Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin-oligodendrocyte glycoprotein

Gene

MOG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.By similarity
(Microbial infection) Acts as a receptor for rubella virus.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: UniProtKB-KW
  • central nervous system development Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Host cell receptor for virus entry, Receptor

Keywords - Biological processi

Cell adhesion, Host-virus interaction

Enzyme and pathway databases

BioCyciZFISH:ENSG00000137345-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin-oligodendrocyte glycoprotein
Gene namesi
Name:MOG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:7197. MOG.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 154ExtracellularSequence analysisAdd BLAST125
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 210CytoplasmicSequence analysisAdd BLAST35
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Topological domaini232 – 247ExtracellularSequence analysisAdd BLAST16

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Narcolepsy 7 (NRCLP7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionNeurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed.
See also OMIM:614250
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_066415133S → C in NRCLP7. 1 PublicationCorresponds to variant rs387906655dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi4340.
MalaCardsiMOG.
MIMi614250. phenotype.
OpenTargetsiENSG00000204655.
Orphaneti2073. Narcolepsy-cataplexy.
PharmGKBiPA30905.

Polymorphism and mutation databases

BioMutaiMOG.
DMDMi317373391.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000001488830 – 247Myelin-oligodendrocyte glycoproteinAdd BLAST218

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi53 ↔ 127PROSITE-ProRule annotation
Glycosylationi60N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ16653.
PeptideAtlasiQ16653.
PRIDEiQ16653.

PTM databases

iPTMnetiQ16653.
PhosphoSitePlusiQ16653.
SwissPalmiQ16653.

Expressioni

Tissue specificityi

Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Gene expression databases

BgeeiENSG00000204655.
ExpressionAtlasiQ16653. baseline and differential.
GenevisibleiQ16653. HS.

Organism-specific databases

HPAiHPA021873.

Interactioni

Subunit structurei

Homodimer (By similarity). May form heterodimers between the different isoforms (By similarity).By similarity
(Microbial infection) Interacts with rubella virus E2 glycoprotein.1 Publication

Protein-protein interaction databases

BioGridi110482. 1 interactor.
IntActiQ16653. 1 interactor.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Q70model-A31-149[»]
ProteinModelPortaliQ16653.
SMRiQ16653.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini32 – 145Ig-like V-typeAdd BLAST114

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKKW. Eukaryota.
ENOG41119UE. LUCA.
GeneTreeiENSGT00760000118933.
HOGENOMiHOG000213934.
HOVERGENiHBG004565.
InParanoidiQ16653.
KOiK17270.
OrthoDBiEOG091G0JF2.
PhylomeDBiQ16653.
TreeFamiTF331083.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR016663. Myelin-oligodendrocyte_glycop.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PIRSFiPIRSF016522. MOG. 1 hit.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (13)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q16653-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASLSRPSLP SCLCSFLLLL LLQVSSSYAG QFRVIGPRHP IRALVGDEVE
60 70 80 90 100
LPCRISPGKN ATGMEVGWYR PPFSRVVHLY RNGKDQDGDQ APEYRGRTEL
110 120 130 140 150
LKDAIGEGKV TLRIRNVRFS DEGGFTCFFR DHSYQEEAAM ELKVEDPFYW
160 170 180 190 200
VSPGVLVLLA VLPVLLLQIT VGLIFLCLQY RLRGKLRAEI ENLHRTFDPH
210 220 230 240
FLRVPCWKIT LFVIVPVLGP LVALIICYNW LHRRLAGQFL EELRNPF
Length:247
Mass (Da):28,193
Last modified:January 11, 2011 - v2
Checksum:i846EBA5D412C080C
GO
Isoform 2 (identifier: Q16653-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.

Show »
Length:208
Mass (Da):23,627
Checksum:i8053FA07957A1963
GO
Isoform 3 (identifier: Q16653-3) [UniParc]FASTAAdd to basket
Also known as: Alpha-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:224
Mass (Da):25,353
Checksum:iEF7BA1567A69FB33
GO
Isoform 4 (identifier: Q16653-4) [UniParc]FASTAAdd to basket
Also known as: Alpha-4

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.

Show »
Length:131
Mass (Da):14,988
Checksum:i80B843738BF1ED47
GO
Isoform 5 (identifier: Q16653-5) [UniParc]FASTAAdd to basket
Also known as: Beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     244-247: RNPF → LFHLEALSG

Show »
Length:252
Mass (Da):28,647
Checksum:iD41E3A6050BA9837
GO
Isoform 6 (identifier: Q16653-6) [UniParc]FASTAAdd to basket
Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:213
Mass (Da):24,081
Checksum:iAD5788DAB32EA577
GO
Isoform 7 (identifier: Q16653-7) [UniParc]FASTAAdd to basket
Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT
     244-247: RNPF → LFHLEALSG

Show »
Length:229
Mass (Da):25,807
Checksum:iDB6C018BA4418D2C
GO
Isoform 8 (identifier: Q16653-8) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     198-243: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:206
Mass (Da):23,264
Checksum:i54D1257CD963AD8E
GO
Isoform 9 (identifier: Q16653-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-203: DPHFLR → GKFRHV
     204-247: Missing.

Note: Not functionally active. May be expressed at low level in the adult.
Show »
Length:203
Mass (Da):23,021
Checksum:i33C38085A4D22627
GO
Isoform 10 (identifier: Q16653-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-171: DPFYWVSPGVLVLLAVLPVLLLQITV → VSHSVTQDWLQWHDHGSLQPPPPRLK
     172-247: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:171
Mass (Da):19,334
Checksum:iE65BA3858848F8E8
GO
Isoform 11 (identifier: Q16653-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-247: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF → VFHLEALSG

Show »
Length:206
Mass (Da):23,250
Checksum:i4823257CD963AD8E
GO
Isoform 12 (identifier: Q16653-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:108
Mass (Da):12,149
Checksum:iEB06EC1E6C59C842
GO
Isoform 13 (identifier: Q16653-13) [UniParc]FASTAAdd to basket
Also known as: X1

The sequence of this isoform differs from the canonical sequence as follows:
     245-247: NPF → KFSSLCYKQRIKSQERETEATRGRGGLLRDHIPRGKEELESLGGGKTPPGR

Note: No experimental confirmation available.
Show »
Length:295
Mass (Da):33,528
Checksum:i2310179859868716
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_066415133S → C in NRCLP7. 1 PublicationCorresponds to variant rs387906655dbSNPEnsembl.1
Natural variantiVAR_056056171V → L.2 PublicationsCorresponds to variant rs2857766dbSNPEnsembl.1
Natural variantiVAR_060215174I → V.10 PublicationsCorresponds to variant rs3130253dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00253930 – 145Missing in isoform 4 and isoform 12. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_040344146 – 171DPFYW…LQITV → VSHSVTQDWLQWHDHGSLQP PPPRLK in isoform 10. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_040345172 – 247Missing in isoform 10. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_046856198 – 247DPHFL…LRNPF → VFHLEALSG in isoform 11. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_002544198 – 243Missing in isoform 8. CuratedAdd BLAST46
Alternative sequenceiVSP_002543198 – 236Missing in isoform 2 and isoform 6. CuratedAdd BLAST39
Alternative sequenceiVSP_002542198 – 236DPHFL…HRRLA → ESFGVLGPQVKEPKKT in isoform 3, isoform 7 and isoform 12. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_002540198 – 203DPHFLR → GKFRHV in isoform 9. Curated6
Alternative sequenceiVSP_002541204 – 247Missing in isoform 9. CuratedAdd BLAST44
Alternative sequenceiVSP_002545244 – 247RNPF → LFHLEALSG in isoform 5, isoform 6, isoform 7 and isoform 8. Curated4
Alternative sequenceiVSP_055600245 – 247NPF → KFSSLCYKQRIKSQERETEA TRGRGGLLRDHIPRGKEELE SLGGGKTPPGR in isoform 13. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74511 mRNA. Translation: CAA52617.1.
Z48051 Genomic DNA. Translation: CAA88109.1.
U18840 mRNA. Translation: AAC50361.1.
U18843 mRNA. Translation: AAC50362.1.
U18798 mRNA. Translation: AAC50876.1.
U18799 mRNA. Translation: AAC50877.1.
U18800 mRNA. Translation: AAB36870.1.
U18801 mRNA. Translation: AAC50878.1.
U18803 mRNA. Translation: AAC50879.1.
U64564 mRNA. Translation: AAB08088.1.
U64565 mRNA. Translation: AAB08089.1.
U64566 mRNA. Translation: AAB08090.1.
U64567 mRNA. Translation: AAB08091.1.
U64568 mRNA. Translation: AAB08092.1.
U64569 mRNA. Translation: AAB08093.1.
U64570 mRNA. Translation: AAB08094.1.
U64571 mRNA. Translation: AAB08095.1.
AK312892 mRNA. Translation: BAG35739.1.
AL050328 Genomic DNA. Translation: CAB89267.1.
AL050328 Genomic DNA. Translation: CAB89268.1.
AL050328 Genomic DNA. Translation: CAB89269.1.
AL050328 Genomic DNA. Translation: CAB89270.1.
AL050328 Genomic DNA. Translation: CAB89271.1.
AL662826 Genomic DNA. Translation: CAI17395.2.
AL662826, AL669813 Genomic DNA. Translation: CAI17396.1.
AL662826, AL669813 Genomic DNA. Translation: CAI17397.1.
AL662826 Genomic DNA. Translation: CAI17400.3.
AL669813, AL662826 Genomic DNA. Translation: CAI17636.2.
AL669813, AL662826 Genomic DNA. Translation: CAI17637.1.
AL645936 Genomic DNA. Translation: CAI18020.1.
AL645936 Genomic DNA. Translation: CAI18021.1.
AL645936 Genomic DNA. Translation: CAI18022.2.
AL645936 Genomic DNA. Translation: CAI18023.1.
AL645936 Genomic DNA. Translation: CAI18024.1.
AL929591 Genomic DNA. Translation: CAI41911.2.
AL929591 Genomic DNA. Translation: CAI41914.2.
AL929591 Genomic DNA. Translation: CAI41917.1.
BX120002 Genomic DNA. Translation: CAI95560.2.
BX120002 Genomic DNA. Translation: CAI95564.1.
BX120002 Genomic DNA. Translation: CAI95565.1.
BX120002 Genomic DNA. Translation: CAI95568.2.
AL929591 Genomic DNA. Translation: CAM25818.1.
CR759766 Genomic DNA. Translation: CAQ06614.1.
CR388408 Genomic DNA. Translation: CAQ08208.1.
CR388408 Genomic DNA. Translation: CAQ08210.1.
CR388408 Genomic DNA. Translation: CAQ08212.1.
CR388408 Genomic DNA. Translation: CAQ08213.1.
CR936483 Genomic DNA. Translation: CAQ10086.1.
CR936483 Genomic DNA. Translation: CAQ10088.1.
CR936483 Genomic DNA. Translation: CAQ10090.1.
CR936483 Genomic DNA. Translation: CAQ10091.1.
BX927250 Genomic DNA. Translation: CAQ10709.1.
BX927250 Genomic DNA. Translation: CAQ10711.1.
BX927250 Genomic DNA. Translation: CAQ10713.1.
BX927250 Genomic DNA. Translation: CAQ10714.1.
CH471081 Genomic DNA. Translation: EAX03213.1.
CH471081 Genomic DNA. Translation: EAX03214.1.
CH471081 Genomic DNA. Translation: EAX03216.1.
CH471081 Genomic DNA. Translation: EAX03217.1.
BC035938 mRNA. Translation: AAH35938.1.
AY566847 mRNA. Translation: AAU09338.1.
AY566853 mRNA. Translation: AAU09343.1.
CCDSiCCDS34366.1. [Q16653-7]
CCDS34367.1. [Q16653-6]
CCDS34368.1. [Q16653-11]
CCDS34369.1. [Q16653-3]
CCDS34370.1. [Q16653-1]
CCDS4667.1. [Q16653-5]
CCDS47394.1. [Q16653-2]
CCDS47395.2. [Q16653-4]
CCDS54977.1. [Q16653-12]
PIRiS58394.
RefSeqiNP_001008229.1. NM_001008228.2. [Q16653-3]
NP_001008230.1. NM_001008229.2. [Q16653-11]
NP_001163889.1. NM_001170418.1. [Q16653-12]
NP_002424.3. NM_002433.4. [Q16653-5]
NP_996532.2. NM_206809.3. [Q16653-1]
NP_996533.2. NM_206810.3. [Q16653-6]
NP_996534.2. NM_206811.3. [Q16653-7]
NP_996535.2. NM_206812.3. [Q16653-2]
NP_996537.3. NM_206814.5. [Q16653-4]
XP_005249188.1. XM_005249131.3. [Q16653-13]
UniGeneiHs.141308.

Genome annotation databases

EnsembliENST00000259891; ENSP00000259891; ENSG00000137345.
ENST00000359539; ENSP00000352534; ENSG00000137345.
ENST00000376888; ENSP00000366085; ENSG00000204655. [Q16653-4]
ENST00000376891; ENSP00000366088; ENSG00000204655. [Q16653-11]
ENST00000376894; ENSP00000366091; ENSG00000204655. [Q16653-13]
ENST00000376898; ENSP00000366095; ENSG00000204655. [Q16653-5]
ENST00000376917; ENSP00000366115; ENSG00000204655. [Q16653-1]
ENST00000383521; ENSP00000373013; ENSG00000237834.
ENST00000383525; ENSP00000373017; ENSG00000237834.
ENST00000383630; ENSP00000373126; ENSG00000137345.
ENST00000383631; ENSP00000373127; ENSG00000137345.
ENST00000396701; ENSP00000379929; ENSG00000204655. [Q16653-6]
ENST00000396704; ENSP00000379932; ENSG00000204655. [Q16653-3]
ENST00000400669; ENSP00000383510; ENSG00000237834.
ENST00000400671; ENSP00000383512; ENSG00000237834.
ENST00000400688; ENSP00000383526; ENSG00000137345.
ENST00000400691; ENSP00000383528; ENSG00000137345.
ENST00000412760; ENSP00000404245; ENSG00000237834.
ENST00000414889; ENSP00000403380; ENSG00000234623.
ENST00000415546; ENSP00000404149; ENSG00000234096.
ENST00000417019; ENSP00000404537; ENSG00000234096.
ENST00000419274; ENSP00000411489; ENSG00000236561.
ENST00000419309; ENSP00000395005; ENSG00000236561.
ENST00000420045; ENSP00000390682; ENSG00000234096.
ENST00000423895; ENSP00000390632; ENSG00000230885.
ENST00000425145; ENSP00000397101; ENSG00000234623.
ENST00000426782; ENSP00000410699; ENSG00000230885.
ENST00000427289; ENSP00000414489; ENSG00000230885.
ENST00000428719; ENSP00000397723; ENSG00000234096.
ENST00000430264; ENSP00000403058; ENSG00000234623.
ENST00000430351; ENSP00000410268; ENSG00000234096.
ENST00000431798; ENSP00000410866; ENSG00000204655. [Q16653-2]
ENST00000432271; ENSP00000389221; ENSG00000234623.
ENST00000433500; ENSP00000413364; ENSG00000236561.
ENST00000434177; ENSP00000398197; ENSG00000234623.
ENST00000438803; ENSP00000414862; ENSG00000236561.
ENST00000439634; ENSP00000404957; ENSG00000234096.
ENST00000439884; ENSP00000398394; ENSG00000237834.
ENST00000440561; ENSP00000409534; ENSG00000230885.
ENST00000442244; ENSP00000391516; ENSG00000236561.
ENST00000442444; ENSP00000414146; ENSG00000137345.
ENST00000442629; ENSP00000399240; ENSG00000234623.
ENST00000444674; ENSP00000390469; ENSG00000230885.
ENST00000447285; ENSP00000401609; ENSG00000236561.
ENST00000448816; ENSP00000397837; ENSG00000237834.
ENST00000449096; ENSP00000391898; ENSG00000234096.
ENST00000452233; ENSP00000394873; ENSG00000234623.
ENST00000452744; ENSP00000389022; ENSG00000232641.
ENST00000457090; ENSP00000415883; ENSG00000236561.
ENST00000457626; ENSP00000402139; ENSG00000230885.
ENST00000458179; ENSP00000413370; ENSG00000230885.
ENST00000490427; ENSP00000420350; ENSG00000204655. [Q16653-12]
ENST00000494692; ENSP00000417405; ENSG00000204655. [Q16653-7]
ENST00000547083; ENSP00000449213; ENSG00000137345.
ENST00000548017; ENSP00000448732; ENSG00000234096.
ENST00000550849; ENSP00000449683; ENSG00000237834.
ENST00000551175; ENSP00000448879; ENSG00000234623.
ENST00000551993; ENSP00000446871; ENSG00000230885.
ENST00000553111; ENSP00000447099; ENSG00000236561.
GeneIDi4340.
KEGGihsa:4340.
UCSCiuc003nmy.3. human. [Q16653-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Myelin oligodendrocyte glycoprotein entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74511 mRNA. Translation: CAA52617.1.
Z48051 Genomic DNA. Translation: CAA88109.1.
U18840 mRNA. Translation: AAC50361.1.
U18843 mRNA. Translation: AAC50362.1.
U18798 mRNA. Translation: AAC50876.1.
U18799 mRNA. Translation: AAC50877.1.
U18800 mRNA. Translation: AAB36870.1.
U18801 mRNA. Translation: AAC50878.1.
U18803 mRNA. Translation: AAC50879.1.
U64564 mRNA. Translation: AAB08088.1.
U64565 mRNA. Translation: AAB08089.1.
U64566 mRNA. Translation: AAB08090.1.
U64567 mRNA. Translation: AAB08091.1.
U64568 mRNA. Translation: AAB08092.1.
U64569 mRNA. Translation: AAB08093.1.
U64570 mRNA. Translation: AAB08094.1.
U64571 mRNA. Translation: AAB08095.1.
AK312892 mRNA. Translation: BAG35739.1.
AL050328 Genomic DNA. Translation: CAB89267.1.
AL050328 Genomic DNA. Translation: CAB89268.1.
AL050328 Genomic DNA. Translation: CAB89269.1.
AL050328 Genomic DNA. Translation: CAB89270.1.
AL050328 Genomic DNA. Translation: CAB89271.1.
AL662826 Genomic DNA. Translation: CAI17395.2.
AL662826, AL669813 Genomic DNA. Translation: CAI17396.1.
AL662826, AL669813 Genomic DNA. Translation: CAI17397.1.
AL662826 Genomic DNA. Translation: CAI17400.3.
AL669813, AL662826 Genomic DNA. Translation: CAI17636.2.
AL669813, AL662826 Genomic DNA. Translation: CAI17637.1.
AL645936 Genomic DNA. Translation: CAI18020.1.
AL645936 Genomic DNA. Translation: CAI18021.1.
AL645936 Genomic DNA. Translation: CAI18022.2.
AL645936 Genomic DNA. Translation: CAI18023.1.
AL645936 Genomic DNA. Translation: CAI18024.1.
AL929591 Genomic DNA. Translation: CAI41911.2.
AL929591 Genomic DNA. Translation: CAI41914.2.
AL929591 Genomic DNA. Translation: CAI41917.1.
BX120002 Genomic DNA. Translation: CAI95560.2.
BX120002 Genomic DNA. Translation: CAI95564.1.
BX120002 Genomic DNA. Translation: CAI95565.1.
BX120002 Genomic DNA. Translation: CAI95568.2.
AL929591 Genomic DNA. Translation: CAM25818.1.
CR759766 Genomic DNA. Translation: CAQ06614.1.
CR388408 Genomic DNA. Translation: CAQ08208.1.
CR388408 Genomic DNA. Translation: CAQ08210.1.
CR388408 Genomic DNA. Translation: CAQ08212.1.
CR388408 Genomic DNA. Translation: CAQ08213.1.
CR936483 Genomic DNA. Translation: CAQ10086.1.
CR936483 Genomic DNA. Translation: CAQ10088.1.
CR936483 Genomic DNA. Translation: CAQ10090.1.
CR936483 Genomic DNA. Translation: CAQ10091.1.
BX927250 Genomic DNA. Translation: CAQ10709.1.
BX927250 Genomic DNA. Translation: CAQ10711.1.
BX927250 Genomic DNA. Translation: CAQ10713.1.
BX927250 Genomic DNA. Translation: CAQ10714.1.
CH471081 Genomic DNA. Translation: EAX03213.1.
CH471081 Genomic DNA. Translation: EAX03214.1.
CH471081 Genomic DNA. Translation: EAX03216.1.
CH471081 Genomic DNA. Translation: EAX03217.1.
BC035938 mRNA. Translation: AAH35938.1.
AY566847 mRNA. Translation: AAU09338.1.
AY566853 mRNA. Translation: AAU09343.1.
CCDSiCCDS34366.1. [Q16653-7]
CCDS34367.1. [Q16653-6]
CCDS34368.1. [Q16653-11]
CCDS34369.1. [Q16653-3]
CCDS34370.1. [Q16653-1]
CCDS4667.1. [Q16653-5]
CCDS47394.1. [Q16653-2]
CCDS47395.2. [Q16653-4]
CCDS54977.1. [Q16653-12]
PIRiS58394.
RefSeqiNP_001008229.1. NM_001008228.2. [Q16653-3]
NP_001008230.1. NM_001008229.2. [Q16653-11]
NP_001163889.1. NM_001170418.1. [Q16653-12]
NP_002424.3. NM_002433.4. [Q16653-5]
NP_996532.2. NM_206809.3. [Q16653-1]
NP_996533.2. NM_206810.3. [Q16653-6]
NP_996534.2. NM_206811.3. [Q16653-7]
NP_996535.2. NM_206812.3. [Q16653-2]
NP_996537.3. NM_206814.5. [Q16653-4]
XP_005249188.1. XM_005249131.3. [Q16653-13]
UniGeneiHs.141308.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Q70model-A31-149[»]
ProteinModelPortaliQ16653.
SMRiQ16653.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110482. 1 interactor.
IntActiQ16653. 1 interactor.

PTM databases

iPTMnetiQ16653.
PhosphoSitePlusiQ16653.
SwissPalmiQ16653.

Polymorphism and mutation databases

BioMutaiMOG.
DMDMi317373391.

Proteomic databases

PaxDbiQ16653.
PeptideAtlasiQ16653.
PRIDEiQ16653.

Protocols and materials databases

DNASUi4340.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000259891; ENSP00000259891; ENSG00000137345.
ENST00000359539; ENSP00000352534; ENSG00000137345.
ENST00000376888; ENSP00000366085; ENSG00000204655. [Q16653-4]
ENST00000376891; ENSP00000366088; ENSG00000204655. [Q16653-11]
ENST00000376894; ENSP00000366091; ENSG00000204655. [Q16653-13]
ENST00000376898; ENSP00000366095; ENSG00000204655. [Q16653-5]
ENST00000376917; ENSP00000366115; ENSG00000204655. [Q16653-1]
ENST00000383521; ENSP00000373013; ENSG00000237834.
ENST00000383525; ENSP00000373017; ENSG00000237834.
ENST00000383630; ENSP00000373126; ENSG00000137345.
ENST00000383631; ENSP00000373127; ENSG00000137345.
ENST00000396701; ENSP00000379929; ENSG00000204655. [Q16653-6]
ENST00000396704; ENSP00000379932; ENSG00000204655. [Q16653-3]
ENST00000400669; ENSP00000383510; ENSG00000237834.
ENST00000400671; ENSP00000383512; ENSG00000237834.
ENST00000400688; ENSP00000383526; ENSG00000137345.
ENST00000400691; ENSP00000383528; ENSG00000137345.
ENST00000412760; ENSP00000404245; ENSG00000237834.
ENST00000414889; ENSP00000403380; ENSG00000234623.
ENST00000415546; ENSP00000404149; ENSG00000234096.
ENST00000417019; ENSP00000404537; ENSG00000234096.
ENST00000419274; ENSP00000411489; ENSG00000236561.
ENST00000419309; ENSP00000395005; ENSG00000236561.
ENST00000420045; ENSP00000390682; ENSG00000234096.
ENST00000423895; ENSP00000390632; ENSG00000230885.
ENST00000425145; ENSP00000397101; ENSG00000234623.
ENST00000426782; ENSP00000410699; ENSG00000230885.
ENST00000427289; ENSP00000414489; ENSG00000230885.
ENST00000428719; ENSP00000397723; ENSG00000234096.
ENST00000430264; ENSP00000403058; ENSG00000234623.
ENST00000430351; ENSP00000410268; ENSG00000234096.
ENST00000431798; ENSP00000410866; ENSG00000204655. [Q16653-2]
ENST00000432271; ENSP00000389221; ENSG00000234623.
ENST00000433500; ENSP00000413364; ENSG00000236561.
ENST00000434177; ENSP00000398197; ENSG00000234623.
ENST00000438803; ENSP00000414862; ENSG00000236561.
ENST00000439634; ENSP00000404957; ENSG00000234096.
ENST00000439884; ENSP00000398394; ENSG00000237834.
ENST00000440561; ENSP00000409534; ENSG00000230885.
ENST00000442244; ENSP00000391516; ENSG00000236561.
ENST00000442444; ENSP00000414146; ENSG00000137345.
ENST00000442629; ENSP00000399240; ENSG00000234623.
ENST00000444674; ENSP00000390469; ENSG00000230885.
ENST00000447285; ENSP00000401609; ENSG00000236561.
ENST00000448816; ENSP00000397837; ENSG00000237834.
ENST00000449096; ENSP00000391898; ENSG00000234096.
ENST00000452233; ENSP00000394873; ENSG00000234623.
ENST00000452744; ENSP00000389022; ENSG00000232641.
ENST00000457090; ENSP00000415883; ENSG00000236561.
ENST00000457626; ENSP00000402139; ENSG00000230885.
ENST00000458179; ENSP00000413370; ENSG00000230885.
ENST00000490427; ENSP00000420350; ENSG00000204655. [Q16653-12]
ENST00000494692; ENSP00000417405; ENSG00000204655. [Q16653-7]
ENST00000547083; ENSP00000449213; ENSG00000137345.
ENST00000548017; ENSP00000448732; ENSG00000234096.
ENST00000550849; ENSP00000449683; ENSG00000237834.
ENST00000551175; ENSP00000448879; ENSG00000234623.
ENST00000551993; ENSP00000446871; ENSG00000230885.
ENST00000553111; ENSP00000447099; ENSG00000236561.
GeneIDi4340.
KEGGihsa:4340.
UCSCiuc003nmy.3. human. [Q16653-1]

Organism-specific databases

CTDi4340.
DisGeNETi4340.
GeneCardsiMOG.
H-InvDBHIX0025082.
HIX0058179.
HIX0166437.
HIX0166689.
HIX0166922.
HIX0167201.
HIX0167440.
HGNCiHGNC:7197. MOG.
HPAiHPA021873.
MalaCardsiMOG.
MIMi159465. gene.
614250. phenotype.
neXtProtiNX_Q16653.
OpenTargetsiENSG00000204655.
Orphaneti2073. Narcolepsy-cataplexy.
PharmGKBiPA30905.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKKW. Eukaryota.
ENOG41119UE. LUCA.
GeneTreeiENSGT00760000118933.
HOGENOMiHOG000213934.
HOVERGENiHBG004565.
InParanoidiQ16653.
KOiK17270.
OrthoDBiEOG091G0JF2.
PhylomeDBiQ16653.
TreeFamiTF331083.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000137345-MONOMER.

Miscellaneous databases

ChiTaRSiMOG. human.
GeneWikiiMyelin_oligodendrocyte_glycoprotein.
GenomeRNAii4340.
PROiQ16653.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000204655.
ExpressionAtlasiQ16653. baseline and differential.
GenevisibleiQ16653. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR016663. Myelin-oligodendrocyte_glycop.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
PIRSFiPIRSF016522. MOG. 1 hit.
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMOG_HUMAN
AccessioniPrimary (citable) accession number: Q16653
Secondary accession number(s): A6NDR4
, A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, O00713, O00714, O00715, Q13054, Q13055, Q14855, Q29ZN8, Q56UY0, Q5JNX7, Q5JNY1, Q5JNY2, Q5JNY4, Q5SSB5, Q5SSB6, Q5STL9, Q5STM0, Q5STM1, Q5STM2, Q5STM5, Q5SUK5, Q5SUK7, Q5SUK8, Q5SUK9, Q5SUL0, Q5SUL1, Q8IYG5, Q92891, Q92892, Q92893, Q92894, Q92895, Q93053, Q96KU9, Q96KV0, Q96KV1, Q99605
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2011
Last modified: November 2, 2016
This is version 153 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Do not confuse myelin-oligodendrocyte glycoprotein (MOG) with oligodendrocyte-myelin glycoprotein (OMG).Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.