Q16625 (OCLN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Occludin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 522 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions. Ref.11 |
| Subunit structure | Interacts with TJP1/ZO1 and with VAPA. Ref.9 |
| Subcellular location | Membrane; Multi-pass membrane protein. Cell junction › tight junction Ref.9 Ref.10 Ref.11. |
| Tissue specificity | Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis. |
| Domain | The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction By similarity. The first extracellular loop participates in an adhesive interaction. Ref.2 |
| Post-translational modification | Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1. Phosphorylation at Ser-490 also attenuates the interaction with TJP1. Ref.9 Ref.10 Ref.11 Ref.12 |
| Involvement in disease | Band-like calcification with simplified gyration and polymicrogyria (BLCPMG) [MIM:251290]: A neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay. |
| Sequence similarities | Belongs to the ELL/occludin family. Contains 1 MARVEL domain. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16625-1) Also known as: WT-OCLN; TM4(+); This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16625-2) Also known as: OCLN-ex4del; TM4(-); The sequence of this isoform differs from the canonical sequence as follows: 244-297: Missing. | ||||||
| Isoform 3 (identifier: Q16625-3) Also known as: OCLN-ex7ext; The sequence of this isoform differs from the canonical sequence as follows: 476-522: AAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT → VNST | ||||||
| Isoform 4 (identifier: Q16625-4) Also known as: OCLN-ex3del; OCLN-ex3pdel; The sequence of this isoform differs from the canonical sequence as follows: 1-251: Missing. | ||||||
| Isoform 5 (identifier: Q16625-5) Also known as: OCLN-ex3-4del; The sequence of this isoform differs from the canonical sequence as follows: 1-251: Missing. 252-322: Missing. | ||||||
| Isoform 6 (identifier: Q16625-6) Also known as: OCLN-ex3p-9pdel; The sequence of this isoform differs from the canonical sequence as follows: 50-69: DEILHFYKWTSPPGVIRILS → ESLQAVKEQIVTHQEDGWRL 70-70: Missing. 71-522: Missing. | ||||||
| Isoform 7 (identifier: Q16625-7) Also known as: OCLN-ex3p-7pdel; The sequence of this isoform differs from the canonical sequence as follows: 52-70: ILHFYKWTSPPGVIRILSM → MTIEKKVKSTWLLLMNTID 71-522: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 522 | 522 | Occludin | PRO_0000146739 | |||||||||||||
Regions | |||||||||||||||||
| Topological domain | 1 – 66 | 66 | Cytoplasmic Potential | ||||||||||||||
| Transmembrane | 67 – 89 | 23 | Helical; Potential | ||||||||||||||
| Topological domain | 90 – 135 | 46 | Extracellular Ref.2 | ||||||||||||||
| Transmembrane | 136 – 160 | 25 | Helical; Potential | ||||||||||||||
| Topological domain | 161 – 170 | 10 | Cytoplasmic Potential | ||||||||||||||
| Transmembrane | 171 – 195 | 25 | Helical; Potential | ||||||||||||||
| Topological domain | 196 – 243 | 48 | Extracellular Potential | ||||||||||||||
| Transmembrane | 244 – 265 | 22 | Helical; Potential | ||||||||||||||
| Topological domain | 266 – 522 | 257 | Cytoplasmic Potential | ||||||||||||||
| Domain | 60 – 269 | 210 | MARVEL | ||||||||||||||
| Coiled coil | 426 – 489 | 64 | Potential | ||||||||||||||
| Compositional bias | 92 – 131 | 40 | Gly/Tyr-rich | ||||||||||||||
Amino acid modifications | |||||||||||||||||
| Modified residue | 340 | 1 | Phosphoserine By similarity | ||||||||||||||
| Modified residue | 398 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||
| Modified residue | 402 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||
| Modified residue | 403 | 1 | Phosphothreonine; by PKC/PRKCH Ref.11 | ||||||||||||||
| Modified residue | 404 | 1 | Phosphothreonine; by PKC/PRKCH Ref.11 | ||||||||||||||
| Modified residue | 490 | 1 | Phosphoserine Ref.12 | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 1 – 251 | 251 | Missing in isoform 4 and isoform 5. | VSP_043872 | |||||||||||||
| Alternative sequence | 50 – 69 | 20 | DEILH…IRILS → ESLQAVKEQIVTHQEDGWRL in isoform 6. | VSP_043873 | |||||||||||||
| Alternative sequence | 52 – 70 | 19 | ILHFY…RILSM → MTIEKKVKSTWLLLMNTID in isoform 7. | VSP_043874 | |||||||||||||
| Alternative sequence | 70 | 1 | Missing in isoform 6. | VSP_043875 | |||||||||||||
| Alternative sequence | 71 – 522 | 452 | Missing in isoform 6 and isoform 7. | VSP_043876 | |||||||||||||
| Alternative sequence | 244 – 297 | 54 | Missing in isoform 2. | VSP_043877 | |||||||||||||
| Alternative sequence | 252 – 322 | 71 | Missing in isoform 5. | VSP_043878 | |||||||||||||
| Alternative sequence | 476 – 522 | 47 | AAADE…DRQKT → VNST in isoform 3. | VSP_043879 | |||||||||||||
| Natural variant | 219 | 1 | F → S in BLCPMG. Ref.13 | VAR_064910 | |||||||||||||
Experimental info | |||||||||||||||||
| Mutagenesis | 398 | 1 | Y → A: Loss of phosphorylation and loss of regulation of TJP1 binding; when associated with A-402. Ref.9 | ||||||||||||||
| Mutagenesis | 398 | 1 | Y → D: Loss of phosphorylation, almost complete loss of binding to TJP1, loss of regulation of TJP1 binding and loss of localization to plasma membrane and sites of cell-cell contact; when associated with D-402. Ref.9 | ||||||||||||||
| Mutagenesis | 398 | 1 | Y → F: Loss of phosphorylation, decrease in binding to TJP1 and significant loss of regulation of TJP1 binding; when associated with F-402. Ref.9 | ||||||||||||||
| Mutagenesis | 402 | 1 | Y → A: Loss of phosphorylation and loss of regulation of TJP1 binding; when associated with A-398. Ref.9 | ||||||||||||||
| Mutagenesis | 402 | 1 | Y → D: Loss of phosphorylation, almost complete loss of binding to TJP1, loss of regulation of TJP1 binding and loss of localization to plasma membrane and sites of cell-cell contact; when associated with D-398. Ref.9 | ||||||||||||||
| Mutagenesis | 402 | 1 | Y → F: Loss of phosphorylation, decrease in binding to TJP1 and significant loss of regulation of TJP1 binding; when associated with F-398. Ref.9 | ||||||||||||||
| Mutagenesis | 404 | 1 | T → A: Loss of localization to the tight junctions. Ref.11 | ||||||||||||||
| Sequence conflict | 233 | 1 | L → S in AAH29886. Ref.7 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Turn | 417 – 419 | 3 | |||||||||||||||
| Helix | 426 – 466 | 41 | |||||||||||||||
| Helix | 472 – 488 | 17 | |||||||||||||||
| Helix | 491 – 520 | 30 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Interspecies diversity of the occludin sequence: cDNA cloning of human, mouse, dog, and rat-kangaroo homologues." Ando-Akatsuka Y., Saitou M., Hirase T., Kishi M., Sakakibara A., Itoh M., Yonemura S., Furuse M., Tsukita S. J. Cell Biol. 133:43-47(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Colon carcinoma. |
| [2] | "Occludin confers adhesiveness when expressed in fibroblasts." Van Itallie C.M., Anderson J.M. J. Cell Sci. 110:1113-1121(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DOMAIN, TOPOLOGY. Tissue: Liver. |
| [3] | "Splicing diversity of the human OCLN gene and its biological significance for hepatitis C virus entry." Kohaar I., Ploss A., Korol E., Mu K., Schoggins J.W., O'Brien T.R., Rice C.M., Prokunina-Olsson L. J. Virol. 84:6987-6994(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4; 5; 6 AND 7), ALTERNATIVE SPLICING. Tissue: Liver. |
| [4] | "Genomic structure of occludin gene." Fukasawa M., Toyota T., Yoshitsugu K., Yoshikawa T. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Lung. |
| [8] | "Occludin TM4(-): an isoform of the tight junction protein present in primates lacking the fourth transmembrane domain." Ghassemifar M.R., Sheth B., Papenbrock T., Leese H.J., Houghton F.D., Fleming T.P. J. Cell Sci. 115:3171-3180(2002) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 2). |
| [9] | "Phosphorylation of Tyr-398 and Tyr-402 in occludin prevents its interaction with ZO-1 and destabilizes its assembly at the tight junctions." Elias B.C., Suzuki T., Seth A., Giorgianni F., Kale G., Shen L., Turner J.R., Naren A., Desiderio D.M., Rao R. J. Biol. Chem. 284:1559-1569(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TJP1, PHOSPHORYLATION AT TYR-398 AND TYR-402, MUTAGENESIS OF TYR-398 AND TYR-402, SUBCELLULAR LOCATION. |
| [10] | "Density-enhanced phosphatase 1 regulates phosphorylation of tight junction proteins and enhances barrier function of epithelial cells." Sallee J.L., Burridge K. J. Biol. Chem. 284:14997-15006(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, DEPHOSPHORYLATION BY PTPRJ, SUBCELLULAR LOCATION. |
| [11] | "PKC eta regulates occludin phosphorylation and epithelial tight junction integrity." Suzuki T., Elias B.C., Seth A., Shen L., Turner J.R., Giorgianni F., Desiderio D., Guntaka R., Rao R. Proc. Natl. Acad. Sci. U.S.A. 106:61-66(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT THR-403 AND THR-404, MUTAGENESIS OF THR-404. |
| [12] | "Identification and analysis of occludin phosphosites: a combined mass spectrometry and bioinformatics approach." Sundstrom J.M., Tash B.R., Murakami T., Flanagan J.M., Bewley M.C., Stanley B.A., Gonsar K.B., Antonetti D.A. J. Proteome Res. 8:808-817(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 416-522, PHOSPHORYLATION AT SER-490. |
| [13] | "Recessive mutations in the gene encoding the tight junction protein occludin cause band-like calcification with simplified gyration and polymicrogyria." O'Driscoll M.C., Daly S.B., Urquhart J.E., Black G.C., Pilz D.T., Brockmann K., McEntagart M., Abdel-Salam G., Zaki M., Wolf N.I., Ladda R.L., Sell S., D'Arrigo S., Squier W., Dobyns W.B., Livingston J.H., Crow Y.J. Am. J. Hum. Genet. 87:354-364(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT BLCPMG SER-219. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Occludin entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U49184 mRNA. Translation: AAC50451.1. U53823 mRNA. Translation: AAB00195.1. FJ786083 mRNA. Translation: ACT53743.1. FJ786084 mRNA. Translation: ACT53744.1. AF400630 AF400629 Genomic DNA. Translation: AAL47094.1.GQ225096 mRNA. Translation: ACT83431.1. GQ225097 mRNA. Translation: ACT83432.1. GQ225098 mRNA. Translation: ACT83433.1. GQ402517 mRNA. Translation: ACZ80515.1. AB451306 mRNA. Translation: BAG70120.1. AB451437 mRNA. Translation: BAG70251.1. AC145146 Genomic DNA. No translation available. AC147575 Genomic DNA. No translation available. BC029886 mRNA. Translation: AAH29886.1. BK001650 mRNA. Translation: DAA01837.1. | ||||||||||||||||||||||||
| IPI | IPI00003373. IPI00479078. IPI00954898. IPI00954920. IPI00965141. IPI00978567. | ||||||||||||||||||||||||
| PIR | G02533. | ||||||||||||||||||||||||
| RefSeq | NP_001192183.1. NM_001205254.1. NP_001192184.1. NM_001205255.1. NP_002529.1. NM_002538.3. | ||||||||||||||||||||||||
| UniGene | Hs.592605. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q16625. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-42791N. | ||||||||||||||||||||||||
| IntAct | Q16625. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-5006137. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000347379. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q16625. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 3914196. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q16625. | ||||||||||||||||||||||||
| PRIDE | Q16625. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000355237; ENSP00000347379; ENSG00000197822. ENST00000380766; ENSP00000370143; ENSG00000197822. ENST00000396442; ENSP00000379719; ENSG00000197822. ENST00000538151; ENSP00000445940; ENSG00000197822. ENST00000542132; ENSP00000440000; ENSG00000197822. | ||||||||||||||||||||||||
| GeneID | 100506658. | ||||||||||||||||||||||||
| KEGG | hsa:100506658. | ||||||||||||||||||||||||
| UCSC | uc003jwu.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 100506658. | ||||||||||||||||||||||||
| GeneCards | GC05P068788. | ||||||||||||||||||||||||
| HGNC | HGNC:8104. OCLN. | ||||||||||||||||||||||||
| HPA | CAB013075. HPA005933. | ||||||||||||||||||||||||
| MIM | 251290. phenotype. 602876. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q16625. | ||||||||||||||||||||||||
| Orphanet | 1229. Congenital intrauterine infection-like syndrome. | ||||||||||||||||||||||||
| PharmGKB | PA31893. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG71745. | ||||||||||||||||||||||||
| HOGENOM | HOG000233490. | ||||||||||||||||||||||||
| HOVERGEN | HBG004523. | ||||||||||||||||||||||||
| InParanoid | Q16625. | ||||||||||||||||||||||||
| KO | K06088. | ||||||||||||||||||||||||
| OMA | MMFIATI. | ||||||||||||||||||||||||
| OrthoDB | EOG4J9N09. | ||||||||||||||||||||||||
| PhylomeDB | Q16625. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | tgfbrpathway. TGF-beta receptor signaling. | ||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| Bgee | Q16625. | ||||||||||||||||||||||||
| CleanEx | HS_OCLN. | ||||||||||||||||||||||||
| Genevestigator | Q16625. | ||||||||||||||||||||||||
| GermOnline | ENSG00000197822. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR008253. Marvel. IPR021128. MARVEL-like_dom. IPR002958. Occludin. IPR010844. Occludin_RNApol2_elong_fac_ELL. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR23288:SF4. PTHR23288:SF4. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF01284. MARVEL. 1 hit. PF07303. Occludin_ELL. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PIRSF | PIRSF005993. Occludin. 1 hit. | ||||||||||||||||||||||||
| PRINTS | PR01258. OCCLUDIN. | ||||||||||||||||||||||||
| PROSITE | PS51225. MARVEL. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| EvolutionaryTrace | Q16625. | ||||||||||||||||||||||||
| GenomeRNAi | 100506658. | ||||||||||||||||||||||||
| NextBio | 34054345. | ||||||||||||||||||||||||
| PMAP-CutDB | Q16625. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | OCLN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16625 Secondary accession number(s): B5BU70 Q8N6K1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
