Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuronal regeneration-related protein

Gene

NREP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation.By similarity2 Publications

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal regeneration-related protein
Alternative name(s):
Neuronal protein 3.1
Protein p311
Gene namesi
Name:NREP
Synonyms:C5orf13, P311
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:16834. NREP.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi59 – 591S → A: Reduces protein degradation and induces glioma cell migration. 1 Publication
Mutagenesisi59 – 591S → D: Accelerates protein degradation and reduces glioma cell migration. 1 Publication

Organism-specific databases

PharmGKBiPA128394547.

Polymorphism and mutation databases

BioMutaiNREP.
DMDMi2833275.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 6868Neuronal regeneration-related proteinPRO_0000057937Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei59 – 591Phosphoserine1 Publication

Post-translational modificationi

Phosphorylated on Ser-59. Phosphorylation decreases stability and activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ16612.
PaxDbiQ16612.
PRIDEiQ16612.

PTM databases

iPTMnetiQ16612.
PhosphoSiteiQ16612.

Expressioni

Tissue specificityi

Expressed in lung (at protein level).1 Publication

Developmental stagei

In embryos of gestational week (gw) 24, detected mostly in the epithelial cells of saccular surfaces. In gw 39, detected in the cells lining the alveolar surfaces as well as in the mesenchyme (at protein level).1 Publication

Inductioni

Down-regulated in emphysematous lung compared to normal lung.1 Publication

Gene expression databases

BgeeiQ16612.
CleanExiHS_C5orf13.
ExpressionAtlasiQ16612. baseline and differential.
GenevisibleiQ16612. HS.

Organism-specific databases

HPAiHPA000545.

Interactioni

Subunit structurei

Interacts with the latency-associated peptides (LAP) of TGFB1 and TGFB2; the interaction results in a decrease in TGFB autoinduction (By similarity). Interacts with FLNA.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
EIF6P565375EBI-718657,EBI-372243

Protein-protein interaction databases

BioGridi114727. 6 interactions.
IntActiQ16612. 5 interactions.
MINTiMINT-1368798.

Structurei

3D structure databases

ProteinModelPortaliQ16612.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J38C. Eukaryota.
ENOG4111AXH. LUCA.
GeneTreeiENSGT00390000016521.
HOGENOMiHOG000237339.
HOVERGENiHBG052654.
InParanoidiQ16612.
OMAiQRSRMTG.
PhylomeDBiQ16612.
TreeFamiTF336368.

Family and domain databases

InterProiIPR024417. Neuronal_3.1.
[Graphical view]
PANTHERiPTHR17102. PTHR17102. 1 hit.
PfamiPF11092. Alveol-reg_P311. 1 hit.
[Graphical view]
ProDomiPD019364. PD019364. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16612-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVYYPELFVW VSQEPFPNKD MEGRLPKGRL PVPKEVNRKK NDETNAASLT
60
PLGSSELRSP RISYLHFF
Length:68
Mass (Da):7,909
Last modified:November 1, 1996 - v1
Checksum:i4E612BC929D45122
GO
Isoform 2 (identifier: Q16612-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKGVWNYSALSRREDETRTQRSRMTDRVPCSKCFQVHCQISVLNC

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):13,081
Checksum:i60EE27856489627B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti43 – 431E → G.
Corresponds to variant rs11559 [ dbSNP | Ensembl ].
VAR_051238

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MKGVWNYSALSRREDETRTQ RSRMTDRVPCSKCFQVHCQI SVLNC in isoform 2. 1 PublicationVSP_043013

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36189 mRNA. Translation: AAA93255.1.
U30521 mRNA. Translation: AAA74903.1.
AK298779 mRNA. Translation: BAH12868.1.
AK315617 mRNA. Translation: BAG37985.1.
CH471086 Genomic DNA. Translation: EAW49019.1.
CH471086 Genomic DNA. Translation: EAW49020.1.
CH471086 Genomic DNA. Translation: EAW49021.1.
CH471086 Genomic DNA. Translation: EAW49023.1.
CH471086 Genomic DNA. Translation: EAW49025.1.
BC011050 mRNA. Translation: AAH11050.1.
BC019068 mRNA. Translation: AAH19068.1.
BC072013 mRNA. Translation: AAH72013.1.
BC072443 mRNA. Translation: AAH72443.1.
CCDSiCCDS4105.1. [Q16612-1]
CCDS47255.1. [Q16612-2]
PIRiG02089.
RefSeqiNP_001135947.1. NM_001142475.1. [Q16612-2]
NP_001135948.1. NM_001142476.1. [Q16612-1]
NP_001135949.1. NM_001142477.1. [Q16612-1]
NP_001135950.1. NM_001142478.1. [Q16612-1]
NP_001135951.1. NM_001142479.1. [Q16612-1]
NP_001135952.1. NM_001142480.1. [Q16612-1]
NP_001135953.1. NM_001142481.1. [Q16612-1]
NP_001135954.1. NM_001142482.1. [Q16612-1]
NP_001135955.1. NM_001142483.1. [Q16612-1]
NP_004763.1. NM_004772.2. [Q16612-1]
UniGeneiHs.36053.
Hs.732682.
Hs.745061.

Genome annotation databases

EnsembliENST00000257435; ENSP00000257435; ENSG00000134986. [Q16612-1]
ENST00000379671; ENSP00000368993; ENSG00000134986. [Q16612-1]
ENST00000395634; ENSP00000378996; ENSG00000134986. [Q16612-2]
ENST00000419114; ENSP00000399766; ENSG00000134986. [Q16612-1]
ENST00000446294; ENSP00000402965; ENSG00000134986. [Q16612-1]
ENST00000447165; ENSP00000408839; ENSG00000134986. [Q16612-1]
ENST00000450761; ENSP00000416617; ENSG00000134986. [Q16612-1]
ENST00000453526; ENSP00000403383; ENSG00000134986. [Q16612-1]
ENST00000455559; ENSP00000392559; ENSG00000134986. [Q16612-1]
ENST00000508870; ENSP00000427149; ENSG00000134986. [Q16612-1]
ENST00000509427; ENSP00000422630; ENSG00000134986. [Q16612-1]
GeneIDi9315.
UCSCiuc003kpl.3. human. [Q16612-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36189 mRNA. Translation: AAA93255.1.
U30521 mRNA. Translation: AAA74903.1.
AK298779 mRNA. Translation: BAH12868.1.
AK315617 mRNA. Translation: BAG37985.1.
CH471086 Genomic DNA. Translation: EAW49019.1.
CH471086 Genomic DNA. Translation: EAW49020.1.
CH471086 Genomic DNA. Translation: EAW49021.1.
CH471086 Genomic DNA. Translation: EAW49023.1.
CH471086 Genomic DNA. Translation: EAW49025.1.
BC011050 mRNA. Translation: AAH11050.1.
BC019068 mRNA. Translation: AAH19068.1.
BC072013 mRNA. Translation: AAH72013.1.
BC072443 mRNA. Translation: AAH72443.1.
CCDSiCCDS4105.1. [Q16612-1]
CCDS47255.1. [Q16612-2]
PIRiG02089.
RefSeqiNP_001135947.1. NM_001142475.1. [Q16612-2]
NP_001135948.1. NM_001142476.1. [Q16612-1]
NP_001135949.1. NM_001142477.1. [Q16612-1]
NP_001135950.1. NM_001142478.1. [Q16612-1]
NP_001135951.1. NM_001142479.1. [Q16612-1]
NP_001135952.1. NM_001142480.1. [Q16612-1]
NP_001135953.1. NM_001142481.1. [Q16612-1]
NP_001135954.1. NM_001142482.1. [Q16612-1]
NP_001135955.1. NM_001142483.1. [Q16612-1]
NP_004763.1. NM_004772.2. [Q16612-1]
UniGeneiHs.36053.
Hs.732682.
Hs.745061.

3D structure databases

ProteinModelPortaliQ16612.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114727. 6 interactions.
IntActiQ16612. 5 interactions.
MINTiMINT-1368798.

PTM databases

iPTMnetiQ16612.
PhosphoSiteiQ16612.

Polymorphism and mutation databases

BioMutaiNREP.
DMDMi2833275.

Proteomic databases

EPDiQ16612.
PaxDbiQ16612.
PRIDEiQ16612.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257435; ENSP00000257435; ENSG00000134986. [Q16612-1]
ENST00000379671; ENSP00000368993; ENSG00000134986. [Q16612-1]
ENST00000395634; ENSP00000378996; ENSG00000134986. [Q16612-2]
ENST00000419114; ENSP00000399766; ENSG00000134986. [Q16612-1]
ENST00000446294; ENSP00000402965; ENSG00000134986. [Q16612-1]
ENST00000447165; ENSP00000408839; ENSG00000134986. [Q16612-1]
ENST00000450761; ENSP00000416617; ENSG00000134986. [Q16612-1]
ENST00000453526; ENSP00000403383; ENSG00000134986. [Q16612-1]
ENST00000455559; ENSP00000392559; ENSG00000134986. [Q16612-1]
ENST00000508870; ENSP00000427149; ENSG00000134986. [Q16612-1]
ENST00000509427; ENSP00000422630; ENSG00000134986. [Q16612-1]
GeneIDi9315.
UCSCiuc003kpl.3. human. [Q16612-1]

Organism-specific databases

CTDi9315.
GeneCardsiNREP.
HGNCiHGNC:16834. NREP.
HPAiHPA000545.
MIMi607332. gene.
neXtProtiNX_Q16612.
PharmGKBiPA128394547.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J38C. Eukaryota.
ENOG4111AXH. LUCA.
GeneTreeiENSGT00390000016521.
HOGENOMiHOG000237339.
HOVERGENiHBG052654.
InParanoidiQ16612.
OMAiQRSRMTG.
PhylomeDBiQ16612.
TreeFamiTF336368.

Miscellaneous databases

GeneWikiiC5orf13.
GenomeRNAii9315.
NextBioi34895.
PROiQ16612.
SOURCEiSearch...

Gene expression databases

BgeeiQ16612.
CleanExiHS_C5orf13.
ExpressionAtlasiQ16612. baseline and differential.
GenevisibleiQ16612. HS.

Family and domain databases

InterProiIPR024417. Neuronal_3.1.
[Graphical view]
PANTHERiPTHR17102. PTHR17102. 1 hit.
PfamiPF11092. Alveol-reg_P311. 1 hit.
[Graphical view]
ProDomiPD019364. PD019364. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a human heart cDNA sequence homologue of mouse P311 protein."
    Tsui S.K.W., Fung K.P., Waye M.M.Y., Lee C.Y.
    Submitted (APR-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  2. Studler J.-M.
    Submitted (JUN-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Cerebellum.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain, Lymph and Skin.
  6. "Identification and validation of P311 as a glioblastoma invasion gene using laser capture microdissection."
    Mariani L., McDonough W.S., Hoelzinger D.B., Beaudry C., Kaczmarek E., Coons S.W., Giese A., Moghaddam M., Seiler R.W., Berens M.E.
    Cancer Res. 61:4190-4196(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  7. "Regulation of glioma cell migration by serine-phosphorylated P311."
    McDonough W.S., Tran N.L., Berens M.E.
    Neoplasia 7:862-872(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH FLNA, PHOSPHORYLATION AT SER-59, MUTAGENESIS OF SER-59.
  8. "Identification of P311 as a potential gene regulating alveolar generation."
    Zhao L., Leung J.K., Yamamoto H., Goswami S., Kheradmand F., Vu T.H.
    Am. J. Respir. Cell Mol. Biol. 35:48-54(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INDUCTION.

Entry informationi

Entry nameiNREP_HUMAN
AccessioniPrimary (citable) accession number: Q16612
Secondary accession number(s): B2RDN8, B7Z5D2, D3DSZ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: March 16, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.