Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-G2

Gene

CCNG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May play a role in growth regulation and in negative regulation of cell cycle progession.

GO - Biological processi

  • cell cycle checkpoint Source: ProtInc
  • cell division Source: UniProtKB-KW
  • mitotic nuclear division Source: UniProtKB-KW
  • regulation of cell cycle Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Cyclin

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Enzyme and pathway databases

SignaLinkiQ16589.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-G2
Gene namesi
Name:CCNG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:1593. CCNG2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26158.

Polymorphism and mutation databases

BioMutaiCCNG2.
DMDMi9087132.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 344344Cyclin-G2PRO_0000080469Add
BLAST

Proteomic databases

PaxDbiQ16589.
PRIDEiQ16589.

PTM databases

PhosphoSiteiQ16589.

Expressioni

Tissue specificityi

High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.

Developmental stagei

Expression levels increase through the cell cycle to peak in the mid/late-S phase and decrease during G2/M phase.

Inductioni

Activated by actinomycin-D induced DNA damage.

Gene expression databases

BgeeiQ16589.
CleanExiHS_CCNG2.
ExpressionAtlasiQ16589. baseline and differential.
GenevisibleiQ16589. HS.

Organism-specific databases

HPAiHPA034684.

Interactioni

Protein-protein interaction databases

BioGridi107341. 9 interactions.
IntActiQ16589. 1 interaction.
STRINGi9606.ENSP00000315743.

Structurei

3D structure databases

ProteinModelPortaliQ16589.
SMRiQ16589. Positions 21-228.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cyclin family. Cyclin G subfamily.Curated

Phylogenomic databases

eggNOGiCOG5024.
GeneTreeiENSGT00530000062971.
HOGENOMiHOG000059559.
HOVERGENiHBG050839.
InParanoidiQ16589.
KOiK10146.
OMAiLTNFFGF.
OrthoDBiEOG7HB59M.
PhylomeDBiQ16589.
TreeFamiTF101007.

Family and domain databases

Gene3Di1.10.472.10. 1 hit.
InterProiIPR028895. CCNG2.
IPR013763. Cyclin-like.
IPR006671. Cyclin_N.
[Graphical view]
PANTHERiPTHR10177:SF60. PTHR10177:SF60. 1 hit.
PfamiPF00134. Cyclin_N. 1 hit.
[Graphical view]
SMARTiSM00385. CYCLIN. 1 hit.
[Graphical view]
SUPFAMiSSF47954. SSF47954. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16589-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT
60 70 80 90 100
LCPGLRNAKV EDLRSLANFF GSCTETFVLA VNILDRFLAL MKVKPKHLSC
110 120 130 140 150
IGVCSFLLAA RIVEEDCNIP STHDVIRISQ CKCTASDIKR MEKIISEKLH
160 170 180 190 200
YELEATTALN FLHLYHTIIL CHTSERKEIL SLDKLEAQLK ACNCRLIFSK
210 220 230 240 250
AKPSVLALCL LNLEVETLKS VELLEILLLV KKHSKINDTE FFYWRELVSK
260 270 280 290 300
CLAEYSSPEC CKPDLKKLVW IVSRRTAQNL HNSYYSVPEL PTIPEGGCFD
310 320 330 340
ESESEDSCED MSCGEESLSS SPPSDQECTF FFNFKVAQTL CFPS
Length:344
Mass (Da):38,866
Last modified:November 1, 1996 - v1
Checksum:iD434E0CE92760301
GO
Isoform 2 (identifier: Q16589-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-344: SEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS → R

Note: No experimental confirmation available.
Show »
Length:304
Mass (Da):34,522
Checksum:iEBEA3EDA34D693FE
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti127 – 1271R → W in CAG46997 (Ref. 5) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti4 – 41L → V.1 Publication
Corresponds to variant rs4150050 [ dbSNP | Ensembl ].
VAR_014333
Natural varianti28 – 281E → G.1 Publication
Corresponds to variant rs4150051 [ dbSNP | Ensembl ].
VAR_014334

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei304 – 34441SEDSC…LCFPS → R in isoform 2. 1 PublicationVSP_053893Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U47414 mRNA. Translation: AAC50689.1.
L49506 mRNA. Translation: AAC41978.1.
AF549495 Genomic DNA. Translation: AAN40704.1.
AK292029 mRNA. Translation: BAF84718.1.
AK293899 mRNA. Translation: BAG57286.1.
CR542181 mRNA. Translation: CAG46978.1.
CR542200 mRNA. Translation: CAG46997.1.
BT019503 mRNA. Translation: AAV38310.1.
AC008638 Genomic DNA. No translation available.
AC092674 Genomic DNA. No translation available.
AC104771 Genomic DNA. No translation available.
AC108144 Genomic DNA. No translation available.
AC112716 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05812.1.
CCDSiCCDS3581.1. [Q16589-1]
RefSeqiNP_004345.1. NM_004354.2. [Q16589-1]
UniGeneiHs.740456.

Genome annotation databases

EnsembliENST00000316355; ENSP00000315743; ENSG00000138764. [Q16589-1]
ENST00000395640; ENSP00000379002; ENSG00000138764. [Q16589-1]
ENST00000502280; ENSP00000424665; ENSG00000138764. [Q16589-1]
ENST00000509972; ENSP00000426476; ENSG00000138764. [Q16589-2]
GeneIDi901.
KEGGihsa:901.
UCSCiuc003hkn.4. human. [Q16589-1]
uc011ccc.1. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U47414 mRNA. Translation: AAC50689.1.
L49506 mRNA. Translation: AAC41978.1.
AF549495 Genomic DNA. Translation: AAN40704.1.
AK292029 mRNA. Translation: BAF84718.1.
AK293899 mRNA. Translation: BAG57286.1.
CR542181 mRNA. Translation: CAG46978.1.
CR542200 mRNA. Translation: CAG46997.1.
BT019503 mRNA. Translation: AAV38310.1.
AC008638 Genomic DNA. No translation available.
AC092674 Genomic DNA. No translation available.
AC104771 Genomic DNA. No translation available.
AC108144 Genomic DNA. No translation available.
AC112716 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05812.1.
CCDSiCCDS3581.1. [Q16589-1]
RefSeqiNP_004345.1. NM_004354.2. [Q16589-1]
UniGeneiHs.740456.

3D structure databases

ProteinModelPortaliQ16589.
SMRiQ16589. Positions 21-228.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107341. 9 interactions.
IntActiQ16589. 1 interaction.
STRINGi9606.ENSP00000315743.

PTM databases

PhosphoSiteiQ16589.

Polymorphism and mutation databases

BioMutaiCCNG2.
DMDMi9087132.

Proteomic databases

PaxDbiQ16589.
PRIDEiQ16589.

Protocols and materials databases

DNASUi901.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316355; ENSP00000315743; ENSG00000138764. [Q16589-1]
ENST00000395640; ENSP00000379002; ENSG00000138764. [Q16589-1]
ENST00000502280; ENSP00000424665; ENSG00000138764. [Q16589-1]
ENST00000509972; ENSP00000426476; ENSG00000138764. [Q16589-2]
GeneIDi901.
KEGGihsa:901.
UCSCiuc003hkn.4. human. [Q16589-1]
uc011ccc.1. human.

Organism-specific databases

CTDi901.
GeneCardsiGC04P078078.
HGNCiHGNC:1593. CCNG2.
HPAiHPA034684.
MIMi603203. gene.
neXtProtiNX_Q16589.
PharmGKBiPA26158.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5024.
GeneTreeiENSGT00530000062971.
HOGENOMiHOG000059559.
HOVERGENiHBG050839.
InParanoidiQ16589.
KOiK10146.
OMAiLTNFFGF.
OrthoDBiEOG7HB59M.
PhylomeDBiQ16589.
TreeFamiTF101007.

Enzyme and pathway databases

SignaLinkiQ16589.

Miscellaneous databases

ChiTaRSiCCNG2. human.
GeneWikiiCCNG2.
GenomeRNAii901.
NextBioi35471386.
PROiQ16589.
SOURCEiSearch...

Gene expression databases

BgeeiQ16589.
CleanExiHS_CCNG2.
ExpressionAtlasiQ16589. baseline and differential.
GenevisibleiQ16589. HS.

Family and domain databases

Gene3Di1.10.472.10. 1 hit.
InterProiIPR028895. CCNG2.
IPR013763. Cyclin-like.
IPR006671. Cyclin_N.
[Graphical view]
PANTHERiPTHR10177:SF60. PTHR10177:SF60. 1 hit.
PfamiPF00134. Cyclin_N. 1 hit.
[Graphical view]
SMARTiSM00385. CYCLIN. 1 hit.
[Graphical view]
SUPFAMiSSF47954. SSF47954. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterisation of human cyclin G1 and G2: DNA damage inducible genes."
    Bates S.A., Rowan S., Vousden K.H.
    Oncogene 13:1103-1109(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fetal brain and Fetal spleen.
  2. "Cyclin G1 and cyclin G2 comprise a new family of cyclins with contrasting tissue-specific and cell cycle-regulated expression."
    Horne M.C., Goolsby G.L., Donaldson K.L., Tran D., Neubauer M.G., Wahl A.F.
    J. Biol. Chem. 271:6050-6061(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: T-cell.
  3. NIEHS SNPs program
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-4 AND GLY-28.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Cerebellum and Spleen.
  5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiCCNG2_HUMAN
AccessioniPrimary (citable) accession number: Q16589
Secondary accession number(s): B4DF25, Q6FGA7, Q6FGC6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: June 24, 2015
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.