Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q16589

- CCNG2_HUMAN

UniProt

Q16589 - CCNG2_HUMAN

Protein

Cyclin-G2

Gene

CCNG2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in growth regulation and in negative regulation of cell cycle progession.

    GO - Biological processi

    1. cell cycle checkpoint Source: ProtInc
    2. mitotic nuclear division Source: UniProtKB-KW
    3. regulation of cell cycle Source: Ensembl

    Keywords - Molecular functioni

    Cyclin

    Keywords - Biological processi

    Cell cycle, Cell division, Mitosis

    Enzyme and pathway databases

    SignaLinkiQ16589.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-G2
    Gene namesi
    Name:CCNG2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:1593. CCNG2.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26158.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 344344Cyclin-G2PRO_0000080469Add
    BLAST

    Proteomic databases

    PaxDbiQ16589.
    PRIDEiQ16589.

    PTM databases

    PhosphoSiteiQ16589.

    Expressioni

    Tissue specificityi

    High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.

    Developmental stagei

    Expression levels increase through the cell cycle to peak in the mid/late-S phase and decrease during G2/M phase.

    Inductioni

    Activated by actinomycin-D induced DNA damage.

    Gene expression databases

    ArrayExpressiQ16589.
    BgeeiQ16589.
    CleanExiHS_CCNG2.
    GenevestigatoriQ16589.

    Organism-specific databases

    HPAiHPA034684.

    Interactioni

    Protein-protein interaction databases

    BioGridi107341. 8 interactions.
    IntActiQ16589. 1 interaction.
    STRINGi9606.ENSP00000315743.

    Structurei

    3D structure databases

    ProteinModelPortaliQ16589.
    SMRiQ16589. Positions 21-228.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cyclin family. Cyclin G subfamily.Curated

    Phylogenomic databases

    eggNOGiCOG5024.
    HOGENOMiHOG000059559.
    HOVERGENiHBG050839.
    InParanoidiQ16589.
    KOiK10146.
    OMAiLTNFFGF.
    OrthoDBiEOG7HB59M.
    PhylomeDBiQ16589.
    TreeFamiTF101007.

    Family and domain databases

    Gene3Di1.10.472.10. 1 hit.
    InterProiIPR028895. CCNG2.
    IPR013763. Cyclin-like.
    IPR006671. Cyclin_N.
    [Graphical view]
    PANTHERiPTHR10177:SF60. PTHR10177:SF60. 1 hit.
    PfamiPF00134. Cyclin_N. 1 hit.
    [Graphical view]
    SMARTiSM00385. CYCLIN. 1 hit.
    [Graphical view]
    SUPFAMiSSF47954. SSF47954. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q16589-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT    50
    LCPGLRNAKV EDLRSLANFF GSCTETFVLA VNILDRFLAL MKVKPKHLSC 100
    IGVCSFLLAA RIVEEDCNIP STHDVIRISQ CKCTASDIKR MEKIISEKLH 150
    YELEATTALN FLHLYHTIIL CHTSERKEIL SLDKLEAQLK ACNCRLIFSK 200
    AKPSVLALCL LNLEVETLKS VELLEILLLV KKHSKINDTE FFYWRELVSK 250
    CLAEYSSPEC CKPDLKKLVW IVSRRTAQNL HNSYYSVPEL PTIPEGGCFD 300
    ESESEDSCED MSCGEESLSS SPPSDQECTF FFNFKVAQTL CFPS 344
    Length:344
    Mass (Da):38,866
    Last modified:November 1, 1996 - v1
    Checksum:iD434E0CE92760301
    GO
    Isoform 2 (identifier: Q16589-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         304-344: SEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS → R

    Note: No experimental confirmation available.

    Show »
    Length:304
    Mass (Da):34,522
    Checksum:iEBEA3EDA34D693FE
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti127 – 1271R → W in CAG46997. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti4 – 41L → V.1 Publication
    Corresponds to variant rs4150050 [ dbSNP | Ensembl ].
    VAR_014333
    Natural varianti28 – 281E → G.1 Publication
    Corresponds to variant rs4150051 [ dbSNP | Ensembl ].
    VAR_014334

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei304 – 34441SEDSC…LCFPS → R in isoform 2. 1 PublicationVSP_053893Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U47414 mRNA. Translation: AAC50689.1.
    L49506 mRNA. Translation: AAC41978.1.
    AF549495 Genomic DNA. Translation: AAN40704.1.
    AK292029 mRNA. Translation: BAF84718.1.
    AK293899 mRNA. Translation: BAG57286.1.
    CR542181 mRNA. Translation: CAG46978.1.
    CR542200 mRNA. Translation: CAG46997.1.
    BT019503 mRNA. Translation: AAV38310.1.
    AC008638 Genomic DNA. No translation available.
    AC092674 Genomic DNA. No translation available.
    AC104771 Genomic DNA. No translation available.
    AC108144 Genomic DNA. No translation available.
    AC112716 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX05812.1.
    CCDSiCCDS3581.1. [Q16589-1]
    RefSeqiNP_004345.1. NM_004354.2. [Q16589-1]
    UniGeneiHs.740456.

    Genome annotation databases

    EnsembliENST00000316355; ENSP00000315743; ENSG00000138764. [Q16589-1]
    ENST00000395640; ENSP00000379002; ENSG00000138764. [Q16589-1]
    ENST00000502280; ENSP00000424665; ENSG00000138764. [Q16589-1]
    ENST00000509972; ENSP00000426476; ENSG00000138764. [Q16589-2]
    GeneIDi901.
    KEGGihsa:901.
    UCSCiuc003hkn.4. human. [Q16589-1]

    Polymorphism databases

    DMDMi9087132.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U47414 mRNA. Translation: AAC50689.1 .
    L49506 mRNA. Translation: AAC41978.1 .
    AF549495 Genomic DNA. Translation: AAN40704.1 .
    AK292029 mRNA. Translation: BAF84718.1 .
    AK293899 mRNA. Translation: BAG57286.1 .
    CR542181 mRNA. Translation: CAG46978.1 .
    CR542200 mRNA. Translation: CAG46997.1 .
    BT019503 mRNA. Translation: AAV38310.1 .
    AC008638 Genomic DNA. No translation available.
    AC092674 Genomic DNA. No translation available.
    AC104771 Genomic DNA. No translation available.
    AC108144 Genomic DNA. No translation available.
    AC112716 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX05812.1 .
    CCDSi CCDS3581.1. [Q16589-1 ]
    RefSeqi NP_004345.1. NM_004354.2. [Q16589-1 ]
    UniGenei Hs.740456.

    3D structure databases

    ProteinModelPortali Q16589.
    SMRi Q16589. Positions 21-228.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107341. 8 interactions.
    IntActi Q16589. 1 interaction.
    STRINGi 9606.ENSP00000315743.

    PTM databases

    PhosphoSitei Q16589.

    Polymorphism databases

    DMDMi 9087132.

    Proteomic databases

    PaxDbi Q16589.
    PRIDEi Q16589.

    Protocols and materials databases

    DNASUi 901.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000316355 ; ENSP00000315743 ; ENSG00000138764 . [Q16589-1 ]
    ENST00000395640 ; ENSP00000379002 ; ENSG00000138764 . [Q16589-1 ]
    ENST00000502280 ; ENSP00000424665 ; ENSG00000138764 . [Q16589-1 ]
    ENST00000509972 ; ENSP00000426476 ; ENSG00000138764 . [Q16589-2 ]
    GeneIDi 901.
    KEGGi hsa:901.
    UCSCi uc003hkn.4. human. [Q16589-1 ]

    Organism-specific databases

    CTDi 901.
    GeneCardsi GC04P078078.
    HGNCi HGNC:1593. CCNG2.
    HPAi HPA034684.
    MIMi 603203. gene.
    neXtProti NX_Q16589.
    PharmGKBi PA26158.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5024.
    HOGENOMi HOG000059559.
    HOVERGENi HBG050839.
    InParanoidi Q16589.
    KOi K10146.
    OMAi LTNFFGF.
    OrthoDBi EOG7HB59M.
    PhylomeDBi Q16589.
    TreeFami TF101007.

    Enzyme and pathway databases

    SignaLinki Q16589.

    Miscellaneous databases

    ChiTaRSi CCNG2. human.
    GeneWikii CCNG2.
    GenomeRNAii 901.
    NextBioi 35471386.
    PROi Q16589.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q16589.
    Bgeei Q16589.
    CleanExi HS_CCNG2.
    Genevestigatori Q16589.

    Family and domain databases

    Gene3Di 1.10.472.10. 1 hit.
    InterProi IPR028895. CCNG2.
    IPR013763. Cyclin-like.
    IPR006671. Cyclin_N.
    [Graphical view ]
    PANTHERi PTHR10177:SF60. PTHR10177:SF60. 1 hit.
    Pfami PF00134. Cyclin_N. 1 hit.
    [Graphical view ]
    SMARTi SM00385. CYCLIN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47954. SSF47954. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Characterisation of human cyclin G1 and G2: DNA damage inducible genes."
      Bates S.A., Rowan S., Vousden K.H.
      Oncogene 13:1103-1109(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Fetal brain and Fetal spleen.
    2. "Cyclin G1 and cyclin G2 comprise a new family of cyclins with contrasting tissue-specific and cell cycle-regulated expression."
      Horne M.C., Goolsby G.L., Donaldson K.L., Tran D., Neubauer M.G., Wahl A.F.
      J. Biol. Chem. 271:6050-6061(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: T-cell.
    3. NIEHS SNPs program
      Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-4 AND GLY-28.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Cerebellum and Spleen.
    5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiCCNG2_HUMAN
    AccessioniPrimary (citable) accession number: Q16589
    Secondary accession number(s): B4DF25, Q6FGA7, Q6FGC6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 124 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3