Q16548 (B2LA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bcl-2-related protein A1 Alternative name(s): Bcl-2-like protein 5 Short name=Bcl2-L-5 Hemopoietic-specific early response protein Protein BFL-1 Protein GRS | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 175 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection By similarity. |
| Subunit structure | Interacts directly with BAK1, BID, BMF and BBC3 By similarity. Interacts directly with BCL2L11/BIM. Interacts with BAX isoform Sigma. Interacts directly with PMAIP1. Interacts with BOP/C22orf29. Ref.10 Ref.11 |
| Subcellular location | |
| Tissue specificity | Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies. |
| Induction | By phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors. |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW negative regulation of apoptotic processTraceable author statement Ref.2. Source: ProtInc |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16548-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16548-2) The sequence of this isoform differs from the canonical sequence as follows: 141-175: ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC → GKWHNHTPMLVESVAHKKRKMAL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 175 | 175 | Bcl-2-related protein A1 | PRO_0000143094 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Motif | 77 – 97 | 21 | BH1 | ||||||||||||||||||||||
| Motif | 132 – 147 | 16 | BH2 | ||||||||||||||||||||||
| Compositional bias | 24 – 33 | 10 | Ala/Pro-rich | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 141 – 175 | 35 | ENGFV…LKQYC → GKWHNHTPMLVESVAHKKRK MAL in isoform 2. | VSP_043106 | |||||||||||||||||||||
| Natural variant | 19 | 1 | C → Y. Ref.6 Corresponds to variant rs1138357 [ dbSNP | Ensembl ]. | VAR_020342 | |||||||||||||||||||||
| Natural variant | 39 | 1 | N → K. Ref.6 Corresponds to variant rs1138358 [ dbSNP | Ensembl ]. | VAR_020343 | |||||||||||||||||||||
| Natural variant | 82 | 1 | G → D. Ref.6 Corresponds to variant rs3826007 [ dbSNP | Ensembl ]. | VAR_020344 | |||||||||||||||||||||
| Natural variant | 117 | 1 | E → D. Corresponds to variant rs34080999 [ dbSNP | Ensembl ]. | VAR_044059 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Sequence conflict | 72 | 1 | N → T in CAA70566. Ref.3 | ||||||||||||||||||||||
| Sequence conflict | 107 | 1 | Q → H in CAA70566. Ref.3 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Helix | 1 – 20 | 20 | |||||||||||||||||||||||
| Helix | 32 – 51 | 20 | |||||||||||||||||||||||
| Helix | 53 – 56 | 4 | |||||||||||||||||||||||
| Helix | 64 – 79 | 16 | |||||||||||||||||||||||
| Helix | 86 – 106 | 21 | |||||||||||||||||||||||
| Helix | 113 – 115 | 3 | |||||||||||||||||||||||
| Helix | 116 – 136 | 21 | |||||||||||||||||||||||
| Helix | 139 – 142 | 4 | |||||||||||||||||||||||
| Helix | 144 – 148 | 5 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel Bcl-2 related gene, Bfl-1, is overexpressed in stomach cancer and preferentially expressed in bone marrow." Choi S.S., Park I.-C., Yun J.W., Sung Y.C., Hong S.-I., Shin H.-S. Oncogene 11:1693-1698(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "Cloning of human Bcl-2 homologue: inflammatory cytokines induce human A1 in cultured endothelial cells." Karsan A., Yee E., Kaushansky K., Harlan J.M. Blood 87:3089-3096(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Umbilical vein. |
| [3] | "GRS, a novel member of the Bcl-2 gene family, is highly expressed in multiple cancer cell lines and in normal leukocytes." Kenny J.J., Knobloch T.J., Augustus M., Carter K.C., Rosen C.A., Lang J.C. Oncogene 14:997-1001(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: T-cell. |
| [4] | "A widely expressed pro-apoptotic splice variant of the human A1 gene is specifically targeted to the nucleus." Barnes F.A., Rowe S.J., Whyte M.K.B., Bingle C.D. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS TYR-19; LYS-39 AND ASP-82. |
| [7] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [10] | "Characterization of Bax-sigma, a cell death-inducing isoform of Bax." Schmitt E., Paquet C., Beauchemin M., Dever-Bertrand J., Bertrand R. Biochem. Biophys. Res. Commun. 270:868-879(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BAX. |
| [11] | "Human Bop is a novel BH3-only member of the Bcl-2 protein family." Zhang X., Weng C., Li Y., Wang X., Jiang C., Li X., Xu Y., Chen Q., Pan L., Tang H. Protein Cell 3:790-801(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BOP/C22ORF29. |
| [12] | "Completing the family portrait of the anti-apoptotic Bcl-2 proteins: crystal structure of human Bfl-1 in complex with Bim." Herman M.D., Nyman T., Welin M., Lehtio L., Flodin S., Tresaugues L., Kotenyova T., Flores A., Nordlund P. FEBS Lett. 582:3590-3594(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 1-149 IN COMPLEX WITH BCL2L11/BIM. |
| [13] | "Human BCL-2A1 in complex with BIM." Structural genomics consortium (SGC) Submitted (FEB-2008) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 149-608 IN COMPLEX WITH BCL2L11. |
| [14] | "Crystal structure of human bfl-1 in complex with noxa bh3 peptide." Northeast structural genomics consortium (NESG) Submitted (JUL-2010) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.24 ANGSTROMS) OF 1-151 IN COMPLEX WITH PMAIP1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U27467 mRNA. Translation: AAC50288.1. U29680 mRNA. Translation: AAC50438.1. Y09397 mRNA. Translation: CAA70566.1. AY234180 mRNA. Translation: AAO89009.1. BT007103 mRNA. Translation: AAP35767.1. CR541937 mRNA. Translation: CAG46735.1. CR541962 mRNA. Translation: CAG46760.1. AC015871 Genomic DNA. No translation available. CH471136 Genomic DNA. Translation: EAW99129.1. BC016281 mRNA. Translation: AAH16281.1. | ||||||||||||||||||||||||
| IPI | IPI00002881. | ||||||||||||||||||||||||
| PIR | I39055. | ||||||||||||||||||||||||
| RefSeq | NP_001108207.1. NM_001114735.1. NP_004040.1. NM_004049.3. | ||||||||||||||||||||||||
| UniGene | Hs.227817. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q16548. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q16548. 4 interactions. | ||||||||||||||||||||||||
| MINT | MINT-89617. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000267953. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q16548. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 2493280. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q16548. | ||||||||||||||||||||||||
| PRIDE | Q16548. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 597. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000267953; ENSP00000267953; ENSG00000140379. ENST00000335661; ENSP00000335250; ENSG00000140379. | ||||||||||||||||||||||||
| GeneID | 597. | ||||||||||||||||||||||||
| KEGG | hsa:597. | ||||||||||||||||||||||||
| UCSC | uc002bfc.4. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 597. | ||||||||||||||||||||||||
| GeneCards | GC15M080256. | ||||||||||||||||||||||||
| HGNC | HGNC:991. BCL2A1. | ||||||||||||||||||||||||
| MIM | 601056. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q16548. | ||||||||||||||||||||||||
| PharmGKB | PA25303. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG244426. | ||||||||||||||||||||||||
| HOGENOM | HOG000059278. | ||||||||||||||||||||||||
| HOVERGEN | HBG004840. | ||||||||||||||||||||||||
| InParanoid | Q16548. | ||||||||||||||||||||||||
| KO | K02162. | ||||||||||||||||||||||||
| OMA | NGGWENG. | ||||||||||||||||||||||||
| OrthoDB | EOG43R3NS. | ||||||||||||||||||||||||
| PhylomeDB | Q16548. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | bcr_5pathway. BCR signaling pathway. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| Bgee | Q16548. | ||||||||||||||||||||||||
| CleanEx | HS_BCL2A1. | ||||||||||||||||||||||||
| Genevestigator | Q16548. | ||||||||||||||||||||||||
| GermOnline | ENSG00000140379. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR002475. Bcl2-like. IPR020717. Bcl2_BH1_motif_CS. IPR020726. Bcl2_BH2_motif_CS. IPR013282. Bcl2A1. IPR026298. Blc2_fam. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR11256. PTHR11256. 1 hit. PTHR11256:SF10. PTHR11256:SF10. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF00452. Bcl-2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR01862. BCL2FAMILY. PR01867. BCL2RLATEDA1. | ||||||||||||||||||||||||
| PROSITE | PS50062. BCL2_FAMILY. 1 hit. PS01080. BH1. 1 hit. PS01258. BH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | Q16548. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL6044. | ||||||||||||||||||||||||
| ChiTaRS | BCL2A1. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q16548. | ||||||||||||||||||||||||
| GenomeRNAi | 597. | ||||||||||||||||||||||||
| NextBio | 2429. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | B2LA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16548 Secondary accession number(s): Q6FGZ4 Q99524 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
