Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q16589 (CCNG2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 120. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclin-G2
Gene names
Name:CCNG2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length344 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May play a role in growth regulation and in negative regulation of cell cycle progession.

Subcellular location

Cytoplasm By similarity.

Tissue specificity

High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.

Developmental stage

Expression levels increase through the cell cycle to peak in the mid/late-S phase and decrease during G2/M phase.

Induction

Activated by actinomycin-D induced DNA damage.

Sequence similarities

Belongs to the cyclin family. Cyclin G subfamily.

Ontologies

Keywords
   Biological processCell cycle
Cell division
Mitosis
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
Polymorphism
   Molecular functionCyclin
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell cycle checkpoint

Traceable author statement Ref.2. Source: ProtInc

mitosis

Inferred from electronic annotation. Source: UniProtKB-KW

regulation of cell cycle

Inferred from electronic annotation. Source: InterPro

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q16589-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q16589-2)

The sequence of this isoform differs from the canonical sequence as follows:
     304-344: SEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS → R
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 344344Cyclin-G2
PRO_0000080469

Natural variations

Alternative sequence304 – 34441SEDSC…LCFPS → R in isoform 2.
VSP_053893
Natural variant41L → V. Ref.3
Corresponds to variant rs4150050 [ dbSNP | Ensembl ].
VAR_014333
Natural variant281E → G. Ref.3
Corresponds to variant rs4150051 [ dbSNP | Ensembl ].
VAR_014334

Experimental info

Sequence conflict1271R → W in CAG46997. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: D434E0CE92760301

FASTA34438,866
        10         20         30         40         50         60 
MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT LCPGLRNAKV 

        70         80         90        100        110        120 
EDLRSLANFF GSCTETFVLA VNILDRFLAL MKVKPKHLSC IGVCSFLLAA RIVEEDCNIP 

       130        140        150        160        170        180 
STHDVIRISQ CKCTASDIKR MEKIISEKLH YELEATTALN FLHLYHTIIL CHTSERKEIL 

       190        200        210        220        230        240 
SLDKLEAQLK ACNCRLIFSK AKPSVLALCL LNLEVETLKS VELLEILLLV KKHSKINDTE 

       250        260        270        280        290        300 
FFYWRELVSK CLAEYSSPEC CKPDLKKLVW IVSRRTAQNL HNSYYSVPEL PTIPEGGCFD 

       310        320        330        340 
ESESEDSCED MSCGEESLSS SPPSDQECTF FFNFKVAQTL CFPS 

« Hide

Isoform 2 [UniParc].

Checksum: EBEA3EDA34D693FE
Show »

FASTA30434,522

References

« Hide 'large scale' references
[1]"Characterisation of human cyclin G1 and G2: DNA damage inducible genes."
Bates S.A., Rowan S., Vousden K.H.
Oncogene 13:1103-1109(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Fetal brain and Fetal spleen.
[2]"Cyclin G1 and cyclin G2 comprise a new family of cyclins with contrasting tissue-specific and cell cycle-regulated expression."
Horne M.C., Goolsby G.L., Donaldson K.L., Tran D., Neubauer M.G., Wahl A.F.
J. Biol. Chem. 271:6050-6061(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: T-cell.
[3]NIEHS SNPs program
Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-4 AND GLY-28.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Cerebellum and Spleen.
[5]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
[6]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U47414 mRNA. Translation: AAC50689.1.
L49506 mRNA. Translation: AAC41978.1.
AF549495 Genomic DNA. Translation: AAN40704.1.
AK292029 mRNA. Translation: BAF84718.1.
AK293899 mRNA. Translation: BAG57286.1.
CR542181 mRNA. Translation: CAG46978.1.
CR542200 mRNA. Translation: CAG46997.1.
BT019503 mRNA. Translation: AAV38310.1.
AC008638 Genomic DNA. No translation available.
AC092674 Genomic DNA. No translation available.
AC104771 Genomic DNA. No translation available.
AC108144 Genomic DNA. No translation available.
AC112716 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05812.1.
RefSeqNP_004345.1. NM_004354.2.
UniGeneHs.740456.

3D structure databases

ProteinModelPortalQ16589.
SMRQ16589. Positions 21-228.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107341. 8 interactions.
IntActQ16589. 1 interaction.
STRING9606.ENSP00000315743.

PTM databases

PhosphoSiteQ16589.

Polymorphism databases

DMDM9087132.

Proteomic databases

PaxDbQ16589.
PRIDEQ16589.

Protocols and materials databases

DNASU901.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000316355; ENSP00000315743; ENSG00000138764.
ENST00000395640; ENSP00000379002; ENSG00000138764.
ENST00000502280; ENSP00000424665; ENSG00000138764.
ENST00000509972; ENSP00000426476; ENSG00000138764.
GeneID901.
KEGGhsa:901.
UCSCuc003hkn.4. human. [Q16589-1]

Organism-specific databases

CTD901.
GeneCardsGC04P078078.
HGNCHGNC:1593. CCNG2.
HPAHPA034684.
MIM603203. gene.
neXtProtNX_Q16589.
PharmGKBPA26158.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5024.
HOGENOMHOG000059559.
HOVERGENHBG050839.
InParanoidQ16589.
KOK10146.
OMACSRLRNA.
OrthoDBEOG7HB59M.
PhylomeDBQ16589.
TreeFamTF101007.

Enzyme and pathway databases

SignaLinkQ16589.

Gene expression databases

ArrayExpressQ16589.
BgeeQ16589.
CleanExHS_CCNG2.
GenevestigatorQ16589.

Family and domain databases

Gene3D1.10.472.10. 1 hit.
InterProIPR028895. CCNG2.
IPR013763. Cyclin-like.
IPR006671. Cyclin_N.
[Graphical view]
PANTHERPTHR10177:SF60. PTHR10177:SF60. 1 hit.
PfamPF00134. Cyclin_N. 1 hit.
[Graphical view]
SMARTSM00385. CYCLIN. 1 hit.
[Graphical view]
SUPFAMSSF47954. SSF47954. 1 hit.
ProtoNetSearch...

Other

ChiTaRSCCNG2. human.
GeneWikiCCNG2.
GenomeRNAi901.
NextBio35471386.
PROQ16589.
SOURCESearch...

Entry information

Entry nameCCNG2_HUMAN
AccessionPrimary (citable) accession number: Q16589
Secondary accession number(s): B4DF25, Q6FGA7, Q6FGC6
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: April 16, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM