SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q16589

- CCNG2_HUMAN

UniProt

Q16589 - CCNG2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cyclin-G2
Gene
CCNG2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

May play a role in growth regulation and in negative regulation of cell cycle progession.

GO - Biological processi

  1. cell cycle checkpoint Source: ProtInc
  2. mitotic nuclear division Source: UniProtKB-KW
  3. regulation of cell cycle Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Cyclin

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Enzyme and pathway databases

SignaLinkiQ16589.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-G2
Gene namesi
Name:CCNG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:1593. CCNG2.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26158.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 344344Cyclin-G2
PRO_0000080469Add
BLAST

Proteomic databases

PaxDbiQ16589.
PRIDEiQ16589.

PTM databases

PhosphoSiteiQ16589.

Expressioni

Tissue specificityi

High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.

Developmental stagei

Expression levels increase through the cell cycle to peak in the mid/late-S phase and decrease during G2/M phase.

Inductioni

Activated by actinomycin-D induced DNA damage.

Gene expression databases

ArrayExpressiQ16589.
BgeeiQ16589.
CleanExiHS_CCNG2.
GenevestigatoriQ16589.

Organism-specific databases

HPAiHPA034684.

Interactioni

Protein-protein interaction databases

BioGridi107341. 8 interactions.
IntActiQ16589. 1 interaction.
STRINGi9606.ENSP00000315743.

Structurei

3D structure databases

ProteinModelPortaliQ16589.
SMRiQ16589. Positions 21-228.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG5024.
HOGENOMiHOG000059559.
HOVERGENiHBG050839.
InParanoidiQ16589.
KOiK10146.
OMAiLTNFFGF.
OrthoDBiEOG7HB59M.
PhylomeDBiQ16589.
TreeFamiTF101007.

Family and domain databases

Gene3Di1.10.472.10. 1 hit.
InterProiIPR028895. CCNG2.
IPR013763. Cyclin-like.
IPR006671. Cyclin_N.
[Graphical view]
PANTHERiPTHR10177:SF60. PTHR10177:SF60. 1 hit.
PfamiPF00134. Cyclin_N. 1 hit.
[Graphical view]
SMARTiSM00385. CYCLIN. 1 hit.
[Graphical view]
SUPFAMiSSF47954. SSF47954. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q16589-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT    50
LCPGLRNAKV EDLRSLANFF GSCTETFVLA VNILDRFLAL MKVKPKHLSC 100
IGVCSFLLAA RIVEEDCNIP STHDVIRISQ CKCTASDIKR MEKIISEKLH 150
YELEATTALN FLHLYHTIIL CHTSERKEIL SLDKLEAQLK ACNCRLIFSK 200
AKPSVLALCL LNLEVETLKS VELLEILLLV KKHSKINDTE FFYWRELVSK 250
CLAEYSSPEC CKPDLKKLVW IVSRRTAQNL HNSYYSVPEL PTIPEGGCFD 300
ESESEDSCED MSCGEESLSS SPPSDQECTF FFNFKVAQTL CFPS 344
Length:344
Mass (Da):38,866
Last modified:November 1, 1996 - v1
Checksum:iD434E0CE92760301
GO
Isoform 2 (identifier: Q16589-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-344: SEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS → R

Note: No experimental confirmation available.

Show »
Length:304
Mass (Da):34,522
Checksum:iEBEA3EDA34D693FE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti4 – 41L → V.1 Publication
Corresponds to variant rs4150050 [ dbSNP | Ensembl ].
VAR_014333
Natural varianti28 – 281E → G.1 Publication
Corresponds to variant rs4150051 [ dbSNP | Ensembl ].
VAR_014334

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei304 – 34441SEDSC…LCFPS → R in isoform 2.
VSP_053893Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti127 – 1271R → W in CAG46997. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U47414 mRNA. Translation: AAC50689.1.
L49506 mRNA. Translation: AAC41978.1.
AF549495 Genomic DNA. Translation: AAN40704.1.
AK292029 mRNA. Translation: BAF84718.1.
AK293899 mRNA. Translation: BAG57286.1.
CR542181 mRNA. Translation: CAG46978.1.
CR542200 mRNA. Translation: CAG46997.1.
BT019503 mRNA. Translation: AAV38310.1.
AC008638 Genomic DNA. No translation available.
AC092674 Genomic DNA. No translation available.
AC104771 Genomic DNA. No translation available.
AC108144 Genomic DNA. No translation available.
AC112716 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05812.1.
CCDSiCCDS3581.1. [Q16589-1]
RefSeqiNP_004345.1. NM_004354.2. [Q16589-1]
UniGeneiHs.740456.

Genome annotation databases

EnsembliENST00000316355; ENSP00000315743; ENSG00000138764.
ENST00000395640; ENSP00000379002; ENSG00000138764.
ENST00000502280; ENSP00000424665; ENSG00000138764.
ENST00000509972; ENSP00000426476; ENSG00000138764.
GeneIDi901.
KEGGihsa:901.
UCSCiuc003hkn.4. human. [Q16589-1]

Polymorphism databases

DMDMi9087132.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U47414 mRNA. Translation: AAC50689.1 .
L49506 mRNA. Translation: AAC41978.1 .
AF549495 Genomic DNA. Translation: AAN40704.1 .
AK292029 mRNA. Translation: BAF84718.1 .
AK293899 mRNA. Translation: BAG57286.1 .
CR542181 mRNA. Translation: CAG46978.1 .
CR542200 mRNA. Translation: CAG46997.1 .
BT019503 mRNA. Translation: AAV38310.1 .
AC008638 Genomic DNA. No translation available.
AC092674 Genomic DNA. No translation available.
AC104771 Genomic DNA. No translation available.
AC108144 Genomic DNA. No translation available.
AC112716 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05812.1 .
CCDSi CCDS3581.1. [Q16589-1 ]
RefSeqi NP_004345.1. NM_004354.2. [Q16589-1 ]
UniGenei Hs.740456.

3D structure databases

ProteinModelPortali Q16589.
SMRi Q16589. Positions 21-228.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107341. 8 interactions.
IntActi Q16589. 1 interaction.
STRINGi 9606.ENSP00000315743.

PTM databases

PhosphoSitei Q16589.

Polymorphism databases

DMDMi 9087132.

Proteomic databases

PaxDbi Q16589.
PRIDEi Q16589.

Protocols and materials databases

DNASUi 901.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000316355 ; ENSP00000315743 ; ENSG00000138764 .
ENST00000395640 ; ENSP00000379002 ; ENSG00000138764 .
ENST00000502280 ; ENSP00000424665 ; ENSG00000138764 .
ENST00000509972 ; ENSP00000426476 ; ENSG00000138764 .
GeneIDi 901.
KEGGi hsa:901.
UCSCi uc003hkn.4. human. [Q16589-1 ]

Organism-specific databases

CTDi 901.
GeneCardsi GC04P078078.
HGNCi HGNC:1593. CCNG2.
HPAi HPA034684.
MIMi 603203. gene.
neXtProti NX_Q16589.
PharmGKBi PA26158.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5024.
HOGENOMi HOG000059559.
HOVERGENi HBG050839.
InParanoidi Q16589.
KOi K10146.
OMAi LTNFFGF.
OrthoDBi EOG7HB59M.
PhylomeDBi Q16589.
TreeFami TF101007.

Enzyme and pathway databases

SignaLinki Q16589.

Miscellaneous databases

ChiTaRSi CCNG2. human.
GeneWikii CCNG2.
GenomeRNAii 901.
NextBioi 35471386.
PROi Q16589.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q16589.
Bgeei Q16589.
CleanExi HS_CCNG2.
Genevestigatori Q16589.

Family and domain databases

Gene3Di 1.10.472.10. 1 hit.
InterProi IPR028895. CCNG2.
IPR013763. Cyclin-like.
IPR006671. Cyclin_N.
[Graphical view ]
PANTHERi PTHR10177:SF60. PTHR10177:SF60. 1 hit.
Pfami PF00134. Cyclin_N. 1 hit.
[Graphical view ]
SMARTi SM00385. CYCLIN. 1 hit.
[Graphical view ]
SUPFAMi SSF47954. SSF47954. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterisation of human cyclin G1 and G2: DNA damage inducible genes."
    Bates S.A., Rowan S., Vousden K.H.
    Oncogene 13:1103-1109(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fetal brain and Fetal spleen.
  2. "Cyclin G1 and cyclin G2 comprise a new family of cyclins with contrasting tissue-specific and cell cycle-regulated expression."
    Horne M.C., Goolsby G.L., Donaldson K.L., Tran D., Neubauer M.G., Wahl A.F.
    J. Biol. Chem. 271:6050-6061(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: T-cell.
  3. NIEHS SNPs program
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-4 AND GLY-28.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Cerebellum and Spleen.
  5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiCCNG2_HUMAN
AccessioniPrimary (citable) accession number: Q16589
Secondary accession number(s): B4DF25, Q6FGA7, Q6FGC6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi