SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q16653

- MOG_HUMAN

UniProt

Q16653 - MOG_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Myelin-oligodendrocyte glycoprotein
Gene
MOG
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Mediates homophilic cell-cell adhesion By similarity. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. central nervous system development Source: ProtInc
  3. positive regulation of MyD88-dependent toll-like receptor signaling pathway Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin-oligodendrocyte glycoprotein
Gene namesi
Name:MOG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:7197. MOG.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 154125Extracellular Reviewed prediction
Add
BLAST
Transmembranei155 – 17521Helical; Reviewed prediction
Add
BLAST
Topological domaini176 – 21035Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei211 – 23121Helical; Reviewed prediction
Add
BLAST
Topological domaini232 – 24716Extracellular Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Narcolepsy 7 (NRCLP7) [MIM:614250]: Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti133 – 1331S → C in NRCLP7. 1 Publication
VAR_066415

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi614250. phenotype.
Orphaneti2073. Narcolepsy-cataplexy.
PharmGKBiPA30905.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929 Reviewed prediction
Add
BLAST
Chaini30 – 247218Myelin-oligodendrocyte glycoprotein
PRO_0000014888Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi53 ↔ 127 Reviewed prediction
Glycosylationi60 – 601N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ16653.
PRIDEiQ16653.

PTM databases

PhosphoSiteiQ16653.

Expressioni

Tissue specificityi

Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Gene expression databases

ArrayExpressiQ16653.
BgeeiQ16653.
GenevestigatoriQ16653.

Organism-specific databases

HPAiHPA021873.

Interactioni

Subunit structurei

Homodimer By similarity. May form heterodimers between the different isoforms.

Protein-protein interaction databases

BioGridi110482. 1 interaction.
IntActiQ16653. 1 interaction.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi42 – 443
Beta strandi66 – 694
Turni71 – 733
Beta strandi74 – 807
Beta strandi82 – 854
Beta strandi87 – 926
Beta strandi96 – 1005
Beta strandi104 – 1096
Beta strandi112 – 1143
Beta strandi125 – 1284
Beta strandi131 – 1333
Beta strandi138 – 1403
Beta strandi143 – 1453

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1Q70model-A31-149[»]
ProteinModelPortaliQ16653.
SMRiQ16653. Positions 30-147.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini32 – 145114Ig-like V-type
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG146805.
HOVERGENiHBG004565.
KOiK17270.
OMAiLRVEDPF.
PhylomeDBiQ16653.
TreeFamiTF331083.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
IPR016663. Myelin-oligodendrocyte_glycop.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PIRSFiPIRSF016522. MOG. 1 hit.
SMARTiSM00406. IGv. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (13)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q16653-1) [UniParc]FASTAAdd to Basket

Also known as: Alpha-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MASLSRPSLP SCLCSFLLLL LLQVSSSYAG QFRVIGPRHP IRALVGDEVE    50
LPCRISPGKN ATGMEVGWYR PPFSRVVHLY RNGKDQDGDQ APEYRGRTEL 100
LKDAIGEGKV TLRIRNVRFS DEGGFTCFFR DHSYQEEAAM ELKVEDPFYW 150
VSPGVLVLLA VLPVLLLQIT VGLIFLCLQY RLRGKLRAEI ENLHRTFDPH 200
FLRVPCWKIT LFVIVPVLGP LVALIICYNW LHRRLAGQFL EELRNPF 247
Length:247
Mass (Da):28,193
Last modified:January 11, 2011 - v2
Checksum:i846EBA5D412C080C
GO
Isoform 2 (identifier: Q16653-2) [UniParc]FASTAAdd to Basket

Also known as: Alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.

Show »
Length:208
Mass (Da):23,627
Checksum:i8053FA07957A1963
GO
Isoform 3 (identifier: Q16653-3) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:224
Mass (Da):25,353
Checksum:iEF7BA1567A69FB33
GO
Isoform 4 (identifier: Q16653-4) [UniParc]FASTAAdd to Basket

Also known as: Alpha-4

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.

Show »
Length:131
Mass (Da):14,988
Checksum:i80B843738BF1ED47
GO
Isoform 5 (identifier: Q16653-5) [UniParc]FASTAAdd to Basket

Also known as: Beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     244-247: RNPF → LFHLEALSG

Show »
Length:252
Mass (Da):28,647
Checksum:iD41E3A6050BA9837
GO
Isoform 6 (identifier: Q16653-6) [UniParc]FASTAAdd to Basket

Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:213
Mass (Da):24,081
Checksum:iAD5788DAB32EA577
GO
Isoform 7 (identifier: Q16653-7) [UniParc]FASTAAdd to Basket

Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT
     244-247: RNPF → LFHLEALSG

Show »
Length:229
Mass (Da):25,807
Checksum:iDB6C018BA4418D2C
GO
Isoform 8 (identifier: Q16653-8) [UniParc]FASTAAdd to Basket

Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     198-243: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:206
Mass (Da):23,264
Checksum:i54D1257CD963AD8E
GO
Isoform 9 (identifier: Q16653-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-203: DPHFLR → GKFRHV
     204-247: Missing.

Note: Not functionally active. May be expressed at low level in the adult.

Show »
Length:203
Mass (Da):23,021
Checksum:i33C38085A4D22627
GO
Isoform 10 (identifier: Q16653-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-171: DPFYWVSPGVLVLLAVLPVLLLQITV → VSHSVTQDWLQWHDHGSLQPPPPRLK
     172-247: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:171
Mass (Da):19,334
Checksum:iE65BA3858848F8E8
GO
Isoform 11 (identifier: Q16653-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-247: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF → VFHLEALSG

Show »
Length:206
Mass (Da):23,250
Checksum:i4823257CD963AD8E
GO
Isoform 12 (identifier: Q16653-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:108
Mass (Da):12,149
Checksum:iEB06EC1E6C59C842
GO
Isoform 13 (identifier: Q16653-13) [UniParc]FASTAAdd to Basket

Also known as: X1

The sequence of this isoform differs from the canonical sequence as follows:
     245-247: NPF → KFSSLCYKQRIKSQERETEATRGRGGLLRDHIPRGKEELESLGGGKTPPGR

Note: No experimental confirmation available.

Show »
Length:295
Mass (Da):33,528
Checksum:i2310179859868716
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti133 – 1331S → C in NRCLP7. 1 Publication
VAR_066415
Natural varianti171 – 1711V → L.2 Publications
Corresponds to variant rs2857766 [ dbSNP | Ensembl ].
VAR_056056
Natural varianti174 – 1741I → V.9 Publications
Corresponds to variant rs3130253 [ dbSNP | Ensembl ].
VAR_060215

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei30 – 145116Missing in isoform 4 and isoform 12.
VSP_002539Add
BLAST
Alternative sequencei146 – 17126DPFYW…LQITV → VSHSVTQDWLQWHDHGSLQP PPPRLK in isoform 10.
VSP_040344Add
BLAST
Alternative sequencei172 – 24776Missing in isoform 10.
VSP_040345Add
BLAST
Alternative sequencei198 – 24750DPHFL…LRNPF → VFHLEALSG in isoform 11.
VSP_046856Add
BLAST
Alternative sequencei198 – 24346Missing in isoform 8.
VSP_002544Add
BLAST
Alternative sequencei198 – 23639Missing in isoform 2 and isoform 6.
VSP_002543Add
BLAST
Alternative sequencei198 – 23639DPHFL…HRRLA → ESFGVLGPQVKEPKKT in isoform 3, isoform 7 and isoform 12.
VSP_002542Add
BLAST
Alternative sequencei198 – 2036DPHFLR → GKFRHV in isoform 9.
VSP_002540
Alternative sequencei204 – 24744Missing in isoform 9.
VSP_002541Add
BLAST
Alternative sequencei244 – 2474RNPF → LFHLEALSG in isoform 5, isoform 6, isoform 7 and isoform 8.
VSP_002545
Alternative sequencei245 – 2473NPF → KFSSLCYKQRIKSQERETEA TRGRGGLLRDHIPRGKEELE SLGGGKTPPGR in isoform 13.
VSP_055600

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X74511 mRNA. Translation: CAA52617.1.
Z48051 Genomic DNA. Translation: CAA88109.1.
U18840 mRNA. Translation: AAC50361.1.
U18843 mRNA. Translation: AAC50362.1.
U18798 mRNA. Translation: AAC50876.1.
U18799 mRNA. Translation: AAC50877.1.
U18800 mRNA. Translation: AAB36870.1.
U18801 mRNA. Translation: AAC50878.1.
U18803 mRNA. Translation: AAC50879.1.
U64564 mRNA. Translation: AAB08088.1.
U64565 mRNA. Translation: AAB08089.1.
U64566 mRNA. Translation: AAB08090.1.
U64567 mRNA. Translation: AAB08091.1.
U64568 mRNA. Translation: AAB08092.1.
U64569 mRNA. Translation: AAB08093.1.
U64570 mRNA. Translation: AAB08094.1.
U64571 mRNA. Translation: AAB08095.1.
AK312892 mRNA. Translation: BAG35739.1.
AL050328 Genomic DNA. Translation: CAB89267.1.
AL050328 Genomic DNA. Translation: CAB89268.1.
AL050328 Genomic DNA. Translation: CAB89269.1.
AL050328 Genomic DNA. Translation: CAB89270.1.
AL050328 Genomic DNA. Translation: CAB89271.1.
AL662826 Genomic DNA. Translation: CAI17395.2.
AL662826, AL669813 Genomic DNA. Translation: CAI17396.1.
AL662826, AL669813 Genomic DNA. Translation: CAI17397.1.
AL662826 Genomic DNA. Translation: CAI17400.3.
AL669813, AL662826 Genomic DNA. Translation: CAI17636.2.
AL669813, AL662826 Genomic DNA. Translation: CAI17637.1.
AL645936 Genomic DNA. Translation: CAI18020.1.
AL645936 Genomic DNA. Translation: CAI18021.1.
AL645936 Genomic DNA. Translation: CAI18022.2.
AL645936 Genomic DNA. Translation: CAI18023.1.
AL645936 Genomic DNA. Translation: CAI18024.1.
AL929591 Genomic DNA. Translation: CAI41911.2.
AL929591 Genomic DNA. Translation: CAI41914.2.
AL929591 Genomic DNA. Translation: CAI41917.1.
BX120002 Genomic DNA. Translation: CAI95560.2.
BX120002 Genomic DNA. Translation: CAI95564.1.
BX120002 Genomic DNA. Translation: CAI95565.1.
BX120002 Genomic DNA. Translation: CAI95568.2.
AL929591 Genomic DNA. Translation: CAM25818.1.
CR759766 Genomic DNA. Translation: CAQ06614.1.
CR388408 Genomic DNA. Translation: CAQ08208.1.
CR388408 Genomic DNA. Translation: CAQ08210.1.
CR388408 Genomic DNA. Translation: CAQ08212.1.
CR388408 Genomic DNA. Translation: CAQ08213.1.
CR936483 Genomic DNA. Translation: CAQ10086.1.
CR936483 Genomic DNA. Translation: CAQ10088.1.
CR936483 Genomic DNA. Translation: CAQ10090.1.
CR936483 Genomic DNA. Translation: CAQ10091.1.
BX927250 Genomic DNA. Translation: CAQ10709.1.
BX927250 Genomic DNA. Translation: CAQ10711.1.
BX927250 Genomic DNA. Translation: CAQ10713.1.
BX927250 Genomic DNA. Translation: CAQ10714.1.
CH471081 Genomic DNA. Translation: EAX03213.1.
CH471081 Genomic DNA. Translation: EAX03214.1.
CH471081 Genomic DNA. Translation: EAX03216.1.
CH471081 Genomic DNA. Translation: EAX03217.1.
BC035938 mRNA. Translation: AAH35938.1.
AY566847 mRNA. Translation: AAU09338.1.
AY566853 mRNA. Translation: AAU09343.1.
CCDSiCCDS34366.1. [Q16653-7]
CCDS34367.1. [Q16653-6]
CCDS34368.1. [Q16653-11]
CCDS34369.1. [Q16653-3]
CCDS34370.1. [Q16653-1]
CCDS4667.1. [Q16653-5]
CCDS47394.1. [Q16653-2]
CCDS47395.2. [Q16653-4]
CCDS54977.1. [Q16653-12]
PIRiS58394.
RefSeqiNP_001008229.1. NM_001008228.2. [Q16653-3]
NP_001008230.1. NM_001008229.2. [Q16653-11]
NP_001163889.1. NM_001170418.1. [Q16653-12]
NP_002424.3. NM_002433.4. [Q16653-5]
NP_996532.2. NM_206809.3. [Q16653-1]
NP_996533.2. NM_206810.3. [Q16653-6]
NP_996534.2. NM_206811.3. [Q16653-7]
NP_996535.2. NM_206812.3. [Q16653-2]
NP_996537.3. NM_206814.5. [Q16653-4]
UniGeneiHs.141308.

Genome annotation databases

EnsembliENST00000359539; ENSP00000352534; ENSG00000137345.
ENST00000376888; ENSP00000366085; ENSG00000204655. [Q16653-4]
ENST00000376891; ENSP00000366088; ENSG00000204655. [Q16653-11]
ENST00000376894; ENSP00000366091; ENSG00000204655.
ENST00000376898; ENSP00000366095; ENSG00000204655. [Q16653-5]
ENST00000376902; ENSP00000366100; ENSG00000204655. [Q16653-10]
ENST00000376917; ENSP00000366115; ENSG00000204655. [Q16653-1]
ENST00000383521; ENSP00000373013; ENSG00000237834.
ENST00000383525; ENSP00000373017; ENSG00000237834.
ENST00000383630; ENSP00000373126; ENSG00000137345.
ENST00000383631; ENSP00000373127; ENSG00000137345.
ENST00000396701; ENSP00000379929; ENSG00000204655. [Q16653-6]
ENST00000396704; ENSP00000379932; ENSG00000204655. [Q16653-3]
ENST00000400669; ENSP00000383510; ENSG00000237834.
ENST00000400671; ENSP00000383512; ENSG00000237834.
ENST00000400688; ENSP00000383526; ENSG00000137345.
ENST00000400691; ENSP00000383528; ENSG00000137345.
ENST00000412760; ENSP00000404245; ENSG00000237834.
ENST00000414889; ENSP00000403380; ENSG00000234623.
ENST00000415546; ENSP00000404149; ENSG00000234096.
ENST00000417019; ENSP00000404537; ENSG00000234096.
ENST00000419274; ENSP00000411489; ENSG00000236561.
ENST00000420045; ENSP00000390682; ENSG00000234096.
ENST00000426782; ENSP00000410699; ENSG00000230885.
ENST00000427289; ENSP00000414489; ENSG00000230885.
ENST00000428719; ENSP00000397723; ENSG00000234096.
ENST00000430264; ENSP00000403058; ENSG00000234623.
ENST00000430351; ENSP00000410268; ENSG00000234096.
ENST00000431798; ENSP00000410866; ENSG00000204655. [Q16653-2]
ENST00000432271; ENSP00000389221; ENSG00000234623.
ENST00000433500; ENSP00000413364; ENSG00000236561.
ENST00000434177; ENSP00000398197; ENSG00000234623.
ENST00000438803; ENSP00000414862; ENSG00000236561.
ENST00000439634; ENSP00000404957; ENSG00000234096.
ENST00000440561; ENSP00000409534; ENSG00000230885.
ENST00000442244; ENSP00000391516; ENSG00000236561.
ENST00000442444; ENSP00000414146; ENSG00000137345.
ENST00000442629; ENSP00000399240; ENSG00000234623.
ENST00000444674; ENSP00000390469; ENSG00000230885.
ENST00000447285; ENSP00000401609; ENSG00000236561.
ENST00000448816; ENSP00000397837; ENSG00000237834.
ENST00000452233; ENSP00000394873; ENSG00000234623.
ENST00000452744; ENSP00000389022; ENSG00000232641.
ENST00000457090; ENSP00000415883; ENSG00000236561.
ENST00000457626; ENSP00000402139; ENSG00000230885.
ENST00000458179; ENSP00000413370; ENSG00000230885.
ENST00000490427; ENSP00000420350; ENSG00000204655. [Q16653-12]
ENST00000494692; ENSP00000417405; ENSG00000204655. [Q16653-7]
ENST00000533330; ENSP00000431709; ENSG00000204655. [Q16653-10]
ENST00000547083; ENSP00000449213; ENSG00000137345.
ENST00000547293; ENSP00000448364; ENSG00000230885. [Q16653-10]
ENST00000547390; ENSP00000448293; ENSG00000236561. [Q16653-10]
ENST00000548017; ENSP00000448732; ENSG00000234096.
ENST00000549967; ENSP00000446956; ENSG00000137345. [Q16653-10]
ENST00000550349; ENSP00000447322; ENSG00000234623. [Q16653-10]
ENST00000550605; ENSP00000447506; ENSG00000232641. [Q16653-10]
ENST00000550849; ENSP00000449683; ENSG00000237834.
ENST00000551175; ENSP00000448879; ENSG00000234623.
ENST00000551392; ENSP00000447935; ENSG00000234096. [Q16653-10]
ENST00000551993; ENSP00000446871; ENSG00000230885.
ENST00000552956; ENSP00000449192; ENSG00000237834. [Q16653-10]
ENST00000553111; ENSP00000447099; ENSG00000236561.
GeneIDi4340.
KEGGihsa:4340.
UCSCiuc003nna.3. human. [Q16653-4]
uc003nne.3. human. [Q16653-5]
uc003nnf.3. human. [Q16653-1]
uc003nng.3. human. [Q16653-7]
uc003nnh.3. human. [Q16653-6]
uc003nni.3. human. [Q16653-3]
uc003nnj.3. human. [Q16653-2]

Polymorphism databases

DMDMi317373391.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Myelin oligodendrocyte glycoprotein entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X74511 mRNA. Translation: CAA52617.1 .
Z48051 Genomic DNA. Translation: CAA88109.1 .
U18840 mRNA. Translation: AAC50361.1 .
U18843 mRNA. Translation: AAC50362.1 .
U18798 mRNA. Translation: AAC50876.1 .
U18799 mRNA. Translation: AAC50877.1 .
U18800 mRNA. Translation: AAB36870.1 .
U18801 mRNA. Translation: AAC50878.1 .
U18803 mRNA. Translation: AAC50879.1 .
U64564 mRNA. Translation: AAB08088.1 .
U64565 mRNA. Translation: AAB08089.1 .
U64566 mRNA. Translation: AAB08090.1 .
U64567 mRNA. Translation: AAB08091.1 .
U64568 mRNA. Translation: AAB08092.1 .
U64569 mRNA. Translation: AAB08093.1 .
U64570 mRNA. Translation: AAB08094.1 .
U64571 mRNA. Translation: AAB08095.1 .
AK312892 mRNA. Translation: BAG35739.1 .
AL050328 Genomic DNA. Translation: CAB89267.1 .
AL050328 Genomic DNA. Translation: CAB89268.1 .
AL050328 Genomic DNA. Translation: CAB89269.1 .
AL050328 Genomic DNA. Translation: CAB89270.1 .
AL050328 Genomic DNA. Translation: CAB89271.1 .
AL662826 Genomic DNA. Translation: CAI17395.2 .
AL662826 , AL669813 Genomic DNA. Translation: CAI17396.1 .
AL662826 , AL669813 Genomic DNA. Translation: CAI17397.1 .
AL662826 Genomic DNA. Translation: CAI17400.3 .
AL669813 , AL662826 Genomic DNA. Translation: CAI17636.2 .
AL669813 , AL662826 Genomic DNA. Translation: CAI17637.1 .
AL645936 Genomic DNA. Translation: CAI18020.1 .
AL645936 Genomic DNA. Translation: CAI18021.1 .
AL645936 Genomic DNA. Translation: CAI18022.2 .
AL645936 Genomic DNA. Translation: CAI18023.1 .
AL645936 Genomic DNA. Translation: CAI18024.1 .
AL929591 Genomic DNA. Translation: CAI41911.2 .
AL929591 Genomic DNA. Translation: CAI41914.2 .
AL929591 Genomic DNA. Translation: CAI41917.1 .
BX120002 Genomic DNA. Translation: CAI95560.2 .
BX120002 Genomic DNA. Translation: CAI95564.1 .
BX120002 Genomic DNA. Translation: CAI95565.1 .
BX120002 Genomic DNA. Translation: CAI95568.2 .
AL929591 Genomic DNA. Translation: CAM25818.1 .
CR759766 Genomic DNA. Translation: CAQ06614.1 .
CR388408 Genomic DNA. Translation: CAQ08208.1 .
CR388408 Genomic DNA. Translation: CAQ08210.1 .
CR388408 Genomic DNA. Translation: CAQ08212.1 .
CR388408 Genomic DNA. Translation: CAQ08213.1 .
CR936483 Genomic DNA. Translation: CAQ10086.1 .
CR936483 Genomic DNA. Translation: CAQ10088.1 .
CR936483 Genomic DNA. Translation: CAQ10090.1 .
CR936483 Genomic DNA. Translation: CAQ10091.1 .
BX927250 Genomic DNA. Translation: CAQ10709.1 .
BX927250 Genomic DNA. Translation: CAQ10711.1 .
BX927250 Genomic DNA. Translation: CAQ10713.1 .
BX927250 Genomic DNA. Translation: CAQ10714.1 .
CH471081 Genomic DNA. Translation: EAX03213.1 .
CH471081 Genomic DNA. Translation: EAX03214.1 .
CH471081 Genomic DNA. Translation: EAX03216.1 .
CH471081 Genomic DNA. Translation: EAX03217.1 .
BC035938 mRNA. Translation: AAH35938.1 .
AY566847 mRNA. Translation: AAU09338.1 .
AY566853 mRNA. Translation: AAU09343.1 .
CCDSi CCDS34366.1. [Q16653-7 ]
CCDS34367.1. [Q16653-6 ]
CCDS34368.1. [Q16653-11 ]
CCDS34369.1. [Q16653-3 ]
CCDS34370.1. [Q16653-1 ]
CCDS4667.1. [Q16653-5 ]
CCDS47394.1. [Q16653-2 ]
CCDS47395.2. [Q16653-4 ]
CCDS54977.1. [Q16653-12 ]
PIRi S58394.
RefSeqi NP_001008229.1. NM_001008228.2. [Q16653-3 ]
NP_001008230.1. NM_001008229.2. [Q16653-11 ]
NP_001163889.1. NM_001170418.1. [Q16653-12 ]
NP_002424.3. NM_002433.4. [Q16653-5 ]
NP_996532.2. NM_206809.3. [Q16653-1 ]
NP_996533.2. NM_206810.3. [Q16653-6 ]
NP_996534.2. NM_206811.3. [Q16653-7 ]
NP_996535.2. NM_206812.3. [Q16653-2 ]
NP_996537.3. NM_206814.5. [Q16653-4 ]
UniGenei Hs.141308.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1Q70 model - A 31-149 [» ]
ProteinModelPortali Q16653.
SMRi Q16653. Positions 30-147.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110482. 1 interaction.
IntActi Q16653. 1 interaction.

Protein family/group databases

MEROPSi I43.001.

PTM databases

PhosphoSitei Q16653.

Polymorphism databases

DMDMi 317373391.

Proteomic databases

PaxDbi Q16653.
PRIDEi Q16653.

Protocols and materials databases

DNASUi 4340.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000359539 ; ENSP00000352534 ; ENSG00000137345 .
ENST00000376888 ; ENSP00000366085 ; ENSG00000204655 . [Q16653-4 ]
ENST00000376891 ; ENSP00000366088 ; ENSG00000204655 . [Q16653-11 ]
ENST00000376894 ; ENSP00000366091 ; ENSG00000204655 .
ENST00000376898 ; ENSP00000366095 ; ENSG00000204655 . [Q16653-5 ]
ENST00000376902 ; ENSP00000366100 ; ENSG00000204655 . [Q16653-10 ]
ENST00000376917 ; ENSP00000366115 ; ENSG00000204655 . [Q16653-1 ]
ENST00000383521 ; ENSP00000373013 ; ENSG00000237834 .
ENST00000383525 ; ENSP00000373017 ; ENSG00000237834 .
ENST00000383630 ; ENSP00000373126 ; ENSG00000137345 .
ENST00000383631 ; ENSP00000373127 ; ENSG00000137345 .
ENST00000396701 ; ENSP00000379929 ; ENSG00000204655 . [Q16653-6 ]
ENST00000396704 ; ENSP00000379932 ; ENSG00000204655 . [Q16653-3 ]
ENST00000400669 ; ENSP00000383510 ; ENSG00000237834 .
ENST00000400671 ; ENSP00000383512 ; ENSG00000237834 .
ENST00000400688 ; ENSP00000383526 ; ENSG00000137345 .
ENST00000400691 ; ENSP00000383528 ; ENSG00000137345 .
ENST00000412760 ; ENSP00000404245 ; ENSG00000237834 .
ENST00000414889 ; ENSP00000403380 ; ENSG00000234623 .
ENST00000415546 ; ENSP00000404149 ; ENSG00000234096 .
ENST00000417019 ; ENSP00000404537 ; ENSG00000234096 .
ENST00000419274 ; ENSP00000411489 ; ENSG00000236561 .
ENST00000420045 ; ENSP00000390682 ; ENSG00000234096 .
ENST00000426782 ; ENSP00000410699 ; ENSG00000230885 .
ENST00000427289 ; ENSP00000414489 ; ENSG00000230885 .
ENST00000428719 ; ENSP00000397723 ; ENSG00000234096 .
ENST00000430264 ; ENSP00000403058 ; ENSG00000234623 .
ENST00000430351 ; ENSP00000410268 ; ENSG00000234096 .
ENST00000431798 ; ENSP00000410866 ; ENSG00000204655 . [Q16653-2 ]
ENST00000432271 ; ENSP00000389221 ; ENSG00000234623 .
ENST00000433500 ; ENSP00000413364 ; ENSG00000236561 .
ENST00000434177 ; ENSP00000398197 ; ENSG00000234623 .
ENST00000438803 ; ENSP00000414862 ; ENSG00000236561 .
ENST00000439634 ; ENSP00000404957 ; ENSG00000234096 .
ENST00000440561 ; ENSP00000409534 ; ENSG00000230885 .
ENST00000442244 ; ENSP00000391516 ; ENSG00000236561 .
ENST00000442444 ; ENSP00000414146 ; ENSG00000137345 .
ENST00000442629 ; ENSP00000399240 ; ENSG00000234623 .
ENST00000444674 ; ENSP00000390469 ; ENSG00000230885 .
ENST00000447285 ; ENSP00000401609 ; ENSG00000236561 .
ENST00000448816 ; ENSP00000397837 ; ENSG00000237834 .
ENST00000452233 ; ENSP00000394873 ; ENSG00000234623 .
ENST00000452744 ; ENSP00000389022 ; ENSG00000232641 .
ENST00000457090 ; ENSP00000415883 ; ENSG00000236561 .
ENST00000457626 ; ENSP00000402139 ; ENSG00000230885 .
ENST00000458179 ; ENSP00000413370 ; ENSG00000230885 .
ENST00000490427 ; ENSP00000420350 ; ENSG00000204655 . [Q16653-12 ]
ENST00000494692 ; ENSP00000417405 ; ENSG00000204655 . [Q16653-7 ]
ENST00000533330 ; ENSP00000431709 ; ENSG00000204655 . [Q16653-10 ]
ENST00000547083 ; ENSP00000449213 ; ENSG00000137345 .
ENST00000547293 ; ENSP00000448364 ; ENSG00000230885 . [Q16653-10 ]
ENST00000547390 ; ENSP00000448293 ; ENSG00000236561 . [Q16653-10 ]
ENST00000548017 ; ENSP00000448732 ; ENSG00000234096 .
ENST00000549967 ; ENSP00000446956 ; ENSG00000137345 . [Q16653-10 ]
ENST00000550349 ; ENSP00000447322 ; ENSG00000234623 . [Q16653-10 ]
ENST00000550605 ; ENSP00000447506 ; ENSG00000232641 . [Q16653-10 ]
ENST00000550849 ; ENSP00000449683 ; ENSG00000237834 .
ENST00000551175 ; ENSP00000448879 ; ENSG00000234623 .
ENST00000551392 ; ENSP00000447935 ; ENSG00000234096 . [Q16653-10 ]
ENST00000551993 ; ENSP00000446871 ; ENSG00000230885 .
ENST00000552956 ; ENSP00000449192 ; ENSG00000237834 . [Q16653-10 ]
ENST00000553111 ; ENSP00000447099 ; ENSG00000236561 .
GeneIDi 4340.
KEGGi hsa:4340.
UCSCi uc003nna.3. human. [Q16653-4 ]
uc003nne.3. human. [Q16653-5 ]
uc003nnf.3. human. [Q16653-1 ]
uc003nng.3. human. [Q16653-7 ]
uc003nnh.3. human. [Q16653-6 ]
uc003nni.3. human. [Q16653-3 ]
uc003nnj.3. human. [Q16653-2 ]

Organism-specific databases

CTDi 4340.
GeneCardsi GC06P029624.
GC06Pi29624.
GC06Pj29621.
GC06Pk29624.
GC06Pl29624.
GC06Pm29624.
GC06Pn29624.
GC06Po29624.
H-InvDB HIX0025082.
HIX0058179.
HIX0166437.
HIX0166689.
HIX0166922.
HIX0167201.
HIX0167440.
HGNCi HGNC:7197. MOG.
HPAi HPA021873.
MIMi 159465. gene.
614250. phenotype.
neXtProti NX_Q16653.
Orphaneti 2073. Narcolepsy-cataplexy.
PharmGKBi PA30905.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG146805.
HOVERGENi HBG004565.
KOi K17270.
OMAi LRVEDPF.
PhylomeDBi Q16653.
TreeFami TF331083.

Miscellaneous databases

ChiTaRSi MOG. human.
GeneWikii Myelin_oligodendrocyte_glycoprotein.
GenomeRNAii 4340.
NextBioi 17078.
PROi Q16653.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q16653.
Bgeei Q16653.
Genevestigatori Q16653.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
IPR016663. Myelin-oligodendrocyte_glycop.
[Graphical view ]
Pfami PF07686. V-set. 1 hit.
[Graphical view ]
PIRSFi PIRSF016522. MOG. 1 hit.
SMARTi SM00406. IGv. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of cDNA and genomic clones encoding human myelin oligodendrocyte glycoprotein."
    Hilton A.A., Slavin A.J., Hilton D.J., Bernard C.C.A.
    J. Neurochem. 65:309-318(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174.
  2. "Characterization and expression of the cDNA coding for the human myelin/oligodendrocyte glycoprotein."
    Pham-Dinh D., Allinquant B., Ruberg M., della Gaspera B., Nussbaum J.-L., Dautigny A.
    J. Neurochem. 63:2353-2356(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT VAL-174.
    Tissue: Brain.
  3. "The human myelin oligodendrocyte glycoprotein (MOG) gene: complete nucleotide sequence and structural characterization."
    Roth M.-P., Malfroy L., Offer C., Sevin J., Enault G., Borot N., Pontarotti P., Coppin H.
    Genomics 28:241-250(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-171 AND VAL-174.
  4. "Structure of the human myelin/oligodendrocyte glycoprotein gene and multiple alternative spliced isoforms."
    Pham-Dinh D., Della Gaspera B., de Rosbo N.K., Dautigny A.
    Genomics 29:345-352(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174.
  5. "Myelin/oligodendrocyte glycoprotein is alternatively spliced in humans but not mice."
    Ballenthin P.A., Gardinier M.V.
    J. Neurosci. Res. 46:271-281(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, NUCLEOTIDE SEQUENCE [MRNA] OF 30-247 (ISOFORM 10), VARIANT VAL-174.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-174.
    Tissue: Brain cortex.
  7. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS LEU-171 AND VAL-174.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-174.
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 13), VARIANT VAL-174.
    Tissue: Brain.
  10. "Alternative splicing of the MOG gene across species."
    Delarasse C., Della Gaspera B., Genain C., Pham-Dinh D.
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-206 (ISOFORM 11), NUCLEOTIDE SEQUENCE [MRNA] OF 3-108 (ISOFORM 12), ALTERNATIVE SPLICING, VARIANT VAL-174.
  11. "A conformational study of the human and rat encephalitogenic myelin oligodendrocyte glycoprotein peptides 35-55."
    Albouz-Abo S., Wilson J.C., Bernard C.C.A., von Itzstein M.
    Eur. J. Biochem. 246:59-70(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 64-84.
  12. "A missense mutation in myelin oligodendrocyte glycoprotein as a cause of familial narcolepsy with cataplexy."
    Hor H., Bartesaghi L., Kutalik Z., Vicario J.L., de Andres C., Pfister C., Lammers G.J., Guex N., Chrast R., Tafti M., Peraita-Adrados R.
    Am. J. Hum. Genet. 89:474-479(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT NRCLP7 CYS-133.

Entry informationi

Entry nameiMOG_HUMAN
AccessioniPrimary (citable) accession number: Q16653
Secondary accession number(s): A6NDR4
, A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, O00713, O00714, O00715, Q13054, Q13055, Q14855, Q29ZN8, Q56UY0, Q5JNX7, Q5JNY1, Q5JNY2, Q5JNY4, Q5SSB5, Q5SSB6, Q5STL9, Q5STM0, Q5STM1, Q5STM5, Q5SUK5, Q5SUK7, Q5SUK8, Q5SUK9, Q5SUL0, Q5SUL1, Q8IYG5, Q92891, Q92892, Q92893, Q92894, Q92895, Q93053, Q96KU9, Q96KV0, Q96KV1, Q99605
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2011
Last modified: September 3, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi