Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Syntaxin-1A

Gene

STX1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Potentially involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.

GO - Molecular functioni

  • calcium channel inhibitor activity Source: Ensembl
  • chloride channel inhibitor activity Source: UniProtKB
  • kinase binding Source: UniProtKB
  • myosin binding Source: GO_Central
  • SNAP receptor activity Source: GO_Central
  • SNARE binding Source: GO_Central

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Exocytosis, Neurotransmitter transport, Transport

Enzyme and pathway databases

ReactomeiREACT_12591. Glutamate Neurotransmitter Release Cycle.
REACT_15293. Dopamine Neurotransmitter Release Cycle.
REACT_15309. Acetylcholine Neurotransmitter Release Cycle.
REACT_15418. Norepinephrine Neurotransmitter Release Cycle.
REACT_15425. Serotonin Neurotransmitter Release Cycle.
REACT_15550. Insulin processing.
REACT_18325. Regulation of insulin secretion.
REACT_23947. GABA synthesis, release, reuptake and degradation.
REACT_263969. Toxicity of botulinum toxin type C (BoNT/C).

Protein family/group databases

TCDBi1.F.1.1.1. the synaptosomal vesicle fusion pore (svf-pore) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Syntaxin-1A
Alternative name(s):
Neuron-specific antigen HPC-1
Gene namesi
Name:STX1A
Synonyms:STX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:11433. STX1A.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 265265CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei266 – 28621Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
BLAST
Topological domaini287 – 2882ExtracellularSequence Analysis

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Secreted, Synapse, Synaptosome

Pathology & Biotechi

Involvement in diseasei

STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.

Keywords - Diseasei

Williams-Beuren syndrome

Organism-specific databases

Orphaneti586. Cystic fibrosis.
PharmGKBiPA36233.

Polymorphism and mutation databases

BioMutaiSTX1A.
DMDMi2501084.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 288288Syntaxin-1APRO_0000210186Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei14 – 141Phosphoserine1 Publication
Modified residuei188 – 1881Phosphoserine; by DAPK11 Publication

Post-translational modificationi

Phosphorylated by CK2 (By similarity). Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ16623.
PRIDEiQ16623.

PTM databases

PhosphoSiteiQ16623.

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.1 Publication

Gene expression databases

BgeeiQ16623.
CleanExiHS_STX1A.
ExpressionAtlasiQ16623. baseline and differential.
GenevisibleiQ16623. HS.

Organism-specific databases

HPAiCAB008372.

Interactioni

Subunit structurei

Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Binds SYTL4 and STXBP6. Found in a ternary complex with STX1A and SNAP25. Interacts with OTOF and LGI3. Interacts with SLC6A4. Interacts with SYT6 and SYT8; the interaction is Ca2+-dependent (By similarity). Found in a complex with VAMP8 and SNAP23. Interacts with VAPA and SYBU. Interacts with STXBP1 and DAPK1.By similarity3 Publications

Protein-protein interaction databases

BioGridi112676. 52 interactions.
DIPiDIP-390N.
IntActiQ16623. 6 interactions.
MINTiMINT-255942.

Structurei

3D structure databases

ProteinModelPortaliQ16623.
SMRiQ16623. Positions 27-286.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini192 – 25463t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili68 – 10942Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the syntaxin family.Curated
Contains 1 t-SNARE coiled-coil homology domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5074.
GeneTreeiENSGT00760000119200.
HOGENOMiHOG000286023.
HOVERGENiHBG000497.
InParanoidiQ16623.
KOiK04560.
OMAiQIDYRER.
PhylomeDBiQ16623.
TreeFamiTF313763.

Family and domain databases

InterProiIPR028669. STX1A/1B.
IPR006012. Syntaxin/epimorphin_CS.
IPR006011. Syntaxin_N.
IPR010989. t-SNARE.
IPR000727. T_SNARE_dom.
[Graphical view]
PANTHERiPTHR19957:SF84. PTHR19957:SF84. 1 hit.
PfamiPF05739. SNARE. 1 hit.
PF00804. Syntaxin. 1 hit.
[Graphical view]
SMARTiSM00503. SynN. 1 hit.
SM00397. t_SNARE. 1 hit.
[Graphical view]
SUPFAMiSSF47661. SSF47661. 1 hit.
PROSITEiPS00914. SYNTAXIN. 1 hit.
PS50192. T_SNARE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16623-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN
60 70 80 90 100
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI
110 120 130 140 150
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ
160 170 180 190 200
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS
210 220 230 240 250
EIIKLENSIR ELHDMFMDMA MLVESQGEMI DRIEYNVEHA VDYVERAVSD
260 270 280
TKKAVKYQSK ARRKKIMIII CCVILGIVIA STVGGIFA
Length:288
Mass (Da):33,023
Last modified:November 1, 1996 - v1
Checksum:i8AC787EFCE65ACA1
GO
Isoform 2 (identifier: Q16623-2) [UniParc]FASTAAdd to basket

Also known as: 1C

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD

Note: Expression is up-regulated by phorbol 12-myristate 13-acetate (PMA), but not by forskolin.
Show »
Length:260
Mass (Da):29,632
Checksum:i546C1582FE83499E
GO
Isoform 3 (identifier: Q16623-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → TMWRGPCLTPRRPSSTRARRAGRKS

Show »
Length:251
Mass (Da):28,995
Checksum:iC885D46384137E0B
GO

Sequence cautioni

The sequence AAA20940.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti73 – 731E → V in AAA20940 (Ref. 10) Curated
Sequence conflicti140 – 1401D → V in AAA20940 (Ref. 10) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 28862GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2. 2 PublicationsVSP_006338Add
BLAST
Alternative sequencei227 – 28862GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3. 1 PublicationVSP_006339Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L37792 mRNA. Translation: AAA53519.1.
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAK54507.2.
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAB65500.2.
D37932 mRNA. Translation: BAA07151.1.
AB086954 mRNA. Translation: BAC78519.1.
AC073846 Genomic DNA. Translation: AAS07470.1.
CH471200 Genomic DNA. Translation: EAW69650.1.
BC000444 mRNA. No translation available.
BC003011 mRNA. Translation: AAH03011.1.
BC064644 mRNA. Translation: AAH64644.1.
U12918 mRNA. Translation: AAA20940.1. Different initiation.
CCDSiCCDS34655.1. [Q16623-1]
CCDS55120.1. [Q16623-3]
RefSeqiNP_001159375.1. NM_001165903.1. [Q16623-3]
NP_004594.1. NM_004603.3. [Q16623-1]
UniGeneiHs.647024.

Genome annotation databases

EnsembliENST00000222812; ENSP00000222812; ENSG00000106089. [Q16623-1]
ENST00000395156; ENSP00000378585; ENSG00000106089. [Q16623-3]
GeneIDi6804.
KEGGihsa:6804.
UCSCiuc003tyx.3. human. [Q16623-1]
uc003tyy.3. human. [Q16623-3]
uc010lbj.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L37792 mRNA. Translation: AAA53519.1.
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAK54507.2.
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAB65500.2.
D37932 mRNA. Translation: BAA07151.1.
AB086954 mRNA. Translation: BAC78519.1.
AC073846 Genomic DNA. Translation: AAS07470.1.
CH471200 Genomic DNA. Translation: EAW69650.1.
BC000444 mRNA. No translation available.
BC003011 mRNA. Translation: AAH03011.1.
BC064644 mRNA. Translation: AAH64644.1.
U12918 mRNA. Translation: AAA20940.1. Different initiation.
CCDSiCCDS34655.1. [Q16623-1]
CCDS55120.1. [Q16623-3]
RefSeqiNP_001159375.1. NM_001165903.1. [Q16623-3]
NP_004594.1. NM_004603.3. [Q16623-1]
UniGeneiHs.647024.

3D structure databases

ProteinModelPortaliQ16623.
SMRiQ16623. Positions 27-286.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112676. 52 interactions.
DIPiDIP-390N.
IntActiQ16623. 6 interactions.
MINTiMINT-255942.

Protein family/group databases

TCDBi1.F.1.1.1. the synaptosomal vesicle fusion pore (svf-pore) family.

PTM databases

PhosphoSiteiQ16623.

Polymorphism and mutation databases

BioMutaiSTX1A.
DMDMi2501084.

Proteomic databases

PaxDbiQ16623.
PRIDEiQ16623.

Protocols and materials databases

DNASUi6804.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222812; ENSP00000222812; ENSG00000106089. [Q16623-1]
ENST00000395156; ENSP00000378585; ENSG00000106089. [Q16623-3]
GeneIDi6804.
KEGGihsa:6804.
UCSCiuc003tyx.3. human. [Q16623-1]
uc003tyy.3. human. [Q16623-3]
uc010lbj.2. human.

Organism-specific databases

CTDi6804.
GeneCardsiGC07M073113.
HGNCiHGNC:11433. STX1A.
HPAiCAB008372.
MIMi186590. gene.
neXtProtiNX_Q16623.
Orphaneti586. Cystic fibrosis.
PharmGKBiPA36233.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5074.
GeneTreeiENSGT00760000119200.
HOGENOMiHOG000286023.
HOVERGENiHBG000497.
InParanoidiQ16623.
KOiK04560.
OMAiQIDYRER.
PhylomeDBiQ16623.
TreeFamiTF313763.

Enzyme and pathway databases

ReactomeiREACT_12591. Glutamate Neurotransmitter Release Cycle.
REACT_15293. Dopamine Neurotransmitter Release Cycle.
REACT_15309. Acetylcholine Neurotransmitter Release Cycle.
REACT_15418. Norepinephrine Neurotransmitter Release Cycle.
REACT_15425. Serotonin Neurotransmitter Release Cycle.
REACT_15550. Insulin processing.
REACT_18325. Regulation of insulin secretion.
REACT_23947. GABA synthesis, release, reuptake and degradation.
REACT_263969. Toxicity of botulinum toxin type C (BoNT/C).

Miscellaneous databases

GeneWikiiSTX1A.
GenomeRNAii6804.
NextBioi26565.
PROiQ16623.
SOURCEiSearch...

Gene expression databases

BgeeiQ16623.
CleanExiHS_STX1A.
ExpressionAtlasiQ16623. baseline and differential.
GenevisibleiQ16623. HS.

Family and domain databases

InterProiIPR028669. STX1A/1B.
IPR006012. Syntaxin/epimorphin_CS.
IPR006011. Syntaxin_N.
IPR010989. t-SNARE.
IPR000727. T_SNARE_dom.
[Graphical view]
PANTHERiPTHR19957:SF84. PTHR19957:SF84. 1 hit.
PfamiPF05739. SNARE. 1 hit.
PF00804. Syntaxin. 1 hit.
[Graphical view]
SMARTiSM00503. SynN. 1 hit.
SM00397. t_SNARE. 1 hit.
[Graphical view]
SUPFAMiSSF47661. SSF47661. 1 hit.
PROSITEiPS00914. SYNTAXIN. 1 hit.
PS50192. T_SNARE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and sequence analysis of a cDNA encoding human syntaxin 1A, a polypeptide essential for exocytosis."
    Zhang R.-D., Maksymowych A.B., Simpson L.L.
    Gene 159:293-294(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Hemizygous deletion of the syntaxin 1A gene in individuals with Williams syndrome."
    Osborne L.R., Soder S., Shi X.-M., Pober B., Costa T., Scherer S.W., Tsui L.-C.
    Am. J. Hum. Genet. 61:449-452(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
  3. "Refinement of the genomic structure of STX1A and mutation analysis in nondeletion Williams syndrome patients."
    Wu Y.-Q., Bejjani B.A., Tsui L.-C., Mandel A., Osborne L.R., Shaffer L.G.
    Am. J. Med. Genet. 109:121-124(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), SEQUENCE REVISION TO 144.
  4. "Novel isoform of syntaxin 1 is expressed in mammalian cells."
    Jagadish M.N., Tellam J.T., Macaulay S.L., Gough K.H., James D.E., Ward C.W.
    Biochem. J. 321:151-156(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Adipose tissue.
  5. "Mapping of the human HPC-1/syntaxin 1A gene (STX1A) to chromosome 7 band q11.2."
    Nakayama T., Fujiwara T., Miyazawa A., Asakawa S., Shimizu N., Shimizu Y., Mikoshiba K., Akagawa K.
    Genomics 42:173-176(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  6. "Expression of syntaxin 1C, an alternative splice variant of HPC-1/syntaxin 1A, is enhanced by phorbol-ester stimulation in astroglioma: participation of the PKC signaling pathway."
    Nakayama T., Mikoshiba K., Yamamori T., Akagawa K.
    FEBS Lett. 536:209-214(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  7. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain and Lung.
  10. "Human syntaxin is homologous with rat syntaxin A and digested by BoNT C."
    Zhang R.-D., Simpson L.
    Submitted (SEP-1994) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-288 (ISOFORM 1).
    Tissue: Brain.
  11. "Expression analysis of the human HPC-1/syntaxin 1A, a gene deleted in Williams syndrome."
    Botta A., Calza L., Giardino L., Potenza S., Novelli G., Dallapiccola B.
    Genomics 62:525-528(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  12. "Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion."
    Polgar J., Chung S.H., Reed G.L.
    Blood 100:1081-1083(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH VAMP8 AND SNAP23.
  13. "Ca2+-dependent phosphorylation of syntaxin-1A by the death-associated protein (DAP) kinase regulates its interaction with Munc18."
    Tian J.H., Das S., Sheng Z.H.
    J. Biol. Chem. 278:26265-26274(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-188, INTERACTION WITH DAPK1 AND STXBP1.
  14. "Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons."
    Su Q., Cai Q., Gerwin C., Smith C.L., Sheng Z.-H.
    Nat. Cell Biol. 6:941-953(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SYBU.
  15. "Phosphoproteomic analysis of synaptosomes from human cerebral cortex."
    DeGiorgis J.A., Jaffe H., Moreira J.E., Carlotti C.G. Jr., Leite J.P., Pant H.C., Dosemeci A.
    J. Proteome Res. 4:306-315(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain cortex.

Entry informationi

Entry nameiSTX1A_HUMAN
AccessioniPrimary (citable) accession number: Q16623
Secondary accession number(s): O15447
, O15448, Q12936, Q75MD9, Q7Z5K3, Q9BPZ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: June 24, 2015
This is version 156 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.