Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q16653 (MOG_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 131. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Myelin-oligodendrocyte glycoprotein
Gene names
Name:MOG
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length247 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mediates homophilic cell-cell adhesion By similarity. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.

Subunit structure

Homodimer By similarity. May form heterodimers between the different isoforms.

Subcellular location

Isoform 1: Cell membrane; Multi-pass membrane protein Potential.

Isoform 5: Cell membrane; Multi-pass membrane protein Potential.

Isoform 2: Cell membrane; Single-pass type I membrane protein Potential.

Isoform 3: Cell membrane; Single-pass type I membrane protein Potential.

Isoform 4: Cell membrane; Single-pass type I membrane protein Potential.

Isoform 6: Cell membrane; Single-pass type I membrane protein Potential.

Isoform 7: Cell membrane; Single-pass type I membrane protein Potential.

Isoform 8: Cell membrane; Single-pass type I membrane protein Potential.

Isoform 9: Cell membrane; Single-pass type I membrane protein Potential.

Tissue specificity

Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Involvement in disease

Narcolepsy 7 (NRCLP7) [MIM:614250]: Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.11

Sequence similarities

Belongs to the immunoglobulin superfamily. BTN/MOG family.

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Caution

Do not confuse myelin-oligodendrocyte glycoprotein (MOG) with oligodendrocyte-myelin glycoprotein (OMG).

Alternative products

This entry describes 12 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q16653-1)

Also known as: Alpha-1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q16653-2)

Also known as: Alpha-2;

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.
Isoform 3 (identifier: Q16653-3)

Also known as: Alpha-3;

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT
Isoform 4 (identifier: Q16653-4)

Also known as: Alpha-4;

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.
Isoform 5 (identifier: Q16653-5)

Also known as: Beta-1;

The sequence of this isoform differs from the canonical sequence as follows:
     244-247: RNPF → LFHLEALSG
Isoform 6 (identifier: Q16653-6)

Also known as: Beta-2;

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.
     244-247: RNPF → LFHLEALSG
Isoform 7 (identifier: Q16653-7)

Also known as: Beta-3;

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT
     244-247: RNPF → LFHLEALSG
Isoform 8 (identifier: Q16653-8)

Also known as: Beta-4;

The sequence of this isoform differs from the canonical sequence as follows:
     198-243: Missing.
     244-247: RNPF → LFHLEALSG
Isoform 9 (identifier: Q16653-9)

The sequence of this isoform differs from the canonical sequence as follows:
     198-203: DPHFLR → GKFRHV
     204-247: Missing.
Note: Not functionally active. May be expressed at low level in the adult.
Isoform 10 (identifier: Q16653-10)

The sequence of this isoform differs from the canonical sequence as follows:
     146-171: DPFYWVSPGVLVLLAVLPVLLLQITV → VSHSVTQDWLQWHDHGSLQPPPPRLK
     172-247: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 11 (identifier: Q16653-11)

The sequence of this isoform differs from the canonical sequence as follows:
     198-247: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF → VFHLEALSG
Isoform 12 (identifier: Q16653-12)

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Potential
Chain30 – 247218Myelin-oligodendrocyte glycoprotein
PRO_0000014888

Regions

Topological domain30 – 154125Extracellular Potential
Transmembrane155 – 17521Helical; Potential
Topological domain176 – 21035Cytoplasmic Potential
Transmembrane211 – 23121Helical; Potential
Topological domain232 – 24716Extracellular Potential
Domain32 – 145114Ig-like V-type

Amino acid modifications

Glycosylation601N-linked (GlcNAc...) Potential
Disulfide bond53 ↔ 127 Potential

Natural variations

Alternative sequence30 – 145116Missing in isoform 4 and isoform 12.
VSP_002539
Alternative sequence146 – 17126DPFYW…LQITV → VSHSVTQDWLQWHDHGSLQP PPPRLK in isoform 10.
VSP_040344
Alternative sequence172 – 24776Missing in isoform 10.
VSP_040345
Alternative sequence198 – 24750DPHFL…LRNPF → VFHLEALSG in isoform 11.
VSP_046856
Alternative sequence198 – 24346Missing in isoform 8.
VSP_002544
Alternative sequence198 – 23639Missing in isoform 2 and isoform 6.
VSP_002543
Alternative sequence198 – 23639DPHFL…HRRLA → ESFGVLGPQVKEPKKT in isoform 3, isoform 7 and isoform 12.
VSP_002542
Alternative sequence198 – 2036DPHFLR → GKFRHV in isoform 9.
VSP_002540
Alternative sequence204 – 24744Missing in isoform 9.
VSP_002541
Alternative sequence244 – 2474RNPF → LFHLEALSG in isoform 5, isoform 6, isoform 7 and isoform 8.
VSP_002545
Natural variant1331S → C in NRCLP7. Ref.11
VAR_066415
Natural variant1711V → L. Ref.3 Ref.7
Corresponds to variant rs2857766 [ dbSNP | Ensembl ].
VAR_056056
Natural variant1741I → V. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Ref.8 Ref.9
Corresponds to variant rs3130253 [ dbSNP | Ensembl ].
VAR_060215

Secondary structure

.......................... 247
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Alpha-1) [UniParc].

Last modified January 11, 2011. Version 2.
Checksum: 846EBA5D412C080C

FASTA24728,193
        10         20         30         40         50         60 
MASLSRPSLP SCLCSFLLLL LLQVSSSYAG QFRVIGPRHP IRALVGDEVE LPCRISPGKN 

        70         80         90        100        110        120 
ATGMEVGWYR PPFSRVVHLY RNGKDQDGDQ APEYRGRTEL LKDAIGEGKV TLRIRNVRFS 

       130        140        150        160        170        180 
DEGGFTCFFR DHSYQEEAAM ELKVEDPFYW VSPGVLVLLA VLPVLLLQIT VGLIFLCLQY 

       190        200        210        220        230        240 
RLRGKLRAEI ENLHRTFDPH FLRVPCWKIT LFVIVPVLGP LVALIICYNW LHRRLAGQFL 


EELRNPF 

« Hide

Isoform 2 (Alpha-2) [UniParc].

Checksum: 8053FA07957A1963
Show »

FASTA20823,627
Isoform 3 (Alpha-3) [UniParc].

Checksum: EF7BA1567A69FB33
Show »

FASTA22425,353
Isoform 4 (Alpha-4) [UniParc].

Checksum: 80B843738BF1ED47
Show »

FASTA13114,988
Isoform 5 (Beta-1) [UniParc].

Checksum: D41E3A6050BA9837
Show »

FASTA25228,647
Isoform 6 (Beta-2) [UniParc].

Checksum: AD5788DAB32EA577
Show »

FASTA21324,081
Isoform 7 (Beta-3) [UniParc].

Checksum: DB6C018BA4418D2C
Show »

FASTA22925,807
Isoform 8 (Beta-4) [UniParc].

Checksum: 54D1257CD963AD8E
Show »

FASTA20623,264
Isoform 9 [UniParc].

Checksum: 33C38085A4D22627
Show »

FASTA20323,021
Isoform 10 [UniParc].

Checksum: E65BA3858848F8E8
Show »

FASTA17119,334
Isoform 11 [UniParc].

Checksum: 4823257CD963AD8E
Show »

FASTA20623,250
Isoform 12 [UniParc].

Checksum: EB06EC1E6C59C842
Show »

FASTA10812,149

References

« Hide 'large scale' references
[1]"Characterization of cDNA and genomic clones encoding human myelin oligodendrocyte glycoprotein."
Hilton A.A., Slavin A.J., Hilton D.J., Bernard C.C.A.
J. Neurochem. 65:309-318(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174.
[2]"Characterization and expression of the cDNA coding for the human myelin/oligodendrocyte glycoprotein."
Pham-Dinh D., Allinquant B., Ruberg M., della Gaspera B., Nussbaum J.-L., Dautigny A.
J. Neurochem. 63:2353-2356(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT VAL-174.
Tissue: Brain.
[3]"The human myelin oligodendrocyte glycoprotein (MOG) gene: complete nucleotide sequence and structural characterization."
Roth M.-P., Malfroy L., Offer C., Sevin J., Enault G., Borot N., Pontarotti P., Coppin H.
Genomics 28:241-250(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-171 AND VAL-174.
[4]"Structure of the human myelin/oligodendrocyte glycoprotein gene and multiple alternative spliced isoforms."
Pham-Dinh D., Della Gaspera B., de Rosbo N.K., Dautigny A.
Genomics 29:345-352(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174.
[5]"Myelin/oligodendrocyte glycoprotein is alternatively spliced in humans but not mice."
Ballenthin P.A., Gardinier M.V.
J. Neurosci. Res. 46:271-281(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, NUCLEOTIDE SEQUENCE [MRNA] OF 30-247 (ISOFORM 10), VARIANT VAL-174.
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-174.
Tissue: Brain cortex.
[7]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS LEU-171 AND VAL-174.
[8]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-174.
[9]"Alternative splicing of the MOG gene across species."
Delarasse C., Della Gaspera B., Genain C., Pham-Dinh D.
Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-206 (ISOFORM 11), NUCLEOTIDE SEQUENCE [MRNA] OF 3-108 (ISOFORM 12), ALTERNATIVE SPLICING, VARIANT VAL-174.
[10]"A conformational study of the human and rat encephalitogenic myelin oligodendrocyte glycoprotein peptides 35-55."
Albouz-Abo S., Wilson J.C., Bernard C.C.A., von Itzstein M.
Eur. J. Biochem. 246:59-70(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 64-84.
[11]"A missense mutation in myelin oligodendrocyte glycoprotein as a cause of familial narcolepsy with cataplexy."
Hor H., Bartesaghi L., Kutalik Z., Vicario J.L., de Andres C., Pfister C., Lammers G.J., Guex N., Chrast R., Tafti M., Peraita-Adrados R.
Am. J. Hum. Genet. 89:474-479(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT NRCLP7 CYS-133.
+Additional computationally mapped references.

Web resources

Wikipedia

Myelin oligodendrocyte glycoprotein entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X74511 mRNA. Translation: CAA52617.1.
Z48051 Genomic DNA. Translation: CAA88109.1.
U18840 mRNA. Translation: AAC50361.1.
U18843 mRNA. Translation: AAC50362.1.
U18798 mRNA. Translation: AAC50876.1.
U18799 mRNA. Translation: AAC50877.1.
U18800 mRNA. Translation: AAB36870.1.
U18801 mRNA. Translation: AAC50878.1.
U18803 mRNA. Translation: AAC50879.1.
U64564 mRNA. Translation: AAB08088.1.
U64565 mRNA. Translation: AAB08089.1.
U64566 mRNA. Translation: AAB08090.1.
U64567 mRNA. Translation: AAB08091.1.
U64568 mRNA. Translation: AAB08092.1.
U64569 mRNA. Translation: AAB08093.1.
U64570 mRNA. Translation: AAB08094.1.
U64571 mRNA. Translation: AAB08095.1.
AK312892 mRNA. Translation: BAG35739.1.
AL050328 Genomic DNA. Translation: CAB89267.1.
AL050328 Genomic DNA. Translation: CAB89268.1.
AL050328 Genomic DNA. Translation: CAB89269.1.
AL050328 Genomic DNA. Translation: CAB89270.1.
AL050328 Genomic DNA. Translation: CAB89271.1.
AL662826 Genomic DNA. Translation: CAI17395.2.
AL662826, AL669813 Genomic DNA. Translation: CAI17396.1.
AL662826, AL669813 Genomic DNA. Translation: CAI17397.1.
AL662826 Genomic DNA. Translation: CAI17400.3.
AL669813, AL662826 Genomic DNA. Translation: CAI17636.2.
AL669813, AL662826 Genomic DNA. Translation: CAI17637.1.
AL645936 Genomic DNA. Translation: CAI18020.1.
AL645936 Genomic DNA. Translation: CAI18021.1.
AL645936 Genomic DNA. Translation: CAI18022.2.
AL645936 Genomic DNA. Translation: CAI18023.1.
AL645936 Genomic DNA. Translation: CAI18024.1.
AL929591 Genomic DNA. Translation: CAI41911.2.
AL929591 Genomic DNA. Translation: CAI41914.2.
AL929591 Genomic DNA. Translation: CAI41917.1.
BX120002 Genomic DNA. Translation: CAI95560.2.
BX120002 Genomic DNA. Translation: CAI95564.1.
BX120002 Genomic DNA. Translation: CAI95565.1.
BX120002 Genomic DNA. Translation: CAI95568.2.
AL929591 Genomic DNA. Translation: CAM25818.1.
CR759766 Genomic DNA. Translation: CAQ06614.1.
CR388408 Genomic DNA. Translation: CAQ08208.1.
CR388408 Genomic DNA. Translation: CAQ08210.1.
CR388408 Genomic DNA. Translation: CAQ08212.1.
CR388408 Genomic DNA. Translation: CAQ08213.1.
CR936483 Genomic DNA. Translation: CAQ10086.1.
CR936483 Genomic DNA. Translation: CAQ10088.1.
CR936483 Genomic DNA. Translation: CAQ10090.1.
CR936483 Genomic DNA. Translation: CAQ10091.1.
BX927250 Genomic DNA. Translation: CAQ10709.1.
BX927250 Genomic DNA. Translation: CAQ10711.1.
BX927250 Genomic DNA. Translation: CAQ10713.1.
BX927250 Genomic DNA. Translation: CAQ10714.1.
CH471081 Genomic DNA. Translation: EAX03213.1.
CH471081 Genomic DNA. Translation: EAX03214.1.
CH471081 Genomic DNA. Translation: EAX03217.1.
AY566847 mRNA. Translation: AAU09338.1.
AY566853 mRNA. Translation: AAU09343.1.
CCDSCCDS34366.1. [Q16653-7]
CCDS34367.1. [Q16653-6]
CCDS34368.1. [Q16653-11]
CCDS34369.1. [Q16653-3]
CCDS34370.1. [Q16653-1]
CCDS4667.1. [Q16653-5]
CCDS47394.1. [Q16653-2]
CCDS47395.2. [Q16653-4]
CCDS54977.1. [Q16653-12]
PIRS58394.
RefSeqNP_001008229.1. NM_001008228.2. [Q16653-3]
NP_001008230.1. NM_001008229.2. [Q16653-11]
NP_001163889.1. NM_001170418.1. [Q16653-12]
NP_002424.3. NM_002433.4. [Q16653-5]
NP_996532.2. NM_206809.3. [Q16653-1]
NP_996533.2. NM_206810.3. [Q16653-6]
NP_996534.2. NM_206811.3. [Q16653-7]
NP_996535.2. NM_206812.3. [Q16653-2]
NP_996537.3. NM_206814.5. [Q16653-4]
UniGeneHs.141308.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1Q70model-A31-149[»]
ProteinModelPortalQ16653.
SMRQ16653. Positions 30-147.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110482. 1 interaction.
IntActQ16653. 1 interaction.

Protein family/group databases

MEROPSI43.001.

PTM databases

PhosphoSiteQ16653.

Polymorphism databases

DMDM317373391.

Proteomic databases

PaxDbQ16653.
PRIDEQ16653.

Protocols and materials databases

DNASU4340.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000359539; ENSP00000352534; ENSG00000137345.
ENST00000376888; ENSP00000366085; ENSG00000204655. [Q16653-4]
ENST00000376891; ENSP00000366088; ENSG00000204655. [Q16653-11]
ENST00000376898; ENSP00000366095; ENSG00000204655. [Q16653-5]
ENST00000376902; ENSP00000366100; ENSG00000204655. [Q16653-10]
ENST00000376917; ENSP00000366115; ENSG00000204655. [Q16653-1]
ENST00000383521; ENSP00000373013; ENSG00000237834.
ENST00000383525; ENSP00000373017; ENSG00000237834.
ENST00000383630; ENSP00000373126; ENSG00000137345.
ENST00000383631; ENSP00000373127; ENSG00000137345.
ENST00000396701; ENSP00000379929; ENSG00000204655. [Q16653-6]
ENST00000396704; ENSP00000379932; ENSG00000204655. [Q16653-3]
ENST00000400669; ENSP00000383510; ENSG00000237834.
ENST00000400671; ENSP00000383512; ENSG00000237834.
ENST00000400688; ENSP00000383526; ENSG00000137345.
ENST00000400691; ENSP00000383528; ENSG00000137345.
ENST00000412760; ENSP00000404245; ENSG00000237834.
ENST00000414889; ENSP00000403380; ENSG00000234623.
ENST00000415546; ENSP00000404149; ENSG00000234096.
ENST00000417019; ENSP00000404537; ENSG00000234096.
ENST00000419274; ENSP00000411489; ENSG00000236561.
ENST00000420045; ENSP00000390682; ENSG00000234096.
ENST00000426782; ENSP00000410699; ENSG00000230885.
ENST00000427289; ENSP00000414489; ENSG00000230885.
ENST00000428719; ENSP00000397723; ENSG00000234096.
ENST00000430264; ENSP00000403058; ENSG00000234623.
ENST00000430351; ENSP00000410268; ENSG00000234096.
ENST00000431798; ENSP00000410866; ENSG00000204655. [Q16653-2]
ENST00000432271; ENSP00000389221; ENSG00000234623.
ENST00000433500; ENSP00000413364; ENSG00000236561.
ENST00000434177; ENSP00000398197; ENSG00000234623.
ENST00000438803; ENSP00000414862; ENSG00000236561.
ENST00000439634; ENSP00000404957; ENSG00000234096.
ENST00000440561; ENSP00000409534; ENSG00000230885.
ENST00000442244; ENSP00000391516; ENSG00000236561.
ENST00000442444; ENSP00000414146; ENSG00000137345.
ENST00000442629; ENSP00000399240; ENSG00000234623.
ENST00000444674; ENSP00000390469; ENSG00000230885.
ENST00000447285; ENSP00000401609; ENSG00000236561.
ENST00000448816; ENSP00000397837; ENSG00000237834.
ENST00000452233; ENSP00000394873; ENSG00000234623.
ENST00000452744; ENSP00000389022; ENSG00000232641.
ENST00000457090; ENSP00000415883; ENSG00000236561.
ENST00000457626; ENSP00000402139; ENSG00000230885.
ENST00000458179; ENSP00000413370; ENSG00000230885.
ENST00000490427; ENSP00000420350; ENSG00000204655. [Q16653-12]
ENST00000494692; ENSP00000417405; ENSG00000204655. [Q16653-7]
ENST00000533330; ENSP00000431709; ENSG00000204655. [Q16653-10]
ENST00000547083; ENSP00000449213; ENSG00000137345.
ENST00000547293; ENSP00000448364; ENSG00000230885. [Q16653-10]
ENST00000547390; ENSP00000448293; ENSG00000236561. [Q16653-10]
ENST00000548017; ENSP00000448732; ENSG00000234096.
ENST00000549967; ENSP00000446956; ENSG00000137345. [Q16653-10]
ENST00000550349; ENSP00000447322; ENSG00000234623. [Q16653-10]
ENST00000550605; ENSP00000447506; ENSG00000232641. [Q16653-10]
ENST00000550849; ENSP00000449683; ENSG00000237834.
ENST00000551175; ENSP00000448879; ENSG00000234623.
ENST00000551392; ENSP00000447935; ENSG00000234096. [Q16653-10]
ENST00000551993; ENSP00000446871; ENSG00000230885.
ENST00000552956; ENSP00000449192; ENSG00000237834. [Q16653-10]
ENST00000553111; ENSP00000447099; ENSG00000236561.
GeneID4340.
KEGGhsa:4340.
UCSCuc003nna.3. human. [Q16653-4]
uc003nne.3. human. [Q16653-5]
uc003nnf.3. human. [Q16653-1]
uc003nng.3. human. [Q16653-7]
uc003nnh.3. human. [Q16653-6]
uc003nni.3. human. [Q16653-3]
uc003nnj.3. human. [Q16653-2]

Organism-specific databases

CTD4340.
GeneCardsGC06P029624.
GC06Pi29624.
GC06Pj29621.
GC06Pk29624.
GC06Pl29624.
GC06Pm29624.
GC06Pn29624.
GC06Po29624.
H-InvDBHIX0025082.
HIX0058179.
HIX0166437.
HIX0166689.
HIX0166922.
HIX0167201.
HIX0167440.
HGNCHGNC:7197. MOG.
HPAHPA021873.
MIM159465. gene.
614250. phenotype.
neXtProtNX_Q16653.
Orphanet2073. Narcolepsy-cataplexy.
PharmGKBPA30905.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG146805.
HOVERGENHBG004565.
KOK17270.
OMALRVEDPF.
PhylomeDBQ16653.
TreeFamTF331083.

Gene expression databases

ArrayExpressQ16653.
BgeeQ16653.
GenevestigatorQ16653.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
IPR016663. Myelin-oligodendrocyte_glycop.
[Graphical view]
PfamPF07686. V-set. 1 hit.
[Graphical view]
PIRSFPIRSF016522. MOG. 1 hit.
SMARTSM00406. IGv. 1 hit.
[Graphical view]
PROSITEPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSMOG. human.
GeneWikiMyelin_oligodendrocyte_glycoprotein.
GenomeRNAi4340.
NextBio17078.
PROQ16653.
SOURCESearch...

Entry information

Entry nameMOG_HUMAN
AccessionPrimary (citable) accession number: Q16653
Secondary accession number(s): A6NDR4 expand/collapse secondary AC list , A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, O00713, O00714, O00715, Q13054, Q13055, Q14855, Q29ZN8, Q56UY0, Q5JNX7, Q5JNY1, Q5JNY2, Q5JNY4, Q5SSB5, Q5SSB6, Q5STL9, Q5STM0, Q5STM1, Q5STM5, Q5SUK7, Q5SUK8, Q5SUK9, Q5SUL0, Q5SUL1, Q92891, Q92892, Q92893, Q92894, Q92895, Q93053, Q96KU9, Q96KV0, Q96KV1, Q99605
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2011
Last modified: July 9, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM