Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-G2

Gene

CCNG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May play a role in growth regulation and in negative regulation of cell cycle progession.

GO - Biological processi

  • cell cycle Source: UniProtKB-KW
  • cell cycle checkpoint Source: ProtInc
  • cell division Source: UniProtKB-KW

Keywordsi

Molecular functionCyclin
Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

SignaLinkiQ16589.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-G2
Gene namesi
Name:CCNG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000138764.13.
HGNCiHGNC:1593. CCNG2.

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi901.
OpenTargetsiENSG00000138764.
PharmGKBiPA26158.

Polymorphism and mutation databases

BioMutaiCCNG2.
DMDMi9087132.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000804691 – 344Cyclin-G2Add BLAST344

Proteomic databases

PaxDbiQ16589.
PRIDEiQ16589.

PTM databases

iPTMnetiQ16589.
PhosphoSitePlusiQ16589.

Expressioni

Tissue specificityi

High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.

Developmental stagei

Expression levels increase through the cell cycle to peak in the mid/late-S phase and decrease during G2/M phase.

Inductioni

Activated by actinomycin-D induced DNA damage.

Gene expression databases

BgeeiENSG00000138764.
CleanExiHS_CCNG2.
ExpressionAtlasiQ16589. baseline and differential.
GenevisibleiQ16589. HS.

Organism-specific databases

HPAiHPA034684.

Interactioni

Protein-protein interaction databases

BioGridi107341. 12 interactors.
IntActiQ16589. 2 interactors.
STRINGi9606.ENSP00000315743.

Structurei

3D structure databases

ProteinModelPortaliQ16589.
SMRiQ16589.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cyclin family. Cyclin G subfamily.Curated

Phylogenomic databases

eggNOGiKOG0653. Eukaryota.
COG5024. LUCA.
GeneTreeiENSGT00530000062971.
HOGENOMiHOG000059559.
HOVERGENiHBG050839.
InParanoidiQ16589.
KOiK10146.
OMAiDLWSLTS.
PhylomeDBiQ16589.
TreeFamiTF101007.

Family and domain databases

CDDicd00043. CYCLIN. 1 hit.
Gene3Di1.10.472.10. 2 hits.
InterProiView protein in InterPro
IPR028895. CCNG2.
IPR013763. Cyclin-like.
IPR006671. Cyclin_N.
PANTHERiPTHR10177:SF319. PTHR10177:SF319. 1 hit.
PfamiView protein in Pfam
PF00134. Cyclin_N. 1 hit.
SMARTiView protein in SMART
SM00385. CYCLIN. 1 hit.
SUPFAMiSSF47954. SSF47954. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16589-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT
60 70 80 90 100
LCPGLRNAKV EDLRSLANFF GSCTETFVLA VNILDRFLAL MKVKPKHLSC
110 120 130 140 150
IGVCSFLLAA RIVEEDCNIP STHDVIRISQ CKCTASDIKR MEKIISEKLH
160 170 180 190 200
YELEATTALN FLHLYHTIIL CHTSERKEIL SLDKLEAQLK ACNCRLIFSK
210 220 230 240 250
AKPSVLALCL LNLEVETLKS VELLEILLLV KKHSKINDTE FFYWRELVSK
260 270 280 290 300
CLAEYSSPEC CKPDLKKLVW IVSRRTAQNL HNSYYSVPEL PTIPEGGCFD
310 320 330 340
ESESEDSCED MSCGEESLSS SPPSDQECTF FFNFKVAQTL CFPS
Length:344
Mass (Da):38,866
Last modified:November 1, 1996 - v1
Checksum:iD434E0CE92760301
GO
Isoform 2 (identifier: Q16589-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-344: SEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS → R

Note: No experimental confirmation available.
Show »
Length:304
Mass (Da):34,522
Checksum:iEBEA3EDA34D693FE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti127R → W in CAG46997 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0143334L → V1 PublicationCorresponds to variant dbSNP:rs4150050Ensembl.1
Natural variantiVAR_01433428E → G1 PublicationCorresponds to variant dbSNP:rs4150051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053893304 – 344SEDSC…LCFPS → R in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U47414 mRNA. Translation: AAC50689.1.
L49506 mRNA. Translation: AAC41978.1.
AF549495 Genomic DNA. Translation: AAN40704.1.
AK292029 mRNA. Translation: BAF84718.1.
AK293899 mRNA. Translation: BAG57286.1.
CR542181 mRNA. Translation: CAG46978.1.
CR542200 mRNA. Translation: CAG46997.1.
BT019503 mRNA. Translation: AAV38310.1.
AC008638 Genomic DNA. No translation available.
AC092674 Genomic DNA. No translation available.
AC104771 Genomic DNA. No translation available.
AC108144 Genomic DNA. No translation available.
AC112716 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05812.1.
CCDSiCCDS3581.1. [Q16589-1]
RefSeqiNP_004345.1. NM_004354.2. [Q16589-1]
XP_011530700.1. XM_011532398.1. [Q16589-1]
XP_011530701.1. XM_011532399.2. [Q16589-1]
UniGeneiHs.740456.

Genome annotation databases

EnsembliENST00000316355; ENSP00000315743; ENSG00000138764. [Q16589-1]
ENST00000395640; ENSP00000379002; ENSG00000138764. [Q16589-1]
ENST00000502280; ENSP00000424665; ENSG00000138764. [Q16589-1]
ENST00000509972; ENSP00000426476; ENSG00000138764. [Q16589-2]
GeneIDi901.
KEGGihsa:901.
UCSCiuc003hkn.5. human. [Q16589-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCCNG2_HUMAN
AccessioniPrimary (citable) accession number: Q16589
Secondary accession number(s): B4DF25, Q6FGA7, Q6FGC6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: September 27, 2017
This is version 143 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families