Q16623 (STX1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Syntaxin-1A Alternative name(s): Neuron-specific antigen HPC-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 288 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Potentially involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm. |
| Subunit structure | Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Binds SYTL4 and STXBP6. Found in a ternary complex with STX1A and SNAP25. Interacts with OTOF and LGI3. Interacts with SLC6A4. Interacts with SYT6 and SYT8; the interaction is Ca2+-dependent By similarity. Found in a complex with VAMP8 and SNAP23. Interacts with VAPA and SYBU. Interacts with STXBP1 and DAPK1. Ref.11 Ref.12 |
| Subcellular location | Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Single-pass type IV membrane protein By similarity. Cell junction › synapse › synaptosome By similarity. |
| Tissue specificity | Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain. Ref.9 |
| Post-translational modification | Phosphorylated by CK2 By similarity. Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1. Ref.11 Ref.13 |
| Involvement in disease | Note=STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. |
| Sequence similarities | Belongs to the syntaxin family. Contains 1 t-SNARE coiled-coil homology domain. |
| Sequence caution | The sequence AAA20940.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16623-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16623-2) Also known as: 1C; The sequence of this isoform differs from the canonical sequence as follows: 227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD | ||||||
| Isoform 3 (identifier: Q16623-3) The sequence of this isoform differs from the canonical sequence as follows: 227-288: GEMIDRIEYN...IASTVGGIFA → TMWRGPCLTPRRPSSTRARRAGRKS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 288 | 288 | Syntaxin-1A | PRO_0000210186 | |||||
Regions | |||||||||
| Topological domain | 1 – 265 | 265 | Cytoplasmic Potential | ||||||
| Transmembrane | 266 – 286 | 21 | Helical; Anchor for type IV membrane protein; Potential | ||||||
| Topological domain | 287 – 288 | 2 | Extracellular Potential | ||||||
| Domain | 192 – 254 | 63 | t-SNARE coiled-coil homology | ||||||
| Coiled coil | 68 – 109 | 42 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 14 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 188 | 1 | Phosphoserine; by DAPK1 Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 227 – 288 | 62 | GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2. | VSP_006338 | |||||
| Alternative sequence | 227 – 288 | 62 | GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3. | VSP_006339 | |||||
Experimental info | |||||||||
| Sequence conflict | 73 | 1 | E → V in AAA20940. Ref.8 | ||||||
| Sequence conflict | 140 | 1 | D → V in AAA20940. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and sequence analysis of a cDNA encoding human syntaxin 1A, a polypeptide essential for exocytosis." Zhang R.-D., Maksymowych A.B., Simpson L.L. Gene 159:293-294(1995) [PubMed: 7622072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Hemizygous deletion of the syntaxin 1A gene in individuals with Williams syndrome." Osborne L.R., Soder S., Shi X.-M., Pober B., Costa T., Scherer S.W., Tsui L.-C. Am. J. Hum. Genet. 61:449-452(1997) [PubMed: 9311751] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2). |
| [3] | "Refinement of the genomic structure of STX1A and mutation analysis in nondeletion Williams syndrome patients." Wu Y.-Q., Bejjani B.A., Tsui L.-C., Mandel A., Osborne L.R., Shaffer L.G. Am. J. Med. Genet. 109:121-124(2002) [PubMed: 11977160] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), SEQUENCE REVISION TO 144. |
| [4] | "Novel isoform of syntaxin 1 is expressed in mammalian cells." Jagadish M.N., Tellam J.T., Macaulay S.L., Gough K.H., James D.E., Ward C.W. Biochem. J. 321:151-156(1997) [PubMed: 9003414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Adipose tissue. |
| [5] | "Mapping of the human HPC-1/syntaxin 1A gene (STX1A) to chromosome 7 band q11.2." Nakayama T., Fujiwara T., Miyazawa A., Asakawa S., Shimizu N., Shimizu Y., Mikoshiba K., Akagawa K. Genomics 42:173-176(1997) [PubMed: 9177791] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain and Lung. |
| [8] | "Human syntaxin is homologous with rat syntaxin A and digested by BoNT C." Zhang R.-D., Simpson L. Submitted (SEP-1994) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-288 (ISOFORM 1). Tissue: Brain. |
| [9] | "Expression analysis of the human HPC-1/syntaxin 1A, a gene deleted in Williams syndrome." Botta A., Calza L., Giardino L., Potenza S., Novelli G., Dallapiccola B. Genomics 62:525-528(1999) [PubMed: 10644452] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion." Polgar J., Chung S.H., Reed G.L. Blood 100:1081-1083(2002) [PubMed: 12130530] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH VAMP8 AND SNAP23. |
| [11] | "Ca2+-dependent phosphorylation of syntaxin-1A by the death-associated protein (DAP) kinase regulates its interaction with Munc18." Tian J.H., Das S., Sheng Z.H. J. Biol. Chem. 278:26265-26274(2003) [PubMed: 12730201] [Abstract] Cited for: PHOSPHORYLATION AT SER-188, INTERACTION WITH DAPK1 AND STXBP1. |
| [12] | "Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons." Su Q., Cai Q., Gerwin C., Smith C.L., Sheng Z.-H. Nat. Cell Biol. 6:941-953(2004) [PubMed: 15459722] [Abstract] Cited for: INTERACTION WITH SYBU. |
| [13] | "Phosphoproteomic analysis of synaptosomes from human cerebral cortex." DeGiorgis J.A., Jaffe H., Moreira J.E., Carlotti C.G. Jr., Leite J.P., Pant H.C., Dosemeci A. J. Proteome Res. 4:306-315(2005) [PubMed: 15822905] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L37792 mRNA. Translation: AAA53519.1. U87315 U87314 Genomic DNA. Translation: AAK54507.2.U87315 U87314 Genomic DNA. Translation: AAB65500.2.D37932 mRNA. Translation: BAA07151.1. BC000444 mRNA. No translation available. AC073846 Genomic DNA. Translation: AAS07470.1. BC003011 mRNA. Translation: AAH03011.1. BC064644 mRNA. Translation: AAH64644.1. U12918 mRNA. Translation: AAA20940.1. Different initiation. |
| IPI | IPI00003370. IPI00221098. IPI00221099. |
| RefSeq | NP_001159375.1. NM_001165903.1. NP_004594.1. NM_004603.3. |
| UniGene | Hs.647024. |
3D structure databases | |
| ProteinModelPortal | Q16623. |
| SMR | Q16623. Positions 2-286. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-390N. |
| IntAct | Q16623. 5 interactions. |
| MINT | MINT-255942. |
| STRING | Q16623. |
Protein family/group databases | |
| TCDB | 1.F.1.1.1. synaptosomal vesicle fusion pore (SVF-Pore) family. |
PTM databases | |
| PhosphoSite | Q16623. |
Polymorphism databases | |
| DMDM | 2501084. |
Proteomic databases | |
| PRIDE | Q16623. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000222812; ENSP00000222812; ENSG00000106089. |
| GeneID | 6804. |
| KEGG | hsa:6804. |
| UCSC | uc003tyx.1. human. |
Organism-specific databases | |
| CTD | 6804. |
| GeneCards | GC07M073113. |
| HGNC | HGNC:11433. STX1A. |
| HPA | CAB008372. |
| MIM | 186590. gene. |
| neXtProt | NX_Q16623. |
| PharmGKB | PA36233. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG15580. |
| HOGENOM | HBG717663. |
| HOVERGEN | HBG000497. |
| InParanoid | Q16623. |
| OMA | RDGFMDE. |
| OrthoDB | EOG4PC9SV. |
| PhylomeDB | Q16623. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | botulinumtoxinpathway. Effects of Botulinum toxin. |
| Reactome | REACT_111217. Metabolism. REACT_13685. Neuronal System. REACT_15380. Diabetes pathways. |
Gene expression databases | |
| ArrayExpress | Q16623. |
| Bgee | Q16623. |
| CleanEx | HS_STX1A. |
| Genevestigator | Q16623. |
| GermOnline | ENSG00000106089. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR015709. Syntaxin-1. IPR006012. Syntaxin/epimorphin_CS. IPR006011. Syntaxin_N. IPR010989. t-SNARE. IPR000727. T_SNARE_dom. [Graphical view] |
| KO | K04560. |
| PANTHER | PTHR19957:SF35. Syntaxin-1. 1 hit. |
| Pfam | PF05739. SNARE. 1 hit. PF00804. Syntaxin. 1 hit. [Graphical view] |
| SMART | SM00503. SynN. 1 hit. SM00397. t_SNARE. 1 hit. [Graphical view] |
| SUPFAM | SSF47661. t-snare. 1 hit. |
| PROSITE | PS00914. SYNTAXIN. 1 hit. PS50192. T_SNARE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 26565. |
| SOURCE | Search... |
Entry information
| Entry name | STX1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16623 Secondary accession number(s): O15447 Q9BPZ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with