Q16653 (MOG_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myelin-oligodendrocyte glycoprotein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 247 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates homophilic cell-cell adhesion By similarity. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. |
| Subunit structure | Homodimer By similarity. May form heterodimers between the different isoforms. |
| Subcellular location | Isoform 1: Cell membrane; Multi-pass membrane protein Potential. Isoform 5: Cell membrane; Multi-pass membrane protein Potential. Isoform 2: Cell membrane; Single-pass type I membrane protein Potential. Isoform 3: Cell membrane; Single-pass type I membrane protein Potential. Isoform 4: Cell membrane; Single-pass type I membrane protein Potential. Isoform 6: Cell membrane; Single-pass type I membrane protein Potential. Isoform 7: Cell membrane; Single-pass type I membrane protein Potential. Isoform 8: Cell membrane; Single-pass type I membrane protein Potential. Isoform 9: Cell membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes. |
| Involvement in disease | Defects in MOG are the cause of narcolepsy type 7 (NRCLP7) [MIM:614250]. Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed. Ref.9 |
| Sequence similarities | Belongs to the immunoglobulin superfamily. BTN/MOG family. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Caution | Do not confuse myelin-oligodendrocyte glycoprotein (MOG) with oligodendrocyte-myelin glycoprotein (OMG). |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Immunoglobulin domain Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW central nervous system developmentTraceable author statement. Source: ProtInc positive regulation of MyD88-dependent toll-like receptor signaling pathwayInferred from sequence or structural similarity. Source: BHF-UCL |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneNon-traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q16653-1) Also known as: Alpha-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16653-2) Also known as: Alpha-2; The sequence of this isoform differs from the canonical sequence as follows: 198-236: Missing. | ||||||
| Isoform 3 (identifier: Q16653-3) Also known as: Alpha-3; The sequence of this isoform differs from the canonical sequence as follows: 198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT | ||||||
| Isoform 4 (identifier: Q16653-4) Also known as: Alpha-4; The sequence of this isoform differs from the canonical sequence as follows: 30-145: Missing. | ||||||
| Isoform 5 (identifier: Q16653-5) Also known as: Beta-1; The sequence of this isoform differs from the canonical sequence as follows: 244-247: RNPF → LFHLEALSG | ||||||
| Isoform 6 (identifier: Q16653-6) Also known as: Beta-2; The sequence of this isoform differs from the canonical sequence as follows: 198-236: Missing. 244-247: RNPF → LFHLEALSG | ||||||
| Isoform 7 (identifier: Q16653-7) Also known as: Beta-3; The sequence of this isoform differs from the canonical sequence as follows: 198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT 244-247: RNPF → LFHLEALSG | ||||||
| Isoform 8 (identifier: Q16653-8) Also known as: Beta-4; The sequence of this isoform differs from the canonical sequence as follows: 198-243: Missing. 244-247: RNPF → LFHLEALSG | ||||||
| Isoform 9 (identifier: Q16653-9) The sequence of this isoform differs from the canonical sequence as follows: 198-203: DPHFLR → GKFRHV 204-247: Missing. | ||||||
| Note: Not functionally active. May be expressed at low level in the adult. | ||||||
| Isoform 10 (identifier: Q16653-10) The sequence of this isoform differs from the canonical sequence as follows: 146-171: DPFYWVSPGVLVLLAVLPVLLLQITV → VSHSVTQDWLQWHDHGSLQPPPPRLK 172-247: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Potential | |||||||||||||||||||||||||||||||
| Chain | 30 – 247 | 218 | Myelin-oligodendrocyte glycoprotein | PRO_0000014888 | ||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||
| Topological domain | 30 – 154 | 125 | Extracellular Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 155 – 175 | 21 | Helical; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 176 – 210 | 35 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 211 – 231 | 21 | Helical; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 232 – 247 | 16 | Extracellular Potential | |||||||||||||||||||||||||||||||
| Domain | 32 – 145 | 114 | Ig-like V-type | |||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||
| Glycosylation | 60 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||
| Disulfide bond | 53 ↔ 127 | Potential | ||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 30 – 145 | 116 | Missing in isoform 4. | VSP_002539 | ||||||||||||||||||||||||||||||
| Alternative sequence | 146 – 171 | 26 | DPFYW…LQITV → VSHSVTQDWLQWHDHGSLQP PPPRLK in isoform 10. | VSP_040344 | ||||||||||||||||||||||||||||||
| Alternative sequence | 172 – 247 | 76 | Missing in isoform 10. | VSP_040345 | ||||||||||||||||||||||||||||||
| Alternative sequence | 198 – 243 | 46 | Missing in isoform 8. | VSP_002544 | ||||||||||||||||||||||||||||||
| Alternative sequence | 198 – 236 | 39 | Missing in isoform 2 and isoform 6. | VSP_002543 | ||||||||||||||||||||||||||||||
| Alternative sequence | 198 – 236 | 39 | DPHFL…HRRLA → ESFGVLGPQVKEPKKT in isoform 3 and isoform 7. | VSP_002542 | ||||||||||||||||||||||||||||||
| Alternative sequence | 198 – 203 | 6 | DPHFLR → GKFRHV in isoform 9. | VSP_002540 | ||||||||||||||||||||||||||||||
| Alternative sequence | 204 – 247 | 44 | Missing in isoform 9. | VSP_002541 | ||||||||||||||||||||||||||||||
| Alternative sequence | 244 – 247 | 4 | RNPF → LFHLEALSG in isoform 5, isoform 6, isoform 7 and isoform 8. | VSP_002545 | ||||||||||||||||||||||||||||||
| Natural variant | 133 | 1 | S → C in NRCLP7. Ref.9 | VAR_066415 | ||||||||||||||||||||||||||||||
| Natural variant | 171 | 1 | V → L. Ref.3 Ref.6 Corresponds to variant rs2857766 [ dbSNP | Ensembl ]. | VAR_056056 | ||||||||||||||||||||||||||||||
| Natural variant | 174 | 1 | I → V. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Corresponds to variant rs3130253 [ dbSNP | Ensembl ]. | VAR_060215 | ||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||
| Beta strand | 42 – 44 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 66 – 69 | 4 | ||||||||||||||||||||||||||||||||
| Turn | 71 – 73 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 74 – 80 | 7 | ||||||||||||||||||||||||||||||||
| Beta strand | 82 – 85 | 4 | ||||||||||||||||||||||||||||||||
| Beta strand | 87 – 92 | 6 | ||||||||||||||||||||||||||||||||
| Beta strand | 96 – 100 | 5 | ||||||||||||||||||||||||||||||||
| Beta strand | 104 – 109 | 6 | ||||||||||||||||||||||||||||||||
| Beta strand | 112 – 114 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 125 – 128 | 4 | ||||||||||||||||||||||||||||||||
| Beta strand | 131 – 133 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 138 – 140 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 143 – 145 | 3 | ||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of cDNA and genomic clones encoding human myelin oligodendrocyte glycoprotein." Hilton A.A., Slavin A.J., Hilton D.J., Bernard C.C.A. J. Neurochem. 65:309-318(1995) [PubMed: 7790876] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174. |
| [2] | "Characterization and expression of the cDNA coding for the human myelin/oligodendrocyte glycoprotein." Pham-Dinh D., Allinquant B., Ruberg M., della Gaspera B., Nussbaum J.-L., Dautigny A. J. Neurochem. 63:2353-2356(1994) [PubMed: 7964757] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT VAL-174. Tissue: Brain. |
| [3] | "The human myelin oligodendrocyte glycoprotein (MOG) gene: complete nucleotide sequence and structural characterization." Roth M.-P., Malfroy L., Offer C., Sevin J., Enault G., Borot N., Pontarotti P., Coppin H. Genomics 28:241-250(1995) [PubMed: 8530032] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-171 AND VAL-174. |
| [4] | "Structure of the human myelin/oligodendrocyte glycoprotein gene and multiple alternative spliced isoforms." Pham-Dinh D., Della Gaspera B., de Rosbo N.K., Dautigny A. Genomics 29:345-352(1995) [PubMed: 8666381] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, VARIANT VAL-174. |
| [5] | "Myelin/oligodendrocyte glycoprotein is alternatively spliced in humans but not mice." Ballenthin P.A., Gardinier M.V. J. Neurosci. Res. 46:271-281(1996) [PubMed: 8915905] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING, NUCLEOTIDE SEQUENCE [MRNA] OF 30-247 (ISOFORM 10), VARIANT VAL-174. |
| [6] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS LEU-171 AND VAL-174. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-174. |
| [8] | "A conformational study of the human and rat encephalitogenic myelin oligodendrocyte glycoprotein peptides 35-55." Albouz-Abo S., Wilson J.C., Bernard C.C.A., von Itzstein M. Eur. J. Biochem. 246:59-70(1997) [PubMed: 9210466] [Abstract] Cited for: STRUCTURE BY NMR OF 64-84. |
| [9] | "A missense mutation in myelin oligodendrocyte glycoprotein as a cause of familial narcolepsy with cataplexy." Hor H., Bartesaghi L., Kutalik Z., Vicario J.L., de Andres C., Pfister C., Lammers G.J., Guex N., Chrast R., Tafti M., Peraita-Adrados R. Am. J. Hum. Genet. 89:474-479(2011) [PubMed: 21907016] [Abstract] Cited for: VARIANT NRCLP7 CYS-133. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Myelin oligodendrocyte glycoprotein entry |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X74511 mRNA. Translation: CAA52617.1. Z48051 Genomic DNA. Translation: CAA88109.1. U18840 mRNA. Translation: AAC50361.1. U18843 mRNA. Translation: AAC50362.1. U18798 mRNA. Translation: AAC50876.1. U18799 mRNA. Translation: AAC50877.1. U18800 mRNA. Translation: AAB36870.1. U18801 mRNA. Translation: AAC50878.1. U18803 mRNA. Translation: AAC50879.1. U64564 mRNA. Translation: AAB08088.1. U64565 mRNA. Translation: AAB08089.1. U64566 mRNA. Translation: AAB08090.1. U64567 mRNA. Translation: AAB08091.1. U64568 mRNA. Translation: AAB08092.1. U64569 mRNA. Translation: AAB08093.1. U64570 mRNA. Translation: AAB08094.1. U64571 mRNA. Translation: AAB08095.1. AL050328 Genomic DNA. Translation: CAB89267.1. AL050328 Genomic DNA. Translation: CAB89268.1. AL050328 Genomic DNA. Translation: CAB89269.1. AL050328 Genomic DNA. Translation: CAB89270.1. AL050328 Genomic DNA. Translation: CAB89271.1. AL662826 Genomic DNA. Translation: CAI17395.2. AL662826, AL669813 Genomic DNA. Translation: CAI17396.1. AL662826, AL669813 Genomic DNA. Translation: CAI17397.1. AL662826 Genomic DNA. Translation: CAI17400.3. AL669813, AL662826 Genomic DNA. Translation: CAI17636.2. AL669813, AL662826 Genomic DNA. Translation: CAI17637.1. AL645936 Genomic DNA. Translation: CAI18020.1. AL645936 Genomic DNA. Translation: CAI18021.1. AL645936 Genomic DNA. Translation: CAI18022.2. AL645936 Genomic DNA. Translation: CAI18023.1. AL645936 Genomic DNA. Translation: CAI18024.1. AL929591 Genomic DNA. Translation: CAI41911.2. AL929591 Genomic DNA. Translation: CAI41914.2. AL929591 Genomic DNA. Translation: CAI41917.1. BX120002 Genomic DNA. Translation: CAI95560.2. BX120002 Genomic DNA. Translation: CAI95564.1. BX120002 Genomic DNA. Translation: CAI95565.1. BX120002 Genomic DNA. Translation: CAI95568.2. AL929591 Genomic DNA. Translation: CAM25818.1. CR759766 Genomic DNA. Translation: CAQ06614.1. CR388408 Genomic DNA. Translation: CAQ08208.1. CR388408 Genomic DNA. Translation: CAQ08210.1. CR388408 Genomic DNA. Translation: CAQ08212.1. CR388408 Genomic DNA. Translation: CAQ08213.1. CR936483 Genomic DNA. Translation: CAQ10086.1. CR936483 Genomic DNA. Translation: CAQ10088.1. CR936483 Genomic DNA. Translation: CAQ10090.1. CR936483 Genomic DNA. Translation: CAQ10091.1. BX927250 Genomic DNA. Translation: CAQ10709.1. BX927250 Genomic DNA. Translation: CAQ10711.1. BX927250 Genomic DNA. Translation: CAQ10713.1. BX927250 Genomic DNA. Translation: CAQ10714.1. CH471081 Genomic DNA. Translation: EAX03214.1. CH471081 Genomic DNA. Translation: EAX03217.1. | ||||||||||||
| IPI | IPI00219664. IPI00409587. IPI00473134. IPI00549656. IPI00556079. IPI00744638. IPI00873156. IPI00873317. IPI00943197. IPI00953473. | ||||||||||||
| PIR | S58394. | ||||||||||||
| RefSeq | NP_001008229.1. NM_001008228.2. NP_001008230.1. NM_001008229.2. NP_001163889.1. NM_001170418.1. NP_002424.3. NM_002433.4. NP_996532.2. NM_206809.3. NP_996533.2. NM_206810.3. NP_996534.2. NM_206811.3. NP_996535.2. NM_206812.3. NP_996537.3. NM_206814.5. | ||||||||||||
| UniGene | Hs.141308. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q16653. | ||||||||||||
| SMR | Q16653. Positions 30-147. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q16653. 1 interaction. | ||||||||||||
| STRING | Q16653. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q16653. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 2497312. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q16653. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000383525; ENSP00000373017; ENSG00000237834. ENST00000383630; ENSP00000373126; ENSG00000137345. ENST00000417019; ENSP00000404537; ENSG00000234096. ENST00000427289; ENSP00000414489; ENSG00000230885. ENST00000432271; ENSP00000389221; ENSG00000234623. ENST00000447285; ENSP00000401609; ENSG00000236561. ENST00000452744; ENSP00000389022; ENSG00000232641. | ||||||||||||
| GeneID | 4340. | ||||||||||||
| KEGG | hsa:4340. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 4340. | ||||||||||||
| GeneCards | GC06P029624. | ||||||||||||
| H-InvDB | HIX0025082. HIX0058179. HIX0166437. HIX0166689. HIX0166922. HIX0167201. HIX0167440. | ||||||||||||
| HGNC | HGNC:7197. MOG. | ||||||||||||
| HPA | HPA021873. | ||||||||||||
| MIM | 159465. gene. 614250. phenotype. | ||||||||||||
| neXtProt | NX_Q16653. | ||||||||||||
| PharmGKB | PA30905. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | HBG004565. | ||||||||||||
| OMA | VIGPGHP. | ||||||||||||
| OrthoDB | EOG4W6NWX. | ||||||||||||
Gene expression databases | |||||||||||||
| Genevestigator | Q16653. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR013106. Ig_V-set. IPR003596. Ig_V-set_subgr. IPR016663. Myelin-oligodendrocyte_glycop. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. | ||||||||||||
| PANTHER | PTHR24100:SF31. PTHR24100:SF31. 1 hit. | ||||||||||||
| Pfam | PF07686. V-set. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF016522. MOG. 1 hit. | ||||||||||||
| SMART | SM00406. IGv. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 17078. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | MOG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16653 Secondary accession number(s): A6NDR4 Q99605 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with