Q16595 (FRDA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Frataxin, mitochondrial EC=1.16.3.1 Alternative name(s): Friedreich ataxia protein Short name=Fxn Cleaved into the following 4 chains:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 210 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1. Ref.6 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.22 Ref.25 |
| Catalytic activity | 4 Fe2+ + 4 H+ + O2 = 4 Fe3+ + 2 H2O. Ref.20 |
| Subunit structure | Monomer (probable predominant form). Oligomer. Monomers and polymeric aggregates of >1 MDa have been isolated from mitochondria. A small fraction of heterologous overexpressed recombinant frataxin forms high-molecular wight aggregates that incoroprate iron. Interacts with LYRM4 AND HSPA9. Interacts with ACO1. Interacts with ISCU isoform 1 and isoform 2. Interacts with FECH; one iron-bound FXN monomer seems to interact with a FECH homodimer. Interacts with SDHA and SDHB. Interacts with ACO2; the interaction is dependent on citrate By similarity. Ref.6 Ref.15 Ref.16 Ref.17 Ref.18 Ref.20 Ref.21 Ref.23 Ref.24 Ref.26 |
| Subcellular location | Cytoplasm. Mitochondrion. Note: Ref.4 reports localization exclusively in mitochondria. Ref.4 Ref.6 Ref.10 Ref.11 Ref.23 Ref.24 Ref.25 |
| Tissue specificity | Expressed in the heart, peripheral blood lymphocytes and dermal fibroblasts. Ref.5 |
| Post-translational modification | Processed in two steps by mitochondrial processing peptidase (MPP). MPP first cleaves the precursor to intermediate form and subsequently converts the intermediate to yield frataxin mature form (frataxin(81-210)) which is the predominant form. The additional forms, frataxin(56-210) and frataxin(78-210), seem to be produced when the normal maturation process is impaired; their physiological relevance is unsure. |
| Involvement in disease | Defects in FXN are the cause of Friedreich ataxia (FRDA) [MIM:229300]. FRDA is an autosomal recessive, progressive degenerative disease characterized by neurodegeneration and cardiomyopathy it is the most common inherited ataxia. The disorder is usually manifest before adolescence and is generally characterized by incoordination of limb movements, dysarthria, nystagmus, diminished or absent tendon reflexes, Babinski sign, impairment of position and vibratory senses, scoliosis, pes cavus, and hammer toe. In most patients, FRDA is due to GAA triplet repeat expansions in the first intron of the frataxin gene. But in some cases the disease is due to mutations in the coding region. Ref.7 Ref.8 Ref.30 Ref.31 Ref.32 Ref.33 Ref.34 Ref.35 Ref.36 |
| Miscellaneous | The unusual migration profile of mature frataxin on SDS-PAGE due to its acidic N-terminus most likely contributed to conflicting reports for the N-terminus of the mature protein. Unlike prokaryotic and yeast frataxin homologs, which self-assemble at high iron concentrations, oligomerization of human frataxin is not induced by iron. The existence of a specialized mitochondrial ferritin in mammalia (FTMT) is suggesting that iron storage would be redundant function, at least in mammalian mitochondria. |
| Sequence similarities | Belongs to the frataxin family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16595-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16595-2) The sequence of this isoform differs from the canonical sequence as follows: 161-210: SGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA → RLTWLLWLFHP | ||||||
| Note: Not highly expressed and may be artifactual. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 41 | 41 | Mitochondrion | |||||||||||||||||||||||
| Chain | 42 – 210 | 169 | Frataxin intermediate form | PRO_0000010129 | ||||||||||||||||||||||
| Chain | 56 – 210 | 155 | Frataxin(56-210) | PRO_0000010130 | ||||||||||||||||||||||
| Chain | 78 – 210 | 133 | Frataxin(78-210) | PRO_0000399388 | ||||||||||||||||||||||
| Chain | 81 – 210 | 130 | Frataxin mature form | PRO_0000289331 | ||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 161 – 210 | 50 | SGPKR…SGKDA → RLTWLLWLFHP in isoform 2. | VSP_001576 | ||||||||||||||||||||||
| Natural variant | 106 | 1 | L → S in FRDA. Ref.31 | VAR_016065 | ||||||||||||||||||||||
| Natural variant | 122 | 1 | D → Y in FRDA. Ref.7 Ref.8 Ref.33 | VAR_002428 | ||||||||||||||||||||||
| Natural variant | 130 | 1 | G → V in FRDA. Ref.30 Ref.32 Ref.33 | VAR_002429 | ||||||||||||||||||||||
| Natural variant | 154 | 1 | I → F in FRDA; reduces interaction with LYRM4; the interaction is rescued by nickel. Defects in mitochondrial structure, mitochondrial iron deposits, decreased enzymatic activity of some mitochondrial and cytoplasmic iron-sulfur cluster-containing enzymes, increased RNA-binding activity of ACO1 and increased sensitivity to oxidative stress. Ref.1 Ref.26 Ref.30 Ref.36 | VAR_002430 | ||||||||||||||||||||||
| Natural variant | 155 | 1 | W → R in FRDA; reduces interaction with LYRM4; the interaction is rescued by nickel. Ref.26 Ref.34 | VAR_002431 | ||||||||||||||||||||||
| Natural variant | 165 | 1 | R → C in FRDA; mild form. Ref.32 | VAR_008139 | ||||||||||||||||||||||
| Natural variant | 182 | 1 | L → F in FRDA. Ref.32 | VAR_008140 | ||||||||||||||||||||||
| Natural variant | 198 | 1 | L → R in FRDA. Ref.35 | VAR_016066 | ||||||||||||||||||||||
| Natural variant | 202 | 1 | S → C. Corresponds to variant rs1052195 [ dbSNP | Ensembl ]. | VAR_049100 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Mutagenesis | 39 – 40 | 2 | RR → GG: Abolishes cleavage to yield frataxin intermediate form and allows accumulation of frataxin(56-210) and frataxin(78-210). Ref.4 Ref.5 | |||||||||||||||||||||||
| Mutagenesis | 53 – 54 | 2 | RR → GG: No effect on processing of wild-type FXN. Ref.4 Ref.5 | |||||||||||||||||||||||
| Mutagenesis | 78 – 79 | 2 | LR → GG: Abolishes cleavage to yield frataxin mature form and allows accumulation of frataxin(56-210) and frataxin(78-210). Ref.4 Ref.5 | |||||||||||||||||||||||
| Mutagenesis | 79 – 80 | 2 | RK → GG: Abolishes cleavage to yield frataxin mature form and allows the accumulation of frataxin(56-210). Ref.4 Ref.5 | |||||||||||||||||||||||
| Sequence conflict | 175 | 1 | Y → F in AAA98508. Ref.1 | |||||||||||||||||||||||
| Sequence conflict | 175 | 1 | Y → F in AAA98510. Ref.1 | |||||||||||||||||||||||
| Sequence conflict | 202 | 1 | S → W in AAA98508. Ref.1 | |||||||||||||||||||||||
| Sequence conflict | 202 | 1 | S → W in AAA98510. Ref.1 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Helix | 92 – 113 | 22 | ||||||||||||||||||||||||
| Beta strand | 124 – 128 | 5 | ||||||||||||||||||||||||
| Beta strand | 131 – 135 | 5 | ||||||||||||||||||||||||
| Beta strand | 142 – 148 | 7 | ||||||||||||||||||||||||
| Turn | 149 – 152 | 4 | ||||||||||||||||||||||||
| Beta strand | 153 – 158 | 6 | ||||||||||||||||||||||||
| Turn | 159 – 161 | 3 | ||||||||||||||||||||||||
| Beta strand | 162 – 168 | 7 | ||||||||||||||||||||||||
| Beta strand | 170 – 175 | 6 | ||||||||||||||||||||||||
| Turn | 176 – 178 | 3 | ||||||||||||||||||||||||
| Helix | 182 – 194 | 13 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Friedreich's ataxia: autosomal recessive disease caused by an intronic GAA triplet repeat expansion." Campuzano V., Montermini L., Molto M.D., Pianese L., Cossee M., Cavalcanti F., Monros E., Rodius F., Duclos F., Monticelli A., Zara F., Canizares J., Koutnikova H., Bidichandani S., Gellera C., Brice A., Trouillas P., de Michele G. Pandolfo M.Science 271:1423-1427(1996) [PubMed: 8596916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, VARIANT PHE-154. |
| [2] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Eye. |
| [4] | "The in vivo mitochondrial two-step maturation of human frataxin." Schmucker S., Argentini M., Carelle-Calmels N., Martelli A., Puccio H. Hum. Mol. Genet. 17:3521-3531(2008) [PubMed: 18725397] [Abstract] Cited for: PROTEIN SEQUENCE OF 81-90, PROTEOLYTIC PROCESSING, SUBCELLULAR LOCATION, MUTAGENESIS OF 39-ARG-ARG-40; 53-ARG-ARG-54; 78-LEU-ARG-79 AND 79-ARG-LYS-80. |
| [5] | "In vivo maturation of human frataxin." Condo I., Ventura N., Malisan F., Rufini A., Tomassini B., Testi R. Hum. Mol. Genet. 16:1534-1540(2007) [PubMed: 17468497] [Abstract] Cited for: PROTEIN SEQUENCE OF 81-86, PROTEOLYTIC PROCESSING, MUTAGENESIS OF 53-ARG-ARG-54 AND 79-ARG-LYS-80, TISSUE SPECIFICITY. |
| [6] | "Molecular control of the cytosolic aconitase/IRP1 switch by extramitochondrial frataxin." Condo I., Malisan F., Guccini I., Serio D., Rufini A., Testi R. Hum. Mol. Genet. 19:1221-1229(2010) [PubMed: 20053667] [Abstract] Cited for: PROTEIN SEQUENCE OF 81-86, FUNCTION, INTERACTION WITH ACO1, SUBCELLULAR LOCATION. |
| [7] | Kostrzewa M. Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 89-128, VARIANT FRDA TYR-122. |
| [8] | "A novel splice site mutation (384+1G-A) in the Friedreich's ataxia gene." Doudney J.D., Pook M.A., Al-Mahdawi S., Carvajal J.J., Hillerman R., Chamberlain S. Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 89-128, VARIANT FRDA TYR-122. |
| [9] | "Correct sequence in exon 5a of x25: human frataxin (FRDA), F175(TTC)-->Y175(TAC) and W202(TGG)-->S202(TCC)." Laccone F., Schloesser M. Submitted (MAR-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 162-210. |
| [10] | "Frataxin is reduced in Friedreich ataxia patients and is associated with mitochondrial membranes." Campuzano V., Montermini L., Lutz Y., Cova L., Hindelang C., Jiralerspong S., Trottier Y., Kish S.J., Faucheux B., Trouillas P., Authier F.J., Duerr A., Mandel J.-L., Vescovi A., Pandolfo M., Koenig M. Hum. Mol. Genet. 6:1771-1780(1997) [PubMed: 9302253] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [11] | "Studies of human, mouse and yeast homologues indicate a mitochondrial function for frataxin." Koutnikova H., Campuzano V., Foury F., Dolle P., Cazzalini O., Koenig M. Nat. Genet. 16:345-351(1997) [PubMed: 9241270] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "Maturation of frataxin within mammalian and yeast mitochondria: one-step processing by matrix processing peptidase." Gordon D.M., Shi Q., Dancis A., Pain D. Hum. Mol. Genet. 8:2255-2262(1999) [PubMed: 10545606] [Abstract] Cited for: PROTEOLYTIC PROCESSING. |
| [13] | "Yeast and human frataxin are processed to mature form in two sequential steps by the mitochondrial processing peptidase." Branda S.S., Cavadini P., Adamec J., Kalousek F., Taroni F., Isaya G. J. Biol. Chem. 274:22763-22769(1999) [PubMed: 10428860] [Abstract] Cited for: PROTEOLYTIC PROCESSING. |
| [14] | "Two-step processing of human frataxin by mitochondrial processing peptidase. Precursor and intermediate forms are cleaved at different rates." Cavadini P., Adamec J., Taroni F., Gakh O., Isaya G. J. Biol. Chem. 275:41469-41475(2000) [PubMed: 11020385] [Abstract] Cited for: PROTEOLYTIC PROCESSING. |
| [15] | "Assembly and iron-binding properties of human frataxin, the protein deficient in Friedreich ataxia." Cavadini P., O'Neill H.A., Benada O., Isaya G. Hum. Mol. Genet. 11:217-227(2002) [PubMed: 11823441] [Abstract] Cited for: POSSIBLE FUNCTION IN IRON STORAGE, SUBUNIT. |
| [16] | "Structure of frataxin iron cores: an X-ray absorption spectroscopic study." Nichol H., Gakh O., O'Neill H.A., Pickering I.J., Isaya G., George G.N. Biochemistry 42:5971-5976(2003) [PubMed: 12755598] [Abstract] Cited for: POSSIBLE FUNCTION IN IRON STORAGE, SUBUNIT. |
| [17] | "Iron-sulfur cluster biosynthesis. Characterization of frataxin as an iron donor for assembly of [2Fe-2S] clusters in ISU-type proteins." Yoon T., Cowan J.A. J. Am. Chem. Soc. 125:6078-6084(2003) [PubMed: 12785837] [Abstract] Cited for: FUNCTION IN IRON-SULFUR CLUSTER BIOSYNTHESIS, INTERACTION WITH ISCU. |
| [18] | "Frataxin-mediated iron delivery to ferrochelatase in the final step of heme biosynthesis." Yoon T., Cowan J.A. J. Biol. Chem. 279:25943-25946(2004) [PubMed: 15123683] [Abstract] Cited for: POSSIBLE FUNCTION IN HEME BIOSYNTHESIS, INTERACTION WITH FECH. |
| [19] | "Frataxin acts as an iron chaperone protein to modulate mitochondrial aconitase activity." Bulteau A.L., O'Neill H.A., Kennedy M.C., Ikeda-Saito M., Isaya G., Szweda L.I. Science 305:242-245(2004) [PubMed: 15247478] [Abstract] Cited for: FUNCTION. |
| [20] | "Assembly of human frataxin is a mechanism for detoxifying redox-active iron." O'Neill H.A., Gakh O., Park S., Cui J., Mooney S.M., Sampson M., Ferreira G.C., Isaya G. Biochemistry 44:537-545(2005) [PubMed: 15641778] [Abstract] Cited for: FUNCTION IN OXIDATIVE STRESS, SUBUNIT, CATALYTIC ACTIVITY. |
| [21] | "Frataxin interacts functionally with mitochondrial electron transport chain proteins." Gonzalez-Cabo P., Vazquez-Manrique R.P., Garcia-Gimeno M.A., Sanz P., Palau F. Hum. Mol. Genet. 14:2091-2098(2005) [PubMed: 15961414] [Abstract] Cited for: INTERACTION WITH SDHA AND SDHB. |
| [22] | "Frataxin deficiency alters heme pathway transcripts and decreases mitochondrial heme metabolites in mammalian cells." Schoenfeld R.A., Napoli E., Wong A., Zhan S., Reutenauer L., Morin D., Buckpitt A.R., Taroni F., Lonnerdal B., Ristow M., Puccio H., Cortopassi G.A. Hum. Mol. Genet. 14:3787-3799(2005) [PubMed: 16239244] [Abstract] Cited for: FUNCTION, INVOLVEMENT IN HEME BIOSYNTHESIS. |
| [23] | "Extra-mitochondrial localisation of frataxin and its association with IscU1 during enterocyte-like differentiation of the human colon adenocarcinoma cell line Caco-2." Acquaviva F., De Biase I., Nezi L., Ruggiero G., Tatangelo F., Pisano C., Monticelli A., Garbi C., Acquaviva A.M., Cocozza S. J. Cell Sci. 118:3917-3924(2005) [PubMed: 16091420] [Abstract] Cited for: INTERACTION WITH ISCU, SUBCELLULAR LOCATION. |
| [24] | "Supramolecular assemblies of human frataxin are formed via subunit-subunit interactions mediated by a non-conserved amino-terminal region." O'Neill H.A., Gakh O., Isaya G. J. Mol. Biol. 345:433-439(2005) [PubMed: 15581888] [Abstract] Cited for: SUBUNIT, SUBCELLULAR LOCATION. |
| [25] | "A pool of extramitochondrial frataxin that promotes cell survival." Condo I., Ventura N., Malisan F., Tomassini B., Testi R. J. Biol. Chem. 281:16750-16756(2006) [PubMed: 16608849] [Abstract] Cited for: FUNCTION IN CELL SURVIVAL, SUBCELLULAR LOCATION. |
| [26] | "Mitochondrial frataxin interacts with ISD11 of the NFS1/ISCU complex and multiple mitochondrial chaperones." Shan Y., Napoli E., Cortopassi G. Hum. Mol. Genet. 16:929-941(2007) [PubMed: 17331979] [Abstract] Cited for: INTERACTION WITH LYRM4 AND HSPA9, CHARACTERIZATION OF VARIANTS PHE-154 AND ARG-155. |
| [27] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [28] | "Crystal structure of human frataxin." Dhe-Paganon S., Shigeta R., Chi Y.-I., Ristow M., Shoelson S.E. J. Biol. Chem. 275:30753-30756(2000) [PubMed: 10900192] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 88-210. |
| [29] | "Towards a structural understanding of Friedreich's ataxia: the solution structure of frataxin." Musco G., Stier G., Kolmerer B., Adinolfi S., Martin S., Frenkiel T., Gibson T., Pastore A. Structure 8:695-707(2000) [PubMed: 10903947] [Abstract] Cited for: STRUCTURE BY NMR OF 91-210. |
| [30] | "Atypical Friedreich ataxia caused by compound heterozygosity for a novel missense mutation and the GAA triplet-repeat expansion." Bidichandani S.I., Ashizawa T., Patel P.I. Am. J. Hum. Genet. 60:1251-1256(1997) [PubMed: 9150176] [Abstract] Cited for: VARIANTS FRDA VAL-130 AND PHE-154. |
| [31] | "Identification of a missense mutation in a Friedreich's ataxia patient: implications for diagnosis and carrier studies." Bartolo C., Mendell J.R., Prior T.W. Am. J. Med. Genet. 79:396-399(1998) [PubMed: 9779809] [Abstract] Cited for: VARIANT FRDA SER-106. |
| [32] | "The correlation of clinical phenotype in Friedreich ataxia with the site of point mutations in the FRDA gene." Forrest S.M., Knight M., Delatycki M.B., Paris D., Williamson R., King J., Yeung L., Nassif N., Nicholson G.A. Neurogenetics 1:253-257(1998) [PubMed: 10732799] [Abstract] Cited for: VARIANTS FRDA VAL-130; CYS-165 AND PHE-182. |
| [33] | "Friedreich's ataxia: point mutations and clinical presentation of compound heterozygotes." Cossee M., Duerr A., Schmitt M., Dahl N., Trouillas P., Allinson P., Kostrzewa M., Nivelon-Chevallier A., Gustavson K.-H., Kohlschuetter A., Mueller U., Mandel J.-L., Brice A., Koenig M., Cavalcanti F., Tammaro A., de Michele G., Filla A. Pandolfo M.Ann. Neurol. 45:200-206(1999) [PubMed: 9989622] [Abstract] Cited for: VARIANTS FRDA TYR-122 AND VAL-130. |
| [34] | "A missense mutation (W155R) in an American patient with Friedreich's ataxia." Labuda M., Poirier J., Pandolfo M. Hum. Mutat. 13:506-506(1999) Cited for: VARIANT FRDA ARG-155. |
| [35] | "A novel missense mutation (L198R) in the Friedreich's ataxia gene." Al-Mahdawi S., Pook M., Chamberlain S. Hum. Mutat. 16:95-95(2000) [PubMed: 10874325] [Abstract] Cited for: VARIANT FRDA ARG-198. |
| [36] | "The first cellular models based on frataxin missense mutations that reproduce spontaneously the defects associated with Friedreich ataxia." Calmels N., Schmucker S., Wattenhofer-Donze M., Martelli A., Vaucamps N., Reutenauer L., Messaddeq N., Bouton C., Koenig M., Puccio H. PLoS ONE 4:E6379-E6379(2009) [PubMed: 19629184] [Abstract] Cited for: CHARACTERIZATION OF VARIANT FRDA PHE-154. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U43747 mRNA. Translation: AAA98510.1. U43752 U43751 Genomic DNA. Translation: AAA98508.1.U43753 U43751 Genomic DNA. Translation: AAA98509.1.AL162730 Genomic DNA. Translation: CAH71829.1. BC023633 mRNA. Translation: AAH23633.1. BC048097 mRNA. Translation: AAH48097.1. Y13751 Genomic DNA. Translation: CAA74077.1. AF028240 Genomic DNA. Translation: AAB84047.1. U93173 Genomic DNA. Translation: AAD00734.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00217745. IPI00293425. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000135.2. NM_000144.4. NP_001155178.1. NM_001161706.1. NP_852090.1. NM_181425.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.20685. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q16595. Positions 89-209. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q16595. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-2856590. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TCDB | 9.B.21.1.1. frataxin family. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 6166193. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OGP | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000377270; ENSP00000366482; ENSG00000165060. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2395. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2395. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NMPDR | fig|9606.3.peg.31391. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc004aha.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 2395. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC09P071650. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0025740. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3951. FXN. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB022164. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 229300. phenotype. 606829. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 95. Friedreich ataxia. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG11242. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000005811. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HBG125781. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG005745. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | AYSGKGT. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4ZCT5S. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_FXN. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q16595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000165060. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR017789. Frataxin. IPR002908. Frataxin-like. IPR020895. Frataxin_CS. IPR001794. Frataxin_subgr. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.30.920.10. Frataxin_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR16821. PTHR16821. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01491. Frataxin_Cyay. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00904. FRATAXIN. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF55387. Frataxin_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR03421. FeS_CyaY. 1 hit. TIGR03422. Mito_frataxin. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01344. FRATAXIN_1. 1 hit. PS50810. FRATAXIN_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 9641. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | FRDA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16595 Secondary accession number(s): O15545 Q5VZ01 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with