Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q16623

- STX1A_HUMAN

UniProt

Q16623 - STX1A_HUMAN

Protein

Syntaxin-1A

Gene

STX1A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 148 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Potentially involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.

    GO - Molecular functioni

    1. calcium channel inhibitor activity Source: Ensembl
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. calcium ion-dependent exocytosis Source: Ensembl
    2. cellular protein metabolic process Source: Reactome
    3. energy reserve metabolic process Source: Reactome
    4. glutamate secretion Source: Reactome
    5. intracellular protein transport Source: InterPro
    6. neurotransmitter secretion Source: Reactome
    7. positive regulation of exocytosis Source: Ensembl
    8. positive regulation of neurotransmitter secretion Source: Ensembl
    9. regulation of insulin secretion Source: UniProtKB
    10. response to gravity Source: Ensembl
    11. small molecule metabolic process Source: Reactome
    12. synaptic transmission Source: Reactome
    13. synaptic vesicle docking involved in exocytosis Source: Ensembl

    Keywords - Biological processi

    Exocytosis, Neurotransmitter transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_12591. Glutamate Neurotransmitter Release Cycle.
    REACT_15293. Dopamine Neurotransmitter Release Cycle.
    REACT_15309. Acetylcholine Neurotransmitter Release Cycle.
    REACT_15418. Norepinephrine Neurotransmitter Release Cycle.
    REACT_15425. Serotonin Neurotransmitter Release Cycle.
    REACT_15550. Insulin processing.
    REACT_18325. Regulation of insulin secretion.
    REACT_200658. Toxicity of botulinum toxin type C (BoNT/C).
    REACT_23947. GABA synthesis, release, reuptake and degradation.

    Protein family/group databases

    TCDBi1.F.1.1.1. the synaptosomal vesicle fusion pore (svf-pore) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Syntaxin-1A
    Alternative name(s):
    Neuron-specific antigen HPC-1
    Gene namesi
    Name:STX1A
    Synonyms:STX1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:11433. STX1A.

    Subcellular locationi

    GO - Cellular componenti

    1. actomyosin Source: Ensembl
    2. cell junction Source: UniProtKB-KW
    3. extracellular region Source: UniProtKB-SubCell
    4. integral component of membrane Source: UniProtKB-KW
    5. neuron projection Source: MGI
    6. plasma membrane Source: Reactome
    7. secretory granule Source: Ensembl
    8. SNARE complex Source: UniProtKB
    9. synaptic vesicle membrane Source: UniProtKB-SubCell
    10. synaptobrevin 2-SNAP-25-syntaxin-1a complex Source: Ensembl
    11. synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex Source: Ensembl
    12. synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex Source: Ensembl

    Keywords - Cellular componenti

    Cell junction, Cytoplasmic vesicle, Membrane, Secreted, Synapse, Synaptosome

    Pathology & Biotechi

    Involvement in diseasei

    STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.

    Keywords - Diseasei

    Williams-Beuren syndrome

    Organism-specific databases

    Orphaneti586. Cystic fibrosis.
    PharmGKBiPA36233.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 288288Syntaxin-1APRO_0000210186Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei14 – 141Phosphoserine1 Publication
    Modified residuei188 – 1881Phosphoserine; by DAPK11 Publication

    Post-translational modificationi

    Phosphorylated by CK2 By similarity. Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.By similarity2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ16623.
    PRIDEiQ16623.

    PTM databases

    PhosphoSiteiQ16623.

    Expressioni

    Tissue specificityi

    Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.1 Publication

    Gene expression databases

    ArrayExpressiQ16623.
    BgeeiQ16623.
    CleanExiHS_STX1A.
    GenevestigatoriQ16623.

    Organism-specific databases

    HPAiCAB008372.

    Interactioni

    Subunit structurei

    Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Binds SYTL4 and STXBP6. Found in a ternary complex with STX1A and SNAP25. Interacts with OTOF and LGI3. Interacts with SLC6A4. Interacts with SYT6 and SYT8; the interaction is Ca2+-dependent By similarity. Found in a complex with VAMP8 and SNAP23. Interacts with VAPA and SYBU. Interacts with STXBP1 and DAPK1.By similarity3 Publications

    Protein-protein interaction databases

    BioGridi112676. 44 interactions.
    DIPiDIP-390N.
    IntActiQ16623. 6 interactions.
    MINTiMINT-255942.
    STRINGi9606.ENSP00000222812.

    Structurei

    3D structure databases

    ProteinModelPortaliQ16623.
    SMRiQ16623. Positions 27-286.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 265265CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini287 – 2882ExtracellularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei266 – 28621Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini192 – 25463t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili68 – 10942Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the syntaxin family.Curated
    Contains 1 t-SNARE coiled-coil homology domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5074.
    HOGENOMiHOG000286023.
    HOVERGENiHBG000497.
    InParanoidiQ16623.
    KOiK04560.
    OMAiHEETKAV.
    PhylomeDBiQ16623.
    TreeFamiTF313763.

    Family and domain databases

    InterProiIPR028669. STX1A/1B.
    IPR006012. Syntaxin/epimorphin_CS.
    IPR006011. Syntaxin_N.
    IPR010989. t-SNARE.
    IPR000727. T_SNARE_dom.
    [Graphical view]
    PANTHERiPTHR19957:SF84. PTHR19957:SF84. 1 hit.
    PfamiPF05739. SNARE. 1 hit.
    PF00804. Syntaxin. 1 hit.
    [Graphical view]
    SMARTiSM00503. SynN. 1 hit.
    SM00397. t_SNARE. 1 hit.
    [Graphical view]
    SUPFAMiSSF47661. SSF47661. 1 hit.
    PROSITEiPS00914. SYNTAXIN. 1 hit.
    PS50192. T_SNARE. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q16623-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN    50
    VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI 100
    EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ 150
    RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS 200
    EIIKLENSIR ELHDMFMDMA MLVESQGEMI DRIEYNVEHA VDYVERAVSD 250
    TKKAVKYQSK ARRKKIMIII CCVILGIVIA STVGGIFA 288
    Length:288
    Mass (Da):33,023
    Last modified:November 1, 1996 - v1
    Checksum:i8AC787EFCE65ACA1
    GO
    Isoform 2 (identifier: Q16623-2) [UniParc]FASTAAdd to Basket

    Also known as: 1C

    The sequence of this isoform differs from the canonical sequence as follows:
         227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD

    Note: Expression is up-regulated by phorbol 12-myristate 13-acetate (PMA), but not by forskolin.

    Show »
    Length:260
    Mass (Da):29,632
    Checksum:i546C1582FE83499E
    GO
    Isoform 3 (identifier: Q16623-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-288: GEMIDRIEYN...IASTVGGIFA → TMWRGPCLTPRRPSSTRARRAGRKS

    Show »
    Length:251
    Mass (Da):28,995
    Checksum:iC885D46384137E0B
    GO

    Sequence cautioni

    The sequence AAA20940.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti73 – 731E → V in AAA20940. 1 PublicationCurated
    Sequence conflicti140 – 1401D → V in AAA20940. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei227 – 28862GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2. 2 PublicationsVSP_006338Add
    BLAST
    Alternative sequencei227 – 28862GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3. 1 PublicationVSP_006339Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L37792 mRNA. Translation: AAA53519.1.
    U87315
    , AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAK54507.2.
    U87315
    , AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA. Translation: AAB65500.2.
    D37932 mRNA. Translation: BAA07151.1.
    AB086954 mRNA. Translation: BAC78519.1.
    AC073846 Genomic DNA. Translation: AAS07470.1.
    CH471200 Genomic DNA. Translation: EAW69650.1.
    BC000444 mRNA. No translation available.
    BC003011 mRNA. Translation: AAH03011.1.
    BC064644 mRNA. Translation: AAH64644.1.
    U12918 mRNA. Translation: AAA20940.1. Different initiation.
    CCDSiCCDS34655.1. [Q16623-1]
    CCDS55120.1. [Q16623-3]
    RefSeqiNP_001159375.1. NM_001165903.1. [Q16623-3]
    NP_004594.1. NM_004603.3. [Q16623-1]
    UniGeneiHs.647024.

    Genome annotation databases

    EnsembliENST00000222812; ENSP00000222812; ENSG00000106089. [Q16623-1]
    ENST00000395155; ENSP00000378584; ENSG00000106089.
    ENST00000395156; ENSP00000378585; ENSG00000106089. [Q16623-3]
    GeneIDi6804.
    KEGGihsa:6804.
    UCSCiuc003tyx.3. human. [Q16623-1]
    uc003tyy.3. human. [Q16623-3]

    Polymorphism databases

    DMDMi2501084.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L37792 mRNA. Translation: AAA53519.1 .
    U87315
    , AF297001 , AF297002 , U87310 , AF297003 , U87314 Genomic DNA. Translation: AAK54507.2 .
    U87315
    , AF297001 , AF297002 , U87310 , AF297003 , U87314 Genomic DNA. Translation: AAB65500.2 .
    D37932 mRNA. Translation: BAA07151.1 .
    AB086954 mRNA. Translation: BAC78519.1 .
    AC073846 Genomic DNA. Translation: AAS07470.1 .
    CH471200 Genomic DNA. Translation: EAW69650.1 .
    BC000444 mRNA. No translation available.
    BC003011 mRNA. Translation: AAH03011.1 .
    BC064644 mRNA. Translation: AAH64644.1 .
    U12918 mRNA. Translation: AAA20940.1 . Different initiation.
    CCDSi CCDS34655.1. [Q16623-1 ]
    CCDS55120.1. [Q16623-3 ]
    RefSeqi NP_001159375.1. NM_001165903.1. [Q16623-3 ]
    NP_004594.1. NM_004603.3. [Q16623-1 ]
    UniGenei Hs.647024.

    3D structure databases

    ProteinModelPortali Q16623.
    SMRi Q16623. Positions 27-286.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112676. 44 interactions.
    DIPi DIP-390N.
    IntActi Q16623. 6 interactions.
    MINTi MINT-255942.
    STRINGi 9606.ENSP00000222812.

    Protein family/group databases

    TCDBi 1.F.1.1.1. the synaptosomal vesicle fusion pore (svf-pore) family.

    PTM databases

    PhosphoSitei Q16623.

    Polymorphism databases

    DMDMi 2501084.

    Proteomic databases

    PaxDbi Q16623.
    PRIDEi Q16623.

    Protocols and materials databases

    DNASUi 6804.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000222812 ; ENSP00000222812 ; ENSG00000106089 . [Q16623-1 ]
    ENST00000395155 ; ENSP00000378584 ; ENSG00000106089 .
    ENST00000395156 ; ENSP00000378585 ; ENSG00000106089 . [Q16623-3 ]
    GeneIDi 6804.
    KEGGi hsa:6804.
    UCSCi uc003tyx.3. human. [Q16623-1 ]
    uc003tyy.3. human. [Q16623-3 ]

    Organism-specific databases

    CTDi 6804.
    GeneCardsi GC07M073113.
    HGNCi HGNC:11433. STX1A.
    HPAi CAB008372.
    MIMi 186590. gene.
    neXtProti NX_Q16623.
    Orphaneti 586. Cystic fibrosis.
    PharmGKBi PA36233.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5074.
    HOGENOMi HOG000286023.
    HOVERGENi HBG000497.
    InParanoidi Q16623.
    KOi K04560.
    OMAi HEETKAV.
    PhylomeDBi Q16623.
    TreeFami TF313763.

    Enzyme and pathway databases

    Reactomei REACT_12591. Glutamate Neurotransmitter Release Cycle.
    REACT_15293. Dopamine Neurotransmitter Release Cycle.
    REACT_15309. Acetylcholine Neurotransmitter Release Cycle.
    REACT_15418. Norepinephrine Neurotransmitter Release Cycle.
    REACT_15425. Serotonin Neurotransmitter Release Cycle.
    REACT_15550. Insulin processing.
    REACT_18325. Regulation of insulin secretion.
    REACT_200658. Toxicity of botulinum toxin type C (BoNT/C).
    REACT_23947. GABA synthesis, release, reuptake and degradation.

    Miscellaneous databases

    GeneWikii STX1A.
    GenomeRNAii 6804.
    NextBioi 26565.
    PROi Q16623.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q16623.
    Bgeei Q16623.
    CleanExi HS_STX1A.
    Genevestigatori Q16623.

    Family and domain databases

    InterProi IPR028669. STX1A/1B.
    IPR006012. Syntaxin/epimorphin_CS.
    IPR006011. Syntaxin_N.
    IPR010989. t-SNARE.
    IPR000727. T_SNARE_dom.
    [Graphical view ]
    PANTHERi PTHR19957:SF84. PTHR19957:SF84. 1 hit.
    Pfami PF05739. SNARE. 1 hit.
    PF00804. Syntaxin. 1 hit.
    [Graphical view ]
    SMARTi SM00503. SynN. 1 hit.
    SM00397. t_SNARE. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47661. SSF47661. 1 hit.
    PROSITEi PS00914. SYNTAXIN. 1 hit.
    PS50192. T_SNARE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and sequence analysis of a cDNA encoding human syntaxin 1A, a polypeptide essential for exocytosis."
      Zhang R.-D., Maksymowych A.B., Simpson L.L.
      Gene 159:293-294(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Hemizygous deletion of the syntaxin 1A gene in individuals with Williams syndrome."
      Osborne L.R., Soder S., Shi X.-M., Pober B., Costa T., Scherer S.W., Tsui L.-C.
      Am. J. Hum. Genet. 61:449-452(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
    3. "Refinement of the genomic structure of STX1A and mutation analysis in nondeletion Williams syndrome patients."
      Wu Y.-Q., Bejjani B.A., Tsui L.-C., Mandel A., Osborne L.R., Shaffer L.G.
      Am. J. Med. Genet. 109:121-124(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), SEQUENCE REVISION TO 144.
    4. "Novel isoform of syntaxin 1 is expressed in mammalian cells."
      Jagadish M.N., Tellam J.T., Macaulay S.L., Gough K.H., James D.E., Ward C.W.
      Biochem. J. 321:151-156(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Adipose tissue.
    5. "Mapping of the human HPC-1/syntaxin 1A gene (STX1A) to chromosome 7 band q11.2."
      Nakayama T., Fujiwara T., Miyazawa A., Asakawa S., Shimizu N., Shimizu Y., Mikoshiba K., Akagawa K.
      Genomics 42:173-176(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    6. "Expression of syntaxin 1C, an alternative splice variant of HPC-1/syntaxin 1A, is enhanced by phorbol-ester stimulation in astroglioma: participation of the PKC signaling pathway."
      Nakayama T., Mikoshiba K., Yamamori T., Akagawa K.
      FEBS Lett. 536:209-214(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    7. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Brain and Lung.
    10. "Human syntaxin is homologous with rat syntaxin A and digested by BoNT C."
      Zhang R.-D., Simpson L.
      Submitted (SEP-1994) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 15-288 (ISOFORM 1).
      Tissue: Brain.
    11. "Expression analysis of the human HPC-1/syntaxin 1A, a gene deleted in Williams syndrome."
      Botta A., Calza L., Giardino L., Potenza S., Novelli G., Dallapiccola B.
      Genomics 62:525-528(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    12. "Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion."
      Polgar J., Chung S.H., Reed G.L.
      Blood 100:1081-1083(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN A COMPLEX WITH VAMP8 AND SNAP23.
    13. "Ca2+-dependent phosphorylation of syntaxin-1A by the death-associated protein (DAP) kinase regulates its interaction with Munc18."
      Tian J.H., Das S., Sheng Z.H.
      J. Biol. Chem. 278:26265-26274(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-188, INTERACTION WITH DAPK1 AND STXBP1.
    14. "Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons."
      Su Q., Cai Q., Gerwin C., Smith C.L., Sheng Z.-H.
      Nat. Cell Biol. 6:941-953(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SYBU.
    15. "Phosphoproteomic analysis of synaptosomes from human cerebral cortex."
      DeGiorgis J.A., Jaffe H., Moreira J.E., Carlotti C.G. Jr., Leite J.P., Pant H.C., Dosemeci A.
      J. Proteome Res. 4:306-315(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain cortex.

    Entry informationi

    Entry nameiSTX1A_HUMAN
    AccessioniPrimary (citable) accession number: Q16623
    Secondary accession number(s): O15447
    , O15448, Q12936, Q75MD9, Q7Z5K3, Q9BPZ6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 148 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3