SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q16623

- STX1A_HUMAN

UniProt

Q16623 - STX1A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Syntaxin-1A
Gene
STX1A, STX1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Potentially involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.

GO - Molecular functioni

  1. calcium channel inhibitor activity Source: Ensembl
  2. protein binding Source: UniProtKB

GO - Biological processi

  1. calcium ion-dependent exocytosis Source: Ensembl
  2. cellular protein metabolic process Source: Reactome
  3. energy reserve metabolic process Source: Reactome
  4. glutamate secretion Source: Reactome
  5. intracellular protein transport Source: InterPro
  6. neurotransmitter secretion Source: Reactome
  7. positive regulation of exocytosis Source: Ensembl
  8. positive regulation of neurotransmitter secretion Source: Ensembl
  9. regulation of exocytosis Source: InterPro
  10. regulation of insulin secretion Source: UniProtKB
  11. response to gravity Source: Ensembl
  12. small molecule metabolic process Source: Reactome
  13. synaptic transmission Source: Reactome
  14. synaptic vesicle docking involved in exocytosis Source: Ensembl
  15. vesicle-mediated transport Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Exocytosis, Neurotransmitter transport, Transport

Enzyme and pathway databases

ReactomeiREACT_12591. Glutamate Neurotransmitter Release Cycle.
REACT_15293. Dopamine Neurotransmitter Release Cycle.
REACT_15309. Acetylcholine Neurotransmitter Release Cycle.
REACT_15418. Norepinephrine Neurotransmitter Release Cycle.
REACT_15425. Serotonin Neurotransmitter Release Cycle.
REACT_15550. Insulin processing.
REACT_18325. Regulation of insulin secretion.
REACT_200658. Toxicity of botulinum toxin type C (BoNT/C).
REACT_23947. GABA synthesis, release, reuptake and degradation.

Protein family/group databases

TCDBi1.F.1.1.1. the synaptosomal vesicle fusion pore (svf-pore) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Syntaxin-1A
Alternative name(s):
Neuron-specific antigen HPC-1
Gene namesi
Name:STX1A
Synonyms:STX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:11433. STX1A.

Subcellular locationi

Isoform 2 : Secreted Inferred

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 265265Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei266 – 28621Helical; Anchor for type IV membrane protein; Reviewed prediction
Add
BLAST
Topological domaini287 – 2882Extracellular Reviewed prediction

GO - Cellular componenti

  1. SNARE complex Source: UniProtKB
  2. actomyosin Source: Ensembl
  3. cell junction Source: UniProtKB-KW
  4. extracellular region Source: UniProtKB-SubCell
  5. integral component of membrane Source: InterPro
  6. neuron projection Source: MGI
  7. plasma membrane Source: Reactome
  8. secretory granule Source: Ensembl
  9. synaptic vesicle membrane Source: UniProtKB-SubCell
  10. synaptobrevin 2-SNAP-25-syntaxin-1a complex Source: Ensembl
  11. synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex Source: Ensembl
  12. synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Secreted, Synapse, Synaptosome

Pathology & Biotechi

Involvement in diseasei

STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.

Keywords - Diseasei

Williams-Beuren syndrome

Organism-specific databases

Orphaneti586. Cystic fibrosis.
PharmGKBiPA36233.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 288288Syntaxin-1A
PRO_0000210186Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei14 – 141Phosphoserine1 Publication
Modified residuei188 – 1881Phosphoserine; by DAPK11 Publication

Post-translational modificationi

Phosphorylated by CK2 By similarity. Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ16623.
PRIDEiQ16623.

PTM databases

PhosphoSiteiQ16623.

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.1 Publication

Gene expression databases

ArrayExpressiQ16623.
BgeeiQ16623.
CleanExiHS_STX1A.
GenevestigatoriQ16623.

Organism-specific databases

HPAiCAB008372.

Interactioni

Subunit structurei

Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Binds SYTL4 and STXBP6. Found in a ternary complex with STX1A and SNAP25. Interacts with OTOF and LGI3. Interacts with SLC6A4. Interacts with SYT6 and SYT8; the interaction is Ca2+-dependent By similarity. Found in a complex with VAMP8 and SNAP23. Interacts with VAPA and SYBU. Interacts with STXBP1 and DAPK1.3 Publications

Protein-protein interaction databases

BioGridi112676. 44 interactions.
DIPiDIP-390N.
IntActiQ16623. 6 interactions.
MINTiMINT-255942.
STRINGi9606.ENSP00000222812.

Structurei

3D structure databases

ProteinModelPortaliQ16623.
SMRiQ16623. Positions 27-286.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini192 – 25463t-SNARE coiled-coil homology
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili68 – 10942 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Belongs to the syntaxin family.

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5074.
HOGENOMiHOG000286023.
HOVERGENiHBG000497.
InParanoidiQ16623.
KOiK04560.
OMAiHEETKAV.
PhylomeDBiQ16623.
TreeFamiTF313763.

Family and domain databases

InterProiIPR028669. STX1A/1B.
IPR006012. Syntaxin/epimorphin_CS.
IPR006011. Syntaxin_N.
IPR010989. t-SNARE.
IPR000727. T_SNARE_dom.
[Graphical view]
PANTHERiPTHR19957:SF84. PTHR19957:SF84. 1 hit.
PfamiPF05739. SNARE. 1 hit.
PF00804. Syntaxin. 1 hit.
[Graphical view]
SMARTiSM00503. SynN. 1 hit.
SM00397. t_SNARE. 1 hit.
[Graphical view]
SUPFAMiSSF47661. SSF47661. 1 hit.
PROSITEiPS00914. SYNTAXIN. 1 hit.
PS50192. T_SNARE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q16623-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN    50
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI 100
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ 150
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS 200
EIIKLENSIR ELHDMFMDMA MLVESQGEMI DRIEYNVEHA VDYVERAVSD 250
TKKAVKYQSK ARRKKIMIII CCVILGIVIA STVGGIFA 288
Length:288
Mass (Da):33,023
Last modified:November 1, 1996 - v1
Checksum:i8AC787EFCE65ACA1
GO
Isoform 2 (identifier: Q16623-2) [UniParc]FASTAAdd to Basket

Also known as: 1C

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD

Note: Expression is up-regulated by phorbol 12-myristate 13-acetate (PMA), but not by forskolin.

Show »
Length:260
Mass (Da):29,632
Checksum:i546C1582FE83499E
GO
Isoform 3 (identifier: Q16623-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → TMWRGPCLTPRRPSSTRARRAGRKS

Show »
Length:251
Mass (Da):28,995
Checksum:iC885D46384137E0B
GO

Sequence cautioni

The sequence AAA20940.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 28862GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2.
VSP_006338Add
BLAST
Alternative sequencei227 – 28862GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3.
VSP_006339Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti73 – 731E → V in AAA20940. 1 Publication
Sequence conflicti140 – 1401D → V in AAA20940. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L37792 mRNA. Translation: AAA53519.1.
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAK54507.2.
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAB65500.2.
D37932 mRNA. Translation: BAA07151.1.
AB086954 mRNA. Translation: BAC78519.1.
AC073846 Genomic DNA. Translation: AAS07470.1.
CH471200 Genomic DNA. Translation: EAW69650.1.
BC000444 mRNA. No translation available.
BC003011 mRNA. Translation: AAH03011.1.
BC064644 mRNA. Translation: AAH64644.1.
U12918 mRNA. Translation: AAA20940.1. Different initiation.
CCDSiCCDS34655.1. [Q16623-1]
CCDS55120.1. [Q16623-3]
RefSeqiNP_001159375.1. NM_001165903.1. [Q16623-3]
NP_004594.1. NM_004603.3. [Q16623-1]
UniGeneiHs.647024.

Genome annotation databases

EnsembliENST00000222812; ENSP00000222812; ENSG00000106089. [Q16623-1]
ENST00000395156; ENSP00000378585; ENSG00000106089. [Q16623-3]
ENST00000572494; ENSP00000459531; ENSG00000263024. [Q16623-1]
ENST00000574942; ENSP00000459444; ENSG00000263024. [Q16623-3]
GeneIDi6804.
KEGGihsa:6804.
UCSCiuc003tyx.3. human. [Q16623-1]
uc003tyy.3. human. [Q16623-3]

Polymorphism databases

DMDMi2501084.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L37792 mRNA. Translation: AAA53519.1 .
U87315
, AF297001 , AF297002 , U87310 , AF297003 , U87314 Genomic DNA. Translation: AAK54507.2 .
U87315
, AF297001 , AF297002 , U87310 , AF297003 , U87314 Genomic DNA. Translation: AAB65500.2 .
D37932 mRNA. Translation: BAA07151.1 .
AB086954 mRNA. Translation: BAC78519.1 .
AC073846 Genomic DNA. Translation: AAS07470.1 .
CH471200 Genomic DNA. Translation: EAW69650.1 .
BC000444 mRNA. No translation available.
BC003011 mRNA. Translation: AAH03011.1 .
BC064644 mRNA. Translation: AAH64644.1 .
U12918 mRNA. Translation: AAA20940.1 . Different initiation.
CCDSi CCDS34655.1. [Q16623-1 ]
CCDS55120.1. [Q16623-3 ]
RefSeqi NP_001159375.1. NM_001165903.1. [Q16623-3 ]
NP_004594.1. NM_004603.3. [Q16623-1 ]
UniGenei Hs.647024.

3D structure databases

ProteinModelPortali Q16623.
SMRi Q16623. Positions 27-286.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112676. 44 interactions.
DIPi DIP-390N.
IntActi Q16623. 6 interactions.
MINTi MINT-255942.
STRINGi 9606.ENSP00000222812.

Protein family/group databases

TCDBi 1.F.1.1.1. the synaptosomal vesicle fusion pore (svf-pore) family.

PTM databases

PhosphoSitei Q16623.

Polymorphism databases

DMDMi 2501084.

Proteomic databases

PaxDbi Q16623.
PRIDEi Q16623.

Protocols and materials databases

DNASUi 6804.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000222812 ; ENSP00000222812 ; ENSG00000106089 . [Q16623-1 ]
ENST00000395156 ; ENSP00000378585 ; ENSG00000106089 . [Q16623-3 ]
ENST00000572494 ; ENSP00000459531 ; ENSG00000263024 . [Q16623-1 ]
ENST00000574942 ; ENSP00000459444 ; ENSG00000263024 . [Q16623-3 ]
GeneIDi 6804.
KEGGi hsa:6804.
UCSCi uc003tyx.3. human. [Q16623-1 ]
uc003tyy.3. human. [Q16623-3 ]

Organism-specific databases

CTDi 6804.
GeneCardsi GC07M073113.
HGNCi HGNC:11433. STX1A.
HPAi CAB008372.
MIMi 186590. gene.
neXtProti NX_Q16623.
Orphaneti 586. Cystic fibrosis.
PharmGKBi PA36233.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5074.
HOGENOMi HOG000286023.
HOVERGENi HBG000497.
InParanoidi Q16623.
KOi K04560.
OMAi HEETKAV.
PhylomeDBi Q16623.
TreeFami TF313763.

Enzyme and pathway databases

Reactomei REACT_12591. Glutamate Neurotransmitter Release Cycle.
REACT_15293. Dopamine Neurotransmitter Release Cycle.
REACT_15309. Acetylcholine Neurotransmitter Release Cycle.
REACT_15418. Norepinephrine Neurotransmitter Release Cycle.
REACT_15425. Serotonin Neurotransmitter Release Cycle.
REACT_15550. Insulin processing.
REACT_18325. Regulation of insulin secretion.
REACT_200658. Toxicity of botulinum toxin type C (BoNT/C).
REACT_23947. GABA synthesis, release, reuptake and degradation.

Miscellaneous databases

GeneWikii STX1A.
GenomeRNAii 6804.
NextBioi 26565.
PROi Q16623.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q16623.
Bgeei Q16623.
CleanExi HS_STX1A.
Genevestigatori Q16623.

Family and domain databases

InterProi IPR028669. STX1A/1B.
IPR006012. Syntaxin/epimorphin_CS.
IPR006011. Syntaxin_N.
IPR010989. t-SNARE.
IPR000727. T_SNARE_dom.
[Graphical view ]
PANTHERi PTHR19957:SF84. PTHR19957:SF84. 1 hit.
Pfami PF05739. SNARE. 1 hit.
PF00804. Syntaxin. 1 hit.
[Graphical view ]
SMARTi SM00503. SynN. 1 hit.
SM00397. t_SNARE. 1 hit.
[Graphical view ]
SUPFAMi SSF47661. SSF47661. 1 hit.
PROSITEi PS00914. SYNTAXIN. 1 hit.
PS50192. T_SNARE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and sequence analysis of a cDNA encoding human syntaxin 1A, a polypeptide essential for exocytosis."
    Zhang R.-D., Maksymowych A.B., Simpson L.L.
    Gene 159:293-294(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Hemizygous deletion of the syntaxin 1A gene in individuals with Williams syndrome."
    Osborne L.R., Soder S., Shi X.-M., Pober B., Costa T., Scherer S.W., Tsui L.-C.
    Am. J. Hum. Genet. 61:449-452(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
  3. "Refinement of the genomic structure of STX1A and mutation analysis in nondeletion Williams syndrome patients."
    Wu Y.-Q., Bejjani B.A., Tsui L.-C., Mandel A., Osborne L.R., Shaffer L.G.
    Am. J. Med. Genet. 109:121-124(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), SEQUENCE REVISION TO 144.
  4. "Novel isoform of syntaxin 1 is expressed in mammalian cells."
    Jagadish M.N., Tellam J.T., Macaulay S.L., Gough K.H., James D.E., Ward C.W.
    Biochem. J. 321:151-156(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Adipose tissue.
  5. "Mapping of the human HPC-1/syntaxin 1A gene (STX1A) to chromosome 7 band q11.2."
    Nakayama T., Fujiwara T., Miyazawa A., Asakawa S., Shimizu N., Shimizu Y., Mikoshiba K., Akagawa K.
    Genomics 42:173-176(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  6. "Expression of syntaxin 1C, an alternative splice variant of HPC-1/syntaxin 1A, is enhanced by phorbol-ester stimulation in astroglioma: participation of the PKC signaling pathway."
    Nakayama T., Mikoshiba K., Yamamori T., Akagawa K.
    FEBS Lett. 536:209-214(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  7. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain and Lung.
  10. "Human syntaxin is homologous with rat syntaxin A and digested by BoNT C."
    Zhang R.-D., Simpson L.
    Submitted (SEP-1994) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-288 (ISOFORM 1).
    Tissue: Brain.
  11. "Expression analysis of the human HPC-1/syntaxin 1A, a gene deleted in Williams syndrome."
    Botta A., Calza L., Giardino L., Potenza S., Novelli G., Dallapiccola B.
    Genomics 62:525-528(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  12. "Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion."
    Polgar J., Chung S.H., Reed G.L.
    Blood 100:1081-1083(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH VAMP8 AND SNAP23.
  13. "Ca2+-dependent phosphorylation of syntaxin-1A by the death-associated protein (DAP) kinase regulates its interaction with Munc18."
    Tian J.H., Das S., Sheng Z.H.
    J. Biol. Chem. 278:26265-26274(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-188, INTERACTION WITH DAPK1 AND STXBP1.
  14. "Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons."
    Su Q., Cai Q., Gerwin C., Smith C.L., Sheng Z.-H.
    Nat. Cell Biol. 6:941-953(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SYBU.
  15. "Phosphoproteomic analysis of synaptosomes from human cerebral cortex."
    DeGiorgis J.A., Jaffe H., Moreira J.E., Carlotti C.G. Jr., Leite J.P., Pant H.C., Dosemeci A.
    J. Proteome Res. 4:306-315(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain cortex.

Entry informationi

Entry nameiSTX1A_HUMAN
AccessioniPrimary (citable) accession number: Q16623
Secondary accession number(s): O15447
, O15448, Q12936, Q75MD9, Q7Z5K3, Q9BPZ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 147 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi