Lys-532 appears to be the principal site of ubiquitination. Clioquinol, the Cu/Zn-chelator, inhibits ubiquitination through preventing hydroxylation at Asn-803. Ref.14 Ref.20 Ref.21 Ref.23 Ref.32 Ref.35 Ref.39 The iron and 2-oxoglutarate dependent 3-hydroxylation of asparagine is (S) stereospecific within HIF CTAD domains. |
| Sequence similarities | Contains 1 bHLH (basic helix-loop-helix) domain. Contains 1 PAC (PAS-associated C-terminal) domain. Contains 2 PAS (PER-ARNT-SIM) domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AR | P10275 | 2 | EBI-447269,EBI-608057 | |
| ARNT | P27540 | 7 | EBI-447269,EBI-80809 | |
| ARRB1 | P49407 | 3 | EBI-447269,EBI-743313 | |
| EP300 | Q09472 | 5 | EBI-447269,EBI-447295 | |
| HIF1AN | Q9NWT6 | 3 | EBI-447269,EBI-745632 | |
| KAT2B | Q92831 | 2 | EBI-447269,EBI-477430 | |
| OS9 | Q13438 | 9 | EBI-447269,EBI-725454 | |
| PIAS4 | Q8N2W9 | 3 | EBI-447269,EBI-473160 | |
| PKM | P14618-1 | 7 | EBI-447269,EBI-4304679 | |
| Rbfox3 | Q8BIF2 | 2 | EBI-447269,EBI-4567146 | From a different organism. |
| Rorc | P51450-2 | 2 | EBI-447269,EBI-4422078 | From a different organism. |
| SEPT9 | Q9UHD8-1 | 4 | EBI-447269,EBI-851558 | |
| SUMO1 | P63165 | 2 | EBI-447269,EBI-80140 | |
| UBXN7 | O94888 | 3 | EBI-447269,EBI-1993627 | |
| VHL | P40337 | 6 | EBI-447269,EBI-301246 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16665-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16665-2) The sequence of this isoform differs from the canonical sequence as follows: 736-826: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q16665-3) Also known as: I.3; The sequence of this isoform differs from the canonical sequence as follows: 1-12: MEGAGGANDKKK → MSSQCRSLENKFVFLKEGLGNSKPEELEEIRIENGR | ||||||
| Note: Up-regulated in peripheral T lymphocytes after T-cell receptor stimulation. Highest expression in peripheral blood leukocytes and thymus. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 826 | 826 | Hypoxia-inducible factor 1-alpha | PRO_0000127220 | ||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||
| Domain | 17 – 70 | 54 | bHLH | |||||||||||||||||||||||||||||||||||||||||
| Domain | 85 – 158 | 74 | PAS 1 | |||||||||||||||||||||||||||||||||||||||||
| Domain | 228 – 298 | 71 | PAS 2 | |||||||||||||||||||||||||||||||||||||||||
| Domain | 302 – 345 | 44 | PAC | |||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 401 | 401 | Interaction with TSGA10 By similarity | |||||||||||||||||||||||||||||||||||||||||
| Region | 380 – 417 | 38 | N-terminal VHL recognition site | |||||||||||||||||||||||||||||||||||||||||
| Region | 401 – 603 | 203 | ODD | |||||||||||||||||||||||||||||||||||||||||
| Region | 531 – 575 | 45 | NTAD | |||||||||||||||||||||||||||||||||||||||||
| Region | 556 – 572 | 17 | C-terminal VHL recognition site | |||||||||||||||||||||||||||||||||||||||||
| Region | 576 – 785 | 210 | ID | |||||||||||||||||||||||||||||||||||||||||
| Region | 786 – 826 | 41 | CTAD | |||||||||||||||||||||||||||||||||||||||||
| Motif | 718 – 721 | 4 | Nuclear localization signal Potential | |||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 615 – 621 | 7 | Poly-Thr | |||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 247 | 1 | Phosphoserine; by CK1 Ref.46 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 402 | 1 | 4-hydroxyproline Ref.21 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 551 | 1 | Phosphoserine; by GSK3-beta Ref.45 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 555 | 1 | Phosphothreonine; by GSK3-beta Ref.45 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 564 | 1 | 4-hydroxyproline Ref.21 Ref.23 Ref.26 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 576 | 1 | Phosphoserine; by PLK3 Ref.45 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 589 | 1 | Phosphoserine; by GSK3-beta Ref.45 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 657 | 1 | Phosphoserine; by PLK3 Ref.45 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 800 | 1 | S-nitrosocysteine Probable | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 803 | 1 | (3S)-3-hydroxyasparagine Ref.25 | |||||||||||||||||||||||||||||||||||||||||
| Cross-link | 391 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.30 Ref.36 | ||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 477 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.30 Ref.36 | ||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 532 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Probable | ||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 538 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Probable | ||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 547 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Probable | ||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 12 | 12 | MEGAG…NDKKK → MSSQCRSLENKFVFLKEGLG NSKPEELEEIRIENGR in isoform 3. | VSP_044942 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 736 – 826 | 91 | Missing in isoform 2. | VSP_007738 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 582 | 1 | P → S. Corresponds to variant rs11549465 [ dbSNP | Ensembl ]. | VAR_049541 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 588 | 1 | A → T. Corresponds to variant rs11549467 [ dbSNP | Ensembl ]. | VAR_049542 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 796 | 1 | T → A. Corresponds to variant rs1802821 [ dbSNP | Ensembl ]. | VAR_015854 | ||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 247 | 1 | S → A: Constitutive kinase activity. Ref.46 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 247 | 1 | S → D: Impaired kinase activity. Ref.46 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 377 | 1 | K → R: No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-391; R-477 and R-532. Ref.30 Ref.36 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 389 | 1 | K → R: No change in sumoylation. Ref.30 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 391 | 1 | K → R: Abolishes 1 sumoylation. Abolishes 1 sumoylation; when associated with R-532. Abolishes 2 sumoylations; when associated with R-477. No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-377; R-477 and R-532. Ref.30 Ref.36 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 392 | 1 | K → R: No change in sumoylation. Ref.30 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 394 | 1 | P → A: No change in VHLE3-dependent ubiquitination. Ref.21 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 397 | 1 | L → A: Abolishes VHLE3-dependent ubiquitination; when associated with A-400. Ref.21 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 400 | 1 | L → A: Abolishes VHLE3-dependent ubiquitination; when associated with A-397. Ref.21 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 402 | 1 | P → A: Abolishes in VHLE3-dependent ubiquitination, abolishes oxygen-dependent regulation of VP16, partially reduced VHLE target site ubiquitination and no interaction with VHL. No VHLE target site ubiquitination; when associated with G-564. Ref.21 Ref.39 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 442 | 1 | K → R: No change in sumoylation. Ref.30 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 460 | 1 | K → R: No change in sumoylation nor in ARD1-mediated acetylation. Ref.30 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 477 | 1 | K → R: Abolishes 1 sumoylation. Abolishes 2 sumoylations; when associated with R-391. No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-377; R-391 and R-532. Ref.30 Ref.36 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 532 | 1 | K → R: Reduced ubiquitination. No change in sumoylation nor on interaction with ARD1A. No change in HIF1A protein turnover rate but increased transcriptional activity; when associated with R-377; R-391 and R-477. Complete loss of ubiquitination, but no change in VHL binding; when associated with K-538 and K-547. Ref.18 Ref.30 Ref.33 Ref.36 Ref.39 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 538 | 1 | K → R: No change in sumoylation, but reduced ubiquitination. Complete loss of ubiquitination, but no change in VHL binding; when associated with K-532 and K-547. Ref.18 Ref.30 Ref.39 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 547 | 1 | K → R: No change in sumoylation, but reduced ubiquitination. Complete loss of ubiquitination, but no change in VHL binding; when associated with K-532 and K-538. Ref.18 Ref.30 Ref.39 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 551 | 1 | S → G: Constitutive expression under nonhypoxic conditions by decreasing ubiquitination. Ref.20 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 552 | 1 | T → A: Constitutive expression under nonhypoxic conditions by decreasing ubiquitination. Ref.20 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 564 | 1 | P → G: No change in VHL-dependent ubiquitination. Partially reduced VHLE target site ubiquitination. No VHLE target site ubiquitination; when associated with A-402. Ref.21 Ref.39 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 576 | 1 | S → A: Induces stabilization of the protein. Ref.45 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 657 | 1 | S → A: Induces stabilization of the protein. Ref.45 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 719 | 1 | K → T: Dramatic reduction of accumulation in the nucleus in response to hypoxia. Ref.13 Ref.18 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 795 | 1 | L → A: Inhibits interaction with EP300 and transactivation activity. Ref.29 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 800 | 1 | C → A: Blocks increase in transcriptional activation caused by nitrosylation. Ref.15 Ref.27 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 800 | 1 | C → S: Abolishes hypoxia-inducible transcriptional activation of ctaD. Ref.15 Ref.27 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 803 | 1 | N → A: Recruits CREBBP. No enhancement of CREBBP by Clioquinol in the presence of FIH1. No change in nuclear location nor on repression of transcriptional activity in the presence of histone deacetylase inhibitor. Ref.34 Ref.35 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 572 | 1 | F → L in AAC68568. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 735 | 1 | G → I in BAB70608. Ref.7 | |||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 241 – 246 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 251 – 255 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 258 – 263 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 270 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 275 – 277 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 281 – 283 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 297 | 14 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 298 – 301 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 305 – 308 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 325 | 16 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 327 – 329 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 332 – 341 | 10 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 559 – 561 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 779 – 783 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 784 – 787 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 789 – 792 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 797 – 803 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 807 – 809 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 815 – 822 | 8 | ||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Hypoxia-inducible factor 1 is a basic-helix-loop-helix-PAS heterodimer regulated by cellular O2 tension." Wang G.L., Jiang B.-H., Rue E.A., Semenza G.L. Proc. Natl. Acad. Sci. U.S.A. 92:5510-5514(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 166-170; 259-289 AND 771-781. |
| [2] | "Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway." Hogenesch J.B., Chan W.K., Jackiw V.H., Brown R.C., Gu Y.-Z., Pray-Grant M., Perdew G.H., Bradfield C.A. J. Biol. Chem. 272:8581-8593(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Hepatoma. |
| [3] | "The human hypoxia-inducible factor 1alpha gene: HIF1A structure and evolutionary conservation." Iyer N.V., Leung S.W., Semenza G.L. Genomics 52:159-165(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [4] | "Preferential expression of the novel alternative isoform I.3 of hypoxia-inducible factor 1alpha in activated human T lymphocytes." Lukashev D., Sitkovsky M. Hum. Immunol. 69:421-425(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING. |
| [5] | "HIF1a sequence in the Quechua, a high altitude population." Rupert J.L., Hochachka P.W. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. |
| [6] | Sun B., Zhao H.R., Yu R.T., Ni M.S.H. Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Glial tumor. |
| [7] | "Hypoxia-inducible factor-1 alpha variant isolated from human liver tissue." Tanaka S., Sugimachi K. Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Liver. |
| [8] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [9] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Choriocarcinoma and Placenta. |
| [11] | "An essential role for p300/CBP in the cellular response to hypoxia." Arany Z., Huang L.E., Eckner R., Bhattacharya S., Jiang C., Goldberg M.A., Bunn H.F., Livingston D.M. Proc. Natl. Acad. Sci. U.S.A. 93:12969-12973(1996) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN COMPLEX WITH EP300 AND CREBBP, INTERACTION WITH EP300. |
| [12] | "Transactivation and inhibitory domains of hypoxia-inducible factor 1alpha. Modulation of transcriptional activity by oxygen tension." Jiang B.H., Zheng J.Z., Leung S.W., Roe R., Semenza G.L. J. Biol. Chem. 272:19253-19260(1997) [PubMed] [Europe PMC] [Abstract] Cited for: TRANSACTIVATION DOMAINS NTAD AND CTAD. |
| [13] | "Signal transduction in hypoxic cells: inducible nuclear translocation and recruitment of the CBP/p300 coactivator by the hypoxia-inducible factor-1alpha." Kallio P.J., Okamoto K., O'Brien S., Carrero P., Makino Y., Tanaka H., Poellinger L. EMBO J. 17:6573-6586(1998) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-719. |
| [14] | "Regulation of hypoxia-inducible factor 1alpha is mediated by an O2-dependent degradation domain via the ubiquitin-proteasome pathway." Huang L.E., Gu J., Schau M., Bunn H.F. Proc. Natl. Acad. Sci. U.S.A. 95:7987-7992(1998) [PubMed] [Europe PMC] [Abstract] Cited for: OXYGEN-DEPENDENT DEGRADATION DOMAIN. |
| [15] | "Molecular mechanisms of transcription activation by HLF and HIF1alpha in response to hypoxia: their stabilization and redox signal-induced interaction with CBP/p300." Ema M., Hirota K., Mimura J., Abe H., Yodoi J., Sogawa K., Poellinger L., Fujii-Kuriyama Y. EMBO J. 18:1905-1914(1999) [PubMed] [Europe PMC] [Abstract] Cited for: TRANSACTIVATION DOMAINS NTAD AND CTAD, INTERACTION WITH APEX, MUTAGENESIS OF CYS-800. |
| [16] | "Functional role of p35srj, a novel p300/CBP binding protein, during transactivation by HIF-1." Bhattacharya S., Michels C.M., Leung M.K., Arany Z.P., Kung A.L., Livingston D.M. Genes Dev. 13:64-75(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DNA-BINDING, INTERACTION WITH EP300. |
| [17] | "Drosophila von Hippel-Lindau tumor suppressor complex possesses E3 ubiquitin ligase activity." Aso T., Yamazaki K., Aigaki T., Kitajima S. Biochem. Biophys. Res. Commun. 276:355-361(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH VHL. |
| [18] | "Mechanism of regulation of the hypoxia-inducible factor-1 alpha by the von Hippel-Lindau tumor suppressor protein." Tanimoto K., Makino Y., Pereira T., Poellinger L. EMBO J. 19:4298-4309(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH VHL AND ARNT, MUTAGENESIS OF LYS-532; LYS-538; LYS-547 AND LYS-719. |
| [19] | "Redox-regulated recruitment of the transcriptional coactivators CREB-binding protein and SRC-1 to hypoxia-inducible factor 1alpha." Carrero P., Okamoto K., Coumailleau P., O'Brien S., Tanaka H., Poellinger L. Mol. Cell. Biol. 20:402-415(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NCOA1; NCOA2 AND APEX. |
| [20] | "Hypoxia-inducible factor 1alpha protein expression is controlled by oxygen-regulated ubiquitination that is disrupted by deletions and missense mutations." Sutter C.H., Laughner E., Semenza G.L. Proc. Natl. Acad. Sci. U.S.A. 97:4748-4753(2000) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF SER-551 AND THR-552, UBIQUITINATION. |
| [21] | "Independent function of two destruction domains in hypoxia-inducible factor-alpha chains activated by prolyl hydroxylation." Masson N., Willam C., Maxwell P.H., Pugh C.W., Ratcliffe P.J. EMBO J. 20:5197-5206(2001) [PubMed] [Europe PMC] [Abstract] Cited for: HYDROXYLATION AT PRO-402 AND PRO-564, UBIQUITINATION, INTERACTION WITH THE VHLE COMPLEX, FUNCTION, MUTAGENESIS OF PRO-394; LEU-397; LEU-400; PRO-402 AND PRO-564. |
| [22] | "Binding and regulation of HIF-1alpha by a subunit of the proteasome complex, PSMA7." Cho S., Choi Y.J., Kim J.M., Jeong S.T., Kim J.H., Kim S.H., Ryu S.E. FEBS Lett. 498:62-66(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PSMA7. |
| [23] | "Targeting of HIF-alpha to the von Hippel-Lindau ubiquitylation complex by O2-regulated prolyl hydroxylation." Jaakkola P., Mole D.R., Tian Y.-M., Wilson M.I., Gielbert J., Gaskell S.J., von Kriegsheim A., Hebestreit H.F., Mukherji M., Schofield C.J., Maxwell P.H., Pugh C.W., Ratcliffe P.J. Science 292:468-472(2001) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION, FUNCTION, HYDROXYLATION AT PRO-564. |
| [24] | "Regulation and destabilization of HIF-1alpha by ARD1-mediated acetylation." Jeong J.-W., Bae M.-K., Ahn M.-Y., Kim S.-H., Sohn T.-K., Bae M.-H., Yoo M.-A., Song E.-J., Lee K.-J., Kim K.-W. Cell 111:709-720(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARD1A. |
| [25] | "FIH-1 is an asparaginyl hydroxylase enzyme that regulates the transcriptional activity of hypoxia-inducible factor." Lando D., Peet D.J., Gorman J.J., Whelan D.A., Whitelaw M.L., Bruick R.K. Genes Dev. 16:1466-1471(2002) [PubMed] [Europe PMC] [Abstract] Cited for: HYDROXYLATION AT ASN-803, MASS SPECTROMETRY. |
| [26] | "Biochemical purification and pharmacological inhibition of a mammalian prolyl hydroxylase acting on hypoxia-inducible factor." Ivan M., Haberberger T., Gervasi D.C., Michelson K.S., Guenzler V., Kondo K., Yang H., Sorokina I., Conaway R.C., Conaway J.W., Kaelin W.G. Jr. Proc. Natl. Acad. Sci. U.S.A. 99:13459-13464(2002) [PubMed] [Europe PMC] [Abstract] Cited for: HYDROXYLATION AT PRO-564, MASS SPECTROMETRY. |
| [27] | "S-nitrosation of Cys-800 of HIF-1alpha protein activates its interaction with p300 and stimulates its transcriptional activity." Yasinska I.M., Sumbayev V.V. FEBS Lett. 549:105-109(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NITROSYLATION AT CYS-800, MUTAGENESIS OF CYS-800. |
| [28] | "HIF-1 alpha protein as a target for S-nitrosation." Sumbayev V.V., Budde A., Zhou J., Bruene B. FEBS Lett. 535:106-112(2003) [PubMed] [Europe PMC] [Abstract] Cited for: S-NITROSYLATION. |
| [29] | "Structural basis for negative regulation of hypoxia-inducible factor-1alpha by CITED2." Freedman S.J., Sun Z.Y., Kung A.L., France D.S., Wagner G., Eck M.J. Nat. Struct. Biol. 10:504-512(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EP300, MUTAGENESIS OF LEU-795. |
| [30] | "Sumoylation increases HIF-1alpha stability and its transcriptional activity." Bae S.-H., Jeong J.-W., Park J.A., Kim S.-H., Bae M.-K., Choi S.-J., Kim K.-W. Biochem. Biophys. Res. Commun. 324:394-400(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-391 AND LYS-477, FUNCTION, MUTAGENESIS OF LYS-389; LYS-391; LYS-392; LYS-442; LYS-460; LYS-477; LYS-532; LYS-538 AND LYS-547. |
| [31] | "Molecular cloning and characterization of the von Hippel-Lindau-like protein." Qi H., Gervais M.L., Li W., DeCaprio J.A., Challis J.R.G., Ohh M. Mol. Cancer Res. 2:43-52(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH VHLL. |
| [32] | "VHL protein-interacting deubiquitinating enzyme 2 deubiquitinates and stabilizes HIF-1alpha." Li Z., Wang D., Messing E.M., Wu G. EMBO Rep. 6:373-378(2005) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION, DEUBIQUITINATION BY USP20, INTERACTION WITH USP20. |
| [33] | "Interaction between HIF-1 alpha (ODD) and hARD1 does not induce acetylation and destabilization of HIF-1 alpha." Arnesen T., Kong X., Evjenth R., Gromyko D., Varhaug J.E., Lin Z., Sang N., Caro J., Lillehaug J.R. FEBS Lett. 579:6428-6432(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARD1A, MUTAGENESIS OF LYS-532. |
| [34] | "Histone deacetylase inhibitors repress the transactivation potential of hypoxia-inducible factors independently of direct acetylation of HIF-alpha." Fath D.M., Kong X., Liang D., Lin Z., Chou A., Jiang Y., Fang J., Caro J., Sang N. J. Biol. Chem. 281:13612-13619(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EP300 IN THE HIF1A/EP300/CREBBP COMPLEX, MUTAGENESIS OF ASN-803. |
| [35] | "Clioquinol, a Cu(II)/Zn(II) chelator, inhibits both ubiquitination and asparagine hydroxylation of hypoxia-inducible factor-1alpha, leading to expression of vascular endothelial growth factor and erythropoietin in normoxic cells." Choi S.M., Choi K.-O., Park Y.K., Cho H., Yang E.G., Park H. J. Biol. Chem. 281:34056-34063(2006) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION, HYDROXYLATION, FUNCTION, INTERACTION WITH CBPP, MASS SPECTROMETRY, MUTAGENESIS OF ASN-803. |
| [36] | "SUMOylation of hypoxia-inducible factor-1alpha reduces its transcriptional activity." Berta M.A., Mazure N., Hattab M., Pouyssegur J., Brahimi-Horn M.C. Biochem. Biophys. Res. Commun. 360:646-652(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-391 AND LYS-477, FUNCTION, MUTAGENESIS OF LYS-377; LYS-391; LYS-477 AND LYS-532. |
| [37] | "RSUME, a small RWD-containing protein, enhances SUMO conjugation and stabilizes HIF-1alpha during hypoxia." Carbia-Nagashima A., Gerez J., Perez-Castro C., Paez-Pereda M., Silberstein S., Stalla G.K., Holsboer F., Arzt E. Cell 131:309-323(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION, INTERACTION WITH RWDD3. |
| [38] | "RACK1 competes with HSP90 for binding to HIF-1alpha and is required for O(2)-independent and HSP90 inhibitor-induced degradation of HIF-1alpha." Liu Y.V., Baek J.H., Zhang H., Diez R., Cole R.N., Semenza G.L. Mol. Cell 25:207-217(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GNB2L1. |
| [39] | "HIF-1alpha and EPAS ubiquitination mediated by the VHL tumour suppressor involves flexibility in the ubiquitination mechanism, similar to other RING E3 ligases." Paltoglou S., Roberts B.J. Oncogene 26:604-609(2007) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION AT LYS-532; LYS-538 AND LYS-547, INTERACTION WITH VHL, MUTAGENESIS OF PRO-402; LYS-532; LYS-538; LYS-547 AND PRO-564. |
| [40] | "Transcriptional activation of HIF-1 by RORalpha and its role in hypoxia signaling." Kim E.J., Yoo Y.G., Yang W.K., Lim Y.S., Na T.Y., Lee I.K., Lee M.O. Arterioscler. Thromb. Vasc. Biol. 28:1796-1802(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RORA. |
| [41] | "Quantitative analysis of global ubiquitination in HeLa cells by mass spectrometry." Meierhofer D., Wang X., Huang L., Kaiser P. J. Proteome Res. 7:4566-4576(2008) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-538, MASS SPECTROMETRY. |
| [42] | "Transcriptional regulation of hypoxia-inducible factor 1alpha by HIPK2 suggests a novel mechanism to restrain tumor growth." Nardinocchi L., Puca R., Guidolin D., Belloni A.S., Bossi G., Michiels C., Sacchi A., Onisto M., D'Orazi G. Biochim. Biophys. Acta 1793:368-377(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION BY HIPK2. |
| [43] | "HUMMR, a hypoxia- and HIF-1alpha-inducible protein, alters mitochondrial distribution and transport." Li Y., Lim S., Hoffman D., Aspenstrom P., Federoff H.J., Rempe D.A. J. Cell Biol. 185:1065-1081(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN MITOCHONDRIAL TRANSPORT. |
| [44] | "Hypoxia-inducible protein 2 is a novel lipid droplet protein and a specific target gene of hypoxia-inducible factor-1." Gimm T., Wiese M., Teschemacher B., Deggerich A., Schodel J., Knaup K.X., Hackenbeck T., Hellerbrand C., Amann K., Wiesener M.S., Honing S., Eckardt K.U., Warnecke C. FASEB J. 24:4443-4458(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [45] | "Plk3 functions as an essential component of the hypoxia regulatory pathway by direct phosphorylation of HIF-1alpha." Xu D., Yao Y., Lu L., Costa M., Dai W. J. Biol. Chem. 285:38944-38950(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-551; THR-555; SER-576; SER-589 AND SER-657, MUTAGENESIS OF SER-576 AND SER-657. |
| [46] | "Casein kinase 1 regulates human hypoxia-inducible factor HIF-1." Kalousi A., Mylonis I., Politou A.S., Chachami G., Paraskeva E., Simos G. J. Cell Sci. 123:2976-2986(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-247 BY CSNK1D/CK1, MUTAGENESIS OF SER-247, INTERACTION WITH ARNT. |
| [47] | "Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1alpha (HIF-1alpha) during hypoxia." Altun M., Zhao B., Velasco K., Liu H., Hassink G., Paschke J., Pereira T., Lindsten K. J. Biol. Chem. 287:1962-1969(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH USP19. |
| [48] | "The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity." Foxler D.E., Bridge K.S., James V., Webb T.M., Mee M., Wong S.C., Feng Y., Constantin-Teodosiu D., Petursdottir T.E., Bjornsson J., Ingvarsson S., Ratcliffe P.J., Longmore G.D., Sharp T.V. Nat. Cell Biol. 14:201-208(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [49] | "A model for the complex between the hypoxia-inducible factor-1 (HIF-1) and its consensus DNA sequence." Michel G., Minet E., Ernest I., Roland I., Durant F., Remacle J., Michiels C. J. Biomol. Struct. Dyn. 18:169-179(2000) [PubMed] [Europe PMC] [Abstract] Cited for: 3D-STRUCTURE MODELING. |
| [50] | "Structure of factor-inhibiting hypoxia-inducible factor (HIF) reveals mechanism of oxidative modification of HIF-1 alpha." Elkins J.M., Hewitson K.S., McNeill L.A., Seibel J.F., Schlemminger I., Pugh C.W., Ratcliffe P.J., Schofield C.J. J. Biol. Chem. 278:1802-1806(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 775-826 IN COMPLEX WITH HIF1AN. |
| [51] | "Structural basis for recruitment of CBP/p300 by hypoxia-inducible factor-1 alpha." Freedman S.J., Sun Z.-Y.J., Poy F., Kung A.L., Livingston D.M., Wagner G., Eck M.J. Proc. Natl. Acad. Sci. U.S.A. 99:5367-5372(2002) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 786-826 IN COMPLEX WITH 302-418 OF EP300. |
| [52] | "Structural basis for Hif-1 alpha /CBP recognition in the cellular hypoxic response." Dames S.A., Martinez-Yamout M., De Guzman R.N., Dyson H.J., Wright P.E. Proc. Natl. Acad. Sci. U.S.A. 99:5271-5276(2002) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 776-826 IN COMPLEX WITH 345-439 OF CREBBP. |
| [53] | "Structure of an HIF-1alpha-pVHL complex: hydroxyproline recognition in signaling." Min J.-H., Yang H., Ivan M., Gertler F., Kaelin W.G. Jr., Pavletich N.P. Science 296:1886-1889(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 556-575 IN COMPLEX WITH TCEB1; TCEB2 AND 54-213 OF VHL. |
| [54] | "Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL." Hon W.-C., Wilson M.I., Harlos K., Claridge T.D.W., Schofield C.J., Pugh C.W., Maxwell P.H., Ratcliffe P.J., Stuart D.I., Jones E.Y. Nature 417:975-978(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 549-582 IN COMPLEX WITH 17-112 OF TCEB1; TCEB2 AND 52-213 OF VHL. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Hypoxia inducible factor entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U22431 mRNA. Translation: AAC50152.1. U29165 mRNA. Translation: AAC51210.1. AF050127 AF050126 Genomic DNA. Translation: AAC68568.1.FJ790247 mRNA. Translation: ACN88547.1. AF207601 mRNA. Translation: AAF20139.1. AF207602 mRNA. Translation: AAF20140.1. AF208487 Genomic DNA. Translation: AAF20149.1. AF304431 mRNA. Translation: AAG43026.1. AB073325 mRNA. Translation: BAB70608.1. BT009776 mRNA. Translation: AAP88778.1. AL137129 Genomic DNA. No translation available. BC012527 mRNA. Translation: AAH12527.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00003442. IPI00332963. IPI00788876. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | I38972. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001230013.1. NM_001243084.1. NP_001521.1. NM_001530.3. NP_851397.1. NM_181054.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.597216. Hs.719495. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DisProt | DP00262. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29722N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q16665. 29 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-133270. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000338018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 2498017. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 3091. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000323441; ENSP00000323326; ENSG00000100644. ENST00000337138; ENSP00000338018; ENSG00000100644. ENST00000539097; ENSP00000437955; ENSG00000100644. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 3091. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:3091. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001xfq.2. human. uc021rua.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 3091. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC14P062162. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:4910. HIF1A. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB017442. HPA001275. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 603348. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA29283. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG289264. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000234306. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG060456. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K08268. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | QNAQRKR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG40CHGP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | hif1_tfpathway. HIF-1-alpha transcription factor network. hif1apathway. Hypoxic and oxygen homeostasis regulation of HIF-1-alpha. pdgfrbpathway. PDGFR-beta signaling pathway. vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. vegfr1_pathway. VEGFR1 specific signals. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_120956. Cellular responses to stress. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SignaLink | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_HIF1A. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000100644. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011598. bHLH_dom. IPR001321. HIF-1_alpha. IPR014887. HIF-1_TAD_C. IPR021537. HIF_alpha_subunit. IPR001610. PAC. IPR000014. PAS. IPR013767. PAS_fold. IPR013655. PAS_fold_3. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF11413. HIF-1. 1 hit. PF08778. HIF-1a_CTAD. 1 hit. PF00989. PAS. 1 hit. PF08447. PAS_3. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01080. HYPOXIAIF1A. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00353. HLH. 1 hit. SM00086. PAC. 1 hit. SM00091. PAS. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47459. HLH_basic. 1 hit. SSF55785. SSF55785. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR00229. sensory_box. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50888. BHLH. 1 hit. PS50113. PAC. False negative. PS50112. PAS. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4261. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | HIF1A. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q16665. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 3091. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 12265. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | HIF1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16665 Secondary accession number(s): C0LZJ3 Q9UPB1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
