Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q16653

- MOG_HUMAN

UniProt

Q16653 - MOG_HUMAN

Protein

Myelin-oligodendrocyte glycoprotein

Gene

MOG

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 133 (01 Oct 2014)
      Sequence version 2 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mediates homophilic cell-cell adhesion By similarity. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.By similarity

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW
    2. central nervous system development Source: ProtInc
    3. positive regulation of MyD88-dependent toll-like receptor signaling pathway Source: BHF-UCL

    Keywords - Biological processi

    Cell adhesion

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Myelin-oligodendrocyte glycoprotein
    Gene namesi
    Name:MOG
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:7197. MOG.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Narcolepsy 7 (NRCLP7) [MIM:614250]: Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti133 – 1331S → C in NRCLP7. 1 Publication
    VAR_066415

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi614250. phenotype.
    Orphaneti2073. Narcolepsy-cataplexy.
    PharmGKBiPA30905.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Chaini30 – 247218Myelin-oligodendrocyte glycoproteinPRO_0000014888Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi53 ↔ 127PROSITE-ProRule annotation
    Glycosylationi60 – 601N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ16653.
    PRIDEiQ16653.

    PTM databases

    PhosphoSiteiQ16653.

    Expressioni

    Tissue specificityi

    Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

    Gene expression databases

    ArrayExpressiQ16653.
    BgeeiQ16653.
    GenevestigatoriQ16653.

    Organism-specific databases

    HPAiHPA021873.

    Interactioni

    Subunit structurei

    Homodimer By similarity. May form heterodimers between the different isoforms.By similarity

    Protein-protein interaction databases

    BioGridi110482. 1 interaction.
    IntActiQ16653. 1 interaction.

    Structurei

    Secondary structure

    1
    247
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi42 – 443
    Beta strandi66 – 694
    Turni71 – 733
    Beta strandi74 – 807
    Beta strandi82 – 854
    Beta strandi87 – 926
    Beta strandi96 – 1005
    Beta strandi104 – 1096
    Beta strandi112 – 1143
    Beta strandi125 – 1284
    Beta strandi131 – 1333
    Beta strandi138 – 1403
    Beta strandi143 – 1453

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1Q70model-A31-149[»]
    ProteinModelPortaliQ16653.
    SMRiQ16653. Positions 30-147.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini30 – 154125ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini176 – 21035CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini232 – 24716ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei155 – 17521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei211 – 23121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini32 – 145114Ig-like V-typeAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG146805.
    HOVERGENiHBG004565.
    KOiK17270.
    OMAiLRVEDPF.
    PhylomeDBiQ16653.
    TreeFamiTF331083.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013106. Ig_V-set.
    IPR003596. Ig_V-set_subgr.
    IPR016663. Myelin-oligodendrocyte_glycop.
    [Graphical view]
    PfamiPF07686. V-set. 1 hit.
    [Graphical view]
    PIRSFiPIRSF016522. MOG. 1 hit.
    SMARTiSM00406. IGv. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (13)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 13 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q16653-1) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASLSRPSLP SCLCSFLLLL LLQVSSSYAG QFRVIGPRHP IRALVGDEVE    50
    LPCRISPGKN ATGMEVGWYR PPFSRVVHLY RNGKDQDGDQ APEYRGRTEL 100
    LKDAIGEGKV TLRIRNVRFS DEGGFTCFFR DHSYQEEAAM ELKVEDPFYW 150
    VSPGVLVLLA VLPVLLLQIT VGLIFLCLQY RLRGKLRAEI ENLHRTFDPH 200
    FLRVPCWKIT LFVIVPVLGP LVALIICYNW LHRRLAGQFL EELRNPF 247
    Length:247
    Mass (Da):28,193
    Last modified:January 11, 2011 - v2
    Checksum:i846EBA5D412C080C
    GO
    Isoform 2 (identifier: Q16653-2) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-2

    The sequence of this isoform differs from the canonical sequence as follows:
         198-236: Missing.

    Show »
    Length:208
    Mass (Da):23,627
    Checksum:i8053FA07957A1963
    GO
    Isoform 3 (identifier: Q16653-3) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-3

    The sequence of this isoform differs from the canonical sequence as follows:
         198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

    Show »
    Length:224
    Mass (Da):25,353
    Checksum:iEF7BA1567A69FB33
    GO
    Isoform 4 (identifier: Q16653-4) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-4

    The sequence of this isoform differs from the canonical sequence as follows:
         30-145: Missing.

    Show »
    Length:131
    Mass (Da):14,988
    Checksum:i80B843738BF1ED47
    GO
    Isoform 5 (identifier: Q16653-5) [UniParc]FASTAAdd to Basket

    Also known as: Beta-1

    The sequence of this isoform differs from the canonical sequence as follows:
         244-247: RNPF → LFHLEALSG

    Show »
    Length:252
    Mass (Da):28,647
    Checksum:iD41E3A6050BA9837
    GO
    Isoform 6 (identifier: Q16653-6) [UniParc]FASTAAdd to Basket

    Also known as: Beta-2

    The sequence of this isoform differs from the canonical sequence as follows:
         198-236: Missing.
         244-247: RNPF → LFHLEALSG

    Show »
    Length:213
    Mass (Da):24,081
    Checksum:iAD5788DAB32EA577
    GO
    Isoform 7 (identifier: Q16653-7) [UniParc]FASTAAdd to Basket

    Also known as: Beta-3

    The sequence of this isoform differs from the canonical sequence as follows:
         198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT
         244-247: RNPF → LFHLEALSG

    Show »
    Length:229
    Mass (Da):25,807
    Checksum:iDB6C018BA4418D2C
    GO
    Isoform 8 (identifier: Q16653-8) [UniParc]FASTAAdd to Basket

    Also known as: Beta-4

    The sequence of this isoform differs from the canonical sequence as follows:
         198-243: Missing.
         244-247: RNPF → LFHLEALSG

    Show »
    Length:206
    Mass (Da):23,264
    Checksum:i54D1257CD963AD8E
    GO
    Isoform 9 (identifier: Q16653-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         198-203: DPHFLR → GKFRHV
         204-247: Missing.

    Note: Not functionally active. May be expressed at low level in the adult.

    Show »
    Length:203
    Mass (Da):23,021
    Checksum:i33C38085A4D22627
    GO
    Isoform 10 (identifier: Q16653-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         146-171: DPFYWVSPGVLVLLAVLPVLLLQITV → VSHSVTQDWLQWHDHGSLQPPPPRLK
         172-247: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:171
    Mass (Da):19,334
    Checksum:iE65BA3858848F8E8
    GO
    Isoform 11 (identifier: Q16653-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         198-247: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF → VFHLEALSG

    Show »
    Length:206
    Mass (Da):23,250
    Checksum:i4823257CD963AD8E
    GO
    Isoform 12 (identifier: Q16653-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         30-145: Missing.
         198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

    Show »
    Length:108
    Mass (Da):12,149
    Checksum:iEB06EC1E6C59C842
    GO
    Isoform 13 (identifier: Q16653-13) [UniParc]FASTAAdd to Basket

    Also known as: X1

    The sequence of this isoform differs from the canonical sequence as follows:
         245-247: NPF → KFSSLCYKQRIKSQERETEATRGRGGLLRDHIPRGKEELESLGGGKTPPGR

    Note: No experimental confirmation available.

    Show »
    Length:295
    Mass (Da):33,528
    Checksum:i2310179859868716
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti133 – 1331S → C in NRCLP7. 1 Publication
    VAR_066415
    Natural varianti171 – 1711V → L.2 Publications
    Corresponds to variant rs2857766 [ dbSNP | Ensembl ].
    VAR_056056
    Natural varianti174 – 1741I → V.10 Publications
    Corresponds to variant rs3130253 [ dbSNP | Ensembl ].
    VAR_060215

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei30 – 145116Missing in isoform 4 and isoform 12. 1 PublicationVSP_002539Add
    BLAST
    Alternative sequencei146 – 17126DPFYW…LQITV → VSHSVTQDWLQWHDHGSLQP PPPRLK in isoform 10. 1 PublicationVSP_040344Add
    BLAST
    Alternative sequencei172 – 24776Missing in isoform 10. 1 PublicationVSP_040345Add
    BLAST
    Alternative sequencei198 – 24750DPHFL…LRNPF → VFHLEALSG in isoform 11. 1 PublicationVSP_046856Add
    BLAST
    Alternative sequencei198 – 24346Missing in isoform 8. CuratedVSP_002544Add
    BLAST
    Alternative sequencei198 – 23639Missing in isoform 2 and isoform 6. CuratedVSP_002543Add
    BLAST
    Alternative sequencei198 – 23639DPHFL…HRRLA → ESFGVLGPQVKEPKKT in isoform 3, isoform 7 and isoform 12. 1 PublicationVSP_002542Add
    BLAST
    Alternative sequencei198 – 2036DPHFLR → GKFRHV in isoform 9. CuratedVSP_002540
    Alternative sequencei204 – 24744Missing in isoform 9. CuratedVSP_002541Add
    BLAST
    Alternative sequencei244 – 2474RNPF → LFHLEALSG in isoform 5, isoform 6, isoform 7 and isoform 8. CuratedVSP_002545
    Alternative sequencei245 – 2473NPF → KFSSLCYKQRIKSQERETEA TRGRGGLLRDHIPRGKEELE SLGGGKTPPGR in isoform 13. 1 PublicationVSP_055600

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X74511 mRNA. Translation: CAA52617.1.
    Z48051 Genomic DNA. Translation: CAA88109.1.
    U18840 mRNA. Translation: AAC50361.1.
    U18843 mRNA. Translation: AAC50362.1.
    U18798 mRNA. Translation: AAC50876.1.
    U18799 mRNA. Translation: AAC50877.1.
    U18800 mRNA. Translation: AAB36870.1.
    U18801 mRNA. Translation: AAC50878.1.
    U18803 mRNA. Translation: AAC50879.1.
    U64564 mRNA. Translation: AAB08088.1.
    U64565 mRNA. Translation: AAB08089.1.
    U64566 mRNA. Translation: AAB08090.1.
    U64567 mRNA. Translation: AAB08091.1.
    U64568 mRNA. Translation: AAB08092.1.
    U64569 mRNA. Translation: AAB08093.1.
    U64570 mRNA. Translation: AAB08094.1.
    U64571 mRNA. Translation: AAB08095.1.
    AK312892 mRNA. Translation: BAG35739.1.
    AL050328 Genomic DNA. Translation: CAB89267.1.
    AL050328 Genomic DNA. Translation: CAB89268.1.
    AL050328 Genomic DNA. Translation: CAB89269.1.
    AL050328 Genomic DNA. Translation: CAB89270.1.
    AL050328 Genomic DNA. Translation: CAB89271.1.
    AL662826 Genomic DNA. Translation: CAI17395.2.
    AL662826, AL669813 Genomic DNA. Translation: CAI17396.1.
    AL662826, AL669813 Genomic DNA. Translation: CAI17397.1.
    AL662826 Genomic DNA. Translation: CAI17400.3.
    AL669813, AL662826 Genomic DNA. Translation: CAI17636.2.
    AL669813, AL662826 Genomic DNA. Translation: CAI17637.1.
    AL645936 Genomic DNA. Translation: CAI18020.1.
    AL645936 Genomic DNA. Translation: CAI18021.1.
    AL645936 Genomic DNA. Translation: CAI18022.2.
    AL645936 Genomic DNA. Translation: CAI18023.1.
    AL645936 Genomic DNA. Translation: CAI18024.1.
    AL929591 Genomic DNA. Translation: CAI41911.2.
    AL929591 Genomic DNA. Translation: CAI41914.2.
    AL929591 Genomic DNA. Translation: CAI41917.1.
    BX120002 Genomic DNA. Translation: CAI95560.2.
    BX120002 Genomic DNA. Translation: CAI95564.1.
    BX120002 Genomic DNA. Translation: CAI95565.1.
    BX120002 Genomic DNA. Translation: CAI95568.2.
    AL929591 Genomic DNA. Translation: CAM25818.1.
    CR759766 Genomic DNA. Translation: CAQ06614.1.
    CR388408 Genomic DNA. Translation: CAQ08208.1.
    CR388408 Genomic DNA. Translation: CAQ08210.1.
    CR388408 Genomic DNA. Translation: CAQ08212.1.
    CR388408 Genomic DNA. Translation: CAQ08213.1.
    CR936483 Genomic DNA. Translation: CAQ10086.1.
    CR936483 Genomic DNA. Translation: CAQ10088.1.
    CR936483 Genomic DNA. Translation: CAQ10090.1.
    CR936483 Genomic DNA. Translation: CAQ10091.1.
    BX927250 Genomic DNA. Translation: CAQ10709.1.
    BX927250 Genomic DNA. Translation: CAQ10711.1.
    BX927250 Genomic DNA. Translation: CAQ10713.1.
    BX927250 Genomic DNA. Translation: CAQ10714.1.
    CH471081 Genomic DNA. Translation: EAX03213.1.
    CH471081 Genomic DNA. Translation: EAX03214.1.
    CH471081 Genomic DNA. Translation: EAX03216.1.
    CH471081 Genomic DNA. Translation: EAX03217.1.
    BC035938 mRNA. Translation: AAH35938.1.
    AY566847 mRNA. Translation: AAU09338.1.
    AY566853 mRNA. Translation: AAU09343.1.
    CCDSiCCDS34366.1. [Q16653-7]
    CCDS34367.1. [Q16653-6]
    CCDS34368.1. [Q16653-11]
    CCDS34369.1. [Q16653-3]
    CCDS34370.1. [Q16653-1]
    CCDS4667.1. [Q16653-5]
    CCDS47394.1. [Q16653-2]
    CCDS47395.2. [Q16653-4]
    CCDS54977.1. [Q16653-12]
    PIRiS58394.
    RefSeqiNP_001008229.1. NM_001008228.2. [Q16653-3]
    NP_001008230.1. NM_001008229.2. [Q16653-11]
    NP_001163889.1. NM_001170418.1. [Q16653-12]
    NP_002424.3. NM_002433.4. [Q16653-5]
    NP_996532.2. NM_206809.3. [Q16653-1]
    NP_996533.2. NM_206810.3. [Q16653-6]
    NP_996534.2. NM_206811.3. [Q16653-7]
    NP_996535.2. NM_206812.3. [Q16653-2]
    NP_996537.3. NM_206814.5. [Q16653-4]
    UniGeneiHs.141308.

    Genome annotation databases

    EnsembliENST00000259891; ENSP00000259891; ENSG00000137345.
    ENST00000359539; ENSP00000352534; ENSG00000137345.
    ENST00000376888; ENSP00000366085; ENSG00000204655. [Q16653-4]
    ENST00000376891; ENSP00000366088; ENSG00000204655. [Q16653-11]
    ENST00000376894; ENSP00000366091; ENSG00000204655. [Q16653-13]
    ENST00000376898; ENSP00000366095; ENSG00000204655. [Q16653-5]
    ENST00000376917; ENSP00000366115; ENSG00000204655. [Q16653-1]
    ENST00000383521; ENSP00000373013; ENSG00000237834.
    ENST00000383525; ENSP00000373017; ENSG00000237834.
    ENST00000383630; ENSP00000373126; ENSG00000137345.
    ENST00000383631; ENSP00000373127; ENSG00000137345.
    ENST00000396701; ENSP00000379929; ENSG00000204655. [Q16653-6]
    ENST00000396704; ENSP00000379932; ENSG00000204655. [Q16653-3]
    ENST00000400669; ENSP00000383510; ENSG00000237834.
    ENST00000400671; ENSP00000383512; ENSG00000237834.
    ENST00000400688; ENSP00000383526; ENSG00000137345.
    ENST00000400691; ENSP00000383528; ENSG00000137345.
    ENST00000412760; ENSP00000404245; ENSG00000237834.
    ENST00000414889; ENSP00000403380; ENSG00000234623.
    ENST00000415546; ENSP00000404149; ENSG00000234096.
    ENST00000417019; ENSP00000404537; ENSG00000234096.
    ENST00000419274; ENSP00000411489; ENSG00000236561.
    ENST00000419309; ENSP00000395005; ENSG00000236561.
    ENST00000420045; ENSP00000390682; ENSG00000234096.
    ENST00000423895; ENSP00000390632; ENSG00000230885.
    ENST00000425145; ENSP00000397101; ENSG00000234623.
    ENST00000426782; ENSP00000410699; ENSG00000230885.
    ENST00000427289; ENSP00000414489; ENSG00000230885.
    ENST00000428719; ENSP00000397723; ENSG00000234096.
    ENST00000430264; ENSP00000403058; ENSG00000234623.
    ENST00000430351; ENSP00000410268; ENSG00000234096.
    ENST00000431798; ENSP00000410866; ENSG00000204655. [Q16653-2]
    ENST00000432271; ENSP00000389221; ENSG00000234623.
    ENST00000433500; ENSP00000413364; ENSG00000236561.
    ENST00000434177; ENSP00000398197; ENSG00000234623.
    ENST00000438803; ENSP00000414862; ENSG00000236561.
    ENST00000439634; ENSP00000404957; ENSG00000234096.
    ENST00000439884; ENSP00000398394; ENSG00000237834.
    ENST00000440561; ENSP00000409534; ENSG00000230885.
    ENST00000442244; ENSP00000391516; ENSG00000236561.
    ENST00000442444; ENSP00000414146; ENSG00000137345.
    ENST00000442629; ENSP00000399240; ENSG00000234623.
    ENST00000444674; ENSP00000390469; ENSG00000230885.
    ENST00000447285; ENSP00000401609; ENSG00000236561.
    ENST00000448816; ENSP00000397837; ENSG00000237834.
    ENST00000449096; ENSP00000391898; ENSG00000234096.
    ENST00000452233; ENSP00000394873; ENSG00000234623.
    ENST00000452744; ENSP00000389022; ENSG00000232641.
    ENST00000457090; ENSP00000415883; ENSG00000236561.
    ENST00000457626; ENSP00000402139; ENSG00000230885.
    ENST00000458179; ENSP00000413370; ENSG00000230885.
    ENST00000490427; ENSP00000420350; ENSG00000204655. [Q16653-12]
    ENST00000494692; ENSP00000417405; ENSG00000204655. [Q16653-7]
    ENST00000547083; ENSP00000449213; ENSG00000137345.
    ENST00000548017; ENSP00000448732; ENSG00000234096.
    ENST00000550849; ENSP00000449683; ENSG00000237834.
    ENST00000551175; ENSP00000448879; ENSG00000234623.
    ENST00000551993; ENSP00000446871; ENSG00000230885.
    ENST00000553111; ENSP00000447099; ENSG00000236561.
    GeneIDi4340.
    KEGGihsa:4340.
    UCSCiuc003nna.3. human. [Q16653-4]
    uc003nne.3. human. [Q16653-5]
    uc003nnf.3. human. [Q16653-1]
    uc003nng.3. human. [Q16653-7]
    uc003nnh.3. human. [Q16653-6]
    uc003nni.3. human. [Q16653-3]
    uc003nnj.3. human. [Q16653-2]

    Polymorphism databases

    DMDMi317373391.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Myelin oligodendrocyte glycoprotein entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X74511 mRNA. Translation: CAA52617.1 .
    Z48051 Genomic DNA. Translation: CAA88109.1 .
    U18840 mRNA. Translation: AAC50361.1 .
    U18843 mRNA. Translation: AAC50362.1 .
    U18798 mRNA. Translation: AAC50876.1 .
    U18799 mRNA. Translation: AAC50877.1 .
    U18800 mRNA. Translation: AAB36870.1 .
    U18801 mRNA. Translation: AAC50878.1 .
    U18803 mRNA. Translation: AAC50879.1 .
    U64564 mRNA. Translation: AAB08088.1 .
    U64565 mRNA. Translation: AAB08089.1 .
    U64566 mRNA. Translation: AAB08090.1 .
    U64567 mRNA. Translation: AAB08091.1 .
    U64568 mRNA. Translation: AAB08092.1 .
    U64569 mRNA. Translation: AAB08093.1 .
    U64570 mRNA. Translation: AAB08094.1 .
    U64571 mRNA. Translation: AAB08095.1 .
    AK312892 mRNA. Translation: BAG35739.1 .
    AL050328 Genomic DNA. Translation: CAB89267.1 .
    AL050328 Genomic DNA. Translation: CAB89268.1 .
    AL050328 Genomic DNA. Translation: CAB89269.1 .
    AL050328 Genomic DNA. Translation: CAB89270.1 .
    AL050328 Genomic DNA. Translation: CAB89271.1 .
    AL662826 Genomic DNA. Translation: CAI17395.2 .
    AL662826 , AL669813 Genomic DNA. Translation: CAI17396.1 .
    AL662826 , AL669813 Genomic DNA. Translation: CAI17397.1 .
    AL662826 Genomic DNA. Translation: CAI17400.3 .
    AL669813 , AL662826 Genomic DNA. Translation: CAI17636.2 .
    AL669813 , AL662826 Genomic DNA. Translation: CAI17637.1 .
    AL645936 Genomic DNA. Translation: CAI18020.1 .
    AL645936 Genomic DNA. Translation: CAI18021.1 .
    AL645936 Genomic DNA. Translation: CAI18022.2 .
    AL645936 Genomic DNA. Translation: CAI18023.1 .
    AL645936 Genomic DNA. Translation: CAI18024.1 .
    AL929591 Genomic DNA. Translation: CAI41911.2 .
    AL929591 Genomic DNA. Translation: CAI41914.2 .
    AL929591 Genomic DNA. Translation: CAI41917.1 .
    BX120002 Genomic DNA. Translation: CAI95560.2 .
    BX120002 Genomic DNA. Translation: CAI95564.1 .
    BX120002 Genomic DNA. Translation: CAI95565.1 .
    BX120002 Genomic DNA. Translation: CAI95568.2 .
    AL929591 Genomic DNA. Translation: CAM25818.1 .
    CR759766 Genomic DNA. Translation: CAQ06614.1 .
    CR388408 Genomic DNA. Translation: CAQ08208.1 .
    CR388408 Genomic DNA. Translation: CAQ08210.1 .
    CR388408 Genomic DNA. Translation: CAQ08212.1 .
    CR388408 Genomic DNA. Translation: CAQ08213.1 .
    CR936483 Genomic DNA. Translation: CAQ10086.1 .
    CR936483 Genomic DNA. Translation: CAQ10088.1 .
    CR936483 Genomic DNA. Translation: CAQ10090.1 .
    CR936483 Genomic DNA. Translation: CAQ10091.1 .
    BX927250 Genomic DNA. Translation: CAQ10709.1 .
    BX927250 Genomic DNA. Translation: CAQ10711.1 .
    BX927250 Genomic DNA. Translation: CAQ10713.1 .
    BX927250 Genomic DNA. Translation: CAQ10714.1 .
    CH471081 Genomic DNA. Translation: EAX03213.1 .
    CH471081 Genomic DNA. Translation: EAX03214.1 .
    CH471081 Genomic DNA. Translation: EAX03216.1 .
    CH471081 Genomic DNA. Translation: EAX03217.1 .
    BC035938 mRNA. Translation: AAH35938.1 .
    AY566847 mRNA. Translation: AAU09338.1 .
    AY566853 mRNA. Translation: AAU09343.1 .
    CCDSi CCDS34366.1. [Q16653-7 ]
    CCDS34367.1. [Q16653-6 ]
    CCDS34368.1. [Q16653-11 ]
    CCDS34369.1. [Q16653-3 ]
    CCDS34370.1. [Q16653-1 ]
    CCDS4667.1. [Q16653-5 ]
    CCDS47394.1. [Q16653-2 ]
    CCDS47395.2. [Q16653-4 ]
    CCDS54977.1. [Q16653-12 ]
    PIRi S58394.
    RefSeqi NP_001008229.1. NM_001008228.2. [Q16653-3 ]
    NP_001008230.1. NM_001008229.2. [Q16653-11 ]
    NP_001163889.1. NM_001170418.1. [Q16653-12 ]
    NP_002424.3. NM_002433.4. [Q16653-5 ]
    NP_996532.2. NM_206809.3. [Q16653-1 ]
    NP_996533.2. NM_206810.3. [Q16653-6 ]
    NP_996534.2. NM_206811.3. [Q16653-7 ]
    NP_996535.2. NM_206812.3. [Q16653-2 ]
    NP_996537.3. NM_206814.5. [Q16653-4 ]
    UniGenei Hs.141308.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1Q70 model - A 31-149 [» ]
    ProteinModelPortali Q16653.
    SMRi Q16653. Positions 30-147.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110482. 1 interaction.
    IntActi Q16653. 1 interaction.

    Protein family/group databases

    MEROPSi I43.001.

    PTM databases

    PhosphoSitei Q16653.

    Polymorphism databases

    DMDMi 317373391.

    Proteomic databases

    PaxDbi Q16653.
    PRIDEi Q16653.

    Protocols and materials databases

    DNASUi 4340.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000259891 ; ENSP00000259891 ; ENSG00000137345 .
    ENST00000359539 ; ENSP00000352534 ; ENSG00000137345 .
    ENST00000376888 ; ENSP00000366085 ; ENSG00000204655 . [Q16653-4 ]
    ENST00000376891 ; ENSP00000366088 ; ENSG00000204655 . [Q16653-11 ]
    ENST00000376894 ; ENSP00000366091 ; ENSG00000204655 . [Q16653-13 ]
    ENST00000376898 ; ENSP00000366095 ; ENSG00000204655 . [Q16653-5 ]
    ENST00000376917 ; ENSP00000366115 ; ENSG00000204655 . [Q16653-1 ]
    ENST00000383521 ; ENSP00000373013 ; ENSG00000237834 .
    ENST00000383525 ; ENSP00000373017 ; ENSG00000237834 .
    ENST00000383630 ; ENSP00000373126 ; ENSG00000137345 .
    ENST00000383631 ; ENSP00000373127 ; ENSG00000137345 .
    ENST00000396701 ; ENSP00000379929 ; ENSG00000204655 . [Q16653-6 ]
    ENST00000396704 ; ENSP00000379932 ; ENSG00000204655 . [Q16653-3 ]
    ENST00000400669 ; ENSP00000383510 ; ENSG00000237834 .
    ENST00000400671 ; ENSP00000383512 ; ENSG00000237834 .
    ENST00000400688 ; ENSP00000383526 ; ENSG00000137345 .
    ENST00000400691 ; ENSP00000383528 ; ENSG00000137345 .
    ENST00000412760 ; ENSP00000404245 ; ENSG00000237834 .
    ENST00000414889 ; ENSP00000403380 ; ENSG00000234623 .
    ENST00000415546 ; ENSP00000404149 ; ENSG00000234096 .
    ENST00000417019 ; ENSP00000404537 ; ENSG00000234096 .
    ENST00000419274 ; ENSP00000411489 ; ENSG00000236561 .
    ENST00000419309 ; ENSP00000395005 ; ENSG00000236561 .
    ENST00000420045 ; ENSP00000390682 ; ENSG00000234096 .
    ENST00000423895 ; ENSP00000390632 ; ENSG00000230885 .
    ENST00000425145 ; ENSP00000397101 ; ENSG00000234623 .
    ENST00000426782 ; ENSP00000410699 ; ENSG00000230885 .
    ENST00000427289 ; ENSP00000414489 ; ENSG00000230885 .
    ENST00000428719 ; ENSP00000397723 ; ENSG00000234096 .
    ENST00000430264 ; ENSP00000403058 ; ENSG00000234623 .
    ENST00000430351 ; ENSP00000410268 ; ENSG00000234096 .
    ENST00000431798 ; ENSP00000410866 ; ENSG00000204655 . [Q16653-2 ]
    ENST00000432271 ; ENSP00000389221 ; ENSG00000234623 .
    ENST00000433500 ; ENSP00000413364 ; ENSG00000236561 .
    ENST00000434177 ; ENSP00000398197 ; ENSG00000234623 .
    ENST00000438803 ; ENSP00000414862 ; ENSG00000236561 .
    ENST00000439634 ; ENSP00000404957 ; ENSG00000234096 .
    ENST00000439884 ; ENSP00000398394 ; ENSG00000237834 .
    ENST00000440561 ; ENSP00000409534 ; ENSG00000230885 .
    ENST00000442244 ; ENSP00000391516 ; ENSG00000236561 .
    ENST00000442444 ; ENSP00000414146 ; ENSG00000137345 .
    ENST00000442629 ; ENSP00000399240 ; ENSG00000234623 .
    ENST00000444674 ; ENSP00000390469 ; ENSG00000230885 .
    ENST00000447285 ; ENSP00000401609 ; ENSG00000236561 .
    ENST00000448816 ; ENSP00000397837 ; ENSG00000237834 .
    ENST00000449096 ; ENSP00000391898 ; ENSG00000234096 .
    ENST00000452233 ; ENSP00000394873 ; ENSG00000234623 .
    ENST00000452744 ; ENSP00000389022 ; ENSG00000232641 .
    ENST00000457090 ; ENSP00000415883 ; ENSG00000236561 .
    ENST00000457626 ; ENSP00000402139 ; ENSG00000230885 .
    ENST00000458179 ; ENSP00000413370 ; ENSG00000230885 .
    ENST00000490427 ; ENSP00000420350 ; ENSG00000204655 . [Q16653-12 ]
    ENST00000494692 ; ENSP00000417405 ; ENSG00000204655 . [Q16653-7 ]
    ENST00000547083 ; ENSP00000449213 ; ENSG00000137345 .
    ENST00000548017 ; ENSP00000448732 ; ENSG00000234096 .
    ENST00000550849 ; ENSP00000449683 ; ENSG00000237834 .
    ENST00000551175 ; ENSP00000448879 ; ENSG00000234623 .
    ENST00000551993 ; ENSP00000446871 ; ENSG00000230885 .
    ENST00000553111 ; ENSP00000447099 ; ENSG00000236561 .
    GeneIDi 4340.
    KEGGi hsa:4340.
    UCSCi uc003nna.3. human. [Q16653-4 ]
    uc003nne.3. human. [Q16653-5 ]
    uc003nnf.3. human. [Q16653-1 ]
    uc003nng.3. human. [Q16653-7 ]
    uc003nnh.3. human. [Q16653-6 ]
    uc003nni.3. human. [Q16653-3 ]
    uc003nnj.3. human. [Q16653-2 ]

    Organism-specific databases

    CTDi 4340.
    GeneCardsi GC06P029624.
    GC06Pi29624.
    GC06Pj29621.
    GC06Pk29624.
    GC06Pl29624.
    GC06Pm29624.
    GC06Pn29624.
    GC06Po29624.
    H-InvDB HIX0025082.
    HIX0058179.
    HIX0166437.
    HIX0166689.
    HIX0166922.
    HIX0167201.
    HIX0167440.
    HGNCi HGNC:7197. MOG.
    HPAi HPA021873.
    MIMi 159465. gene.
    614250. phenotype.
    neXtProti NX_Q16653.
    Orphaneti 2073. Narcolepsy-cataplexy.
    PharmGKBi PA30905.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG146805.
    HOVERGENi HBG004565.
    KOi K17270.
    OMAi LRVEDPF.
    PhylomeDBi Q16653.
    TreeFami TF331083.

    Miscellaneous databases

    ChiTaRSi MOG. human.
    GeneWikii Myelin_oligodendrocyte_glycoprotein.
    GenomeRNAii 4340.
    NextBioi 17078.
    PROi Q16653.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q16653.
    Bgeei Q16653.
    Genevestigatori Q16653.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013106. Ig_V-set.
    IPR003596. Ig_V-set_subgr.
    IPR016663. Myelin-oligodendrocyte_glycop.
    [Graphical view ]
    Pfami PF07686. V-set. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF016522. MOG. 1 hit.
    SMARTi SM00406. IGv. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of cDNA and genomic clones encoding human myelin oligodendrocyte glycoprotein."
      Hilton A.A., Slavin A.J., Hilton D.J., Bernard C.C.A.
      J. Neurochem. 65:309-318(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174.
    2. "Characterization and expression of the cDNA coding for the human myelin/oligodendrocyte glycoprotein."
      Pham-Dinh D., Allinquant B., Ruberg M., della Gaspera B., Nussbaum J.-L., Dautigny A.
      J. Neurochem. 63:2353-2356(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT VAL-174.
      Tissue: Brain.
    3. "The human myelin oligodendrocyte glycoprotein (MOG) gene: complete nucleotide sequence and structural characterization."
      Roth M.-P., Malfroy L., Offer C., Sevin J., Enault G., Borot N., Pontarotti P., Coppin H.
      Genomics 28:241-250(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-171 AND VAL-174.
    4. "Structure of the human myelin/oligodendrocyte glycoprotein gene and multiple alternative spliced isoforms."
      Pham-Dinh D., Della Gaspera B., de Rosbo N.K., Dautigny A.
      Genomics 29:345-352(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174.
    5. "Myelin/oligodendrocyte glycoprotein is alternatively spliced in humans but not mice."
      Ballenthin P.A., Gardinier M.V.
      J. Neurosci. Res. 46:271-281(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, NUCLEOTIDE SEQUENCE [MRNA] OF 30-247 (ISOFORM 10), VARIANT VAL-174.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-174.
      Tissue: Brain cortex.
    7. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS LEU-171 AND VAL-174.
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-174.
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 13), VARIANT VAL-174.
      Tissue: Brain.
    10. "Alternative splicing of the MOG gene across species."
      Delarasse C., Della Gaspera B., Genain C., Pham-Dinh D.
      Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-206 (ISOFORM 11), NUCLEOTIDE SEQUENCE [MRNA] OF 3-108 (ISOFORM 12), ALTERNATIVE SPLICING, VARIANT VAL-174.
    11. "A conformational study of the human and rat encephalitogenic myelin oligodendrocyte glycoprotein peptides 35-55."
      Albouz-Abo S., Wilson J.C., Bernard C.C.A., von Itzstein M.
      Eur. J. Biochem. 246:59-70(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 64-84.
    12. "A missense mutation in myelin oligodendrocyte glycoprotein as a cause of familial narcolepsy with cataplexy."
      Hor H., Bartesaghi L., Kutalik Z., Vicario J.L., de Andres C., Pfister C., Lammers G.J., Guex N., Chrast R., Tafti M., Peraita-Adrados R.
      Am. J. Hum. Genet. 89:474-479(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT NRCLP7 CYS-133.

    Entry informationi

    Entry nameiMOG_HUMAN
    AccessioniPrimary (citable) accession number: Q16653
    Secondary accession number(s): A6NDR4
    , A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, O00713, O00714, O00715, Q13054, Q13055, Q14855, Q29ZN8, Q56UY0, Q5JNX7, Q5JNY1, Q5JNY2, Q5JNY4, Q5SSB5, Q5SSB6, Q5STL9, Q5STM0, Q5STM1, Q5STM2, Q5STM5, Q5SUK5, Q5SUK7, Q5SUK8, Q5SUK9, Q5SUL0, Q5SUL1, Q8IYG5, Q92891, Q92892, Q92893, Q92894, Q92895, Q93053, Q96KU9, Q96KV0, Q96KV1, Q99605
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 133 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3