Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2-related protein A1

Gene

BCL2A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140379-MONOMER.
SIGNORiQ16548.

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-related protein A1
Alternative name(s):
Bcl-2-like protein 5
Short name:
Bcl2-L-5
Hemopoietic-specific early response protein
Protein BFL-1
Protein GRS
Gene namesi
Name:BCL2A1
Synonyms:BCL2L5, BFL1, GRS, HBPA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:991. BCL2A1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi597.
OpenTargetsiENSG00000140379.
PharmGKBiPA25303.

Chemistry databases

ChEMBLiCHEMBL6044.

Polymorphism and mutation databases

BioMutaiBCL2A1.
DMDMi2493280.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001430941 – 175Bcl-2-related protein A1Add BLAST175

Proteomic databases

MaxQBiQ16548.
PaxDbiQ16548.
PeptideAtlasiQ16548.
PRIDEiQ16548.

PTM databases

iPTMnetiQ16548.
PhosphoSitePlusiQ16548.

Expressioni

Tissue specificityi

Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies.

Inductioni

By phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors.

Gene expression databases

BgeeiENSG00000140379.
CleanExiHS_BCL2A1.
GenevisibleiQ16548. HS.

Interactioni

Subunit structurei

Interacts directly with BAK1, BID, BMF and BBC3 (By similarity). Interacts directly with BCL2L11/BIM. Interacts with BAX isoform Sigma. Interacts directly with PMAIP1. Interacts with BOP/C22orf29. Interacts with ING4 (By similarity).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BAK1Q166115EBI-1003550,EBI-519866
BIKQ133235EBI-1003550,EBI-700794
FAM9BQ8IZU03EBI-1003550,EBI-10175124

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107069. 16 interactors.
IntActiQ16548. 10 interactors.
MINTiMINT-89617.
STRINGi9606.ENSP00000267953.

Chemistry databases

BindingDBiQ16548.

Structurei

Secondary structure

1175
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi6 – 20Combined sources15
Turni26 – 28Combined sources3
Helixi32 – 51Combined sources20
Helixi53 – 57Combined sources5
Helixi64 – 79Combined sources16
Helixi86 – 106Combined sources21
Helixi114 – 136Combined sources23
Helixi139 – 142Combined sources4
Helixi144 – 148Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2VM6X-ray2.20A1-149[»]
3I1HX-ray2.20A1-151[»]
3MQPX-ray2.24A1-151[»]
4ZEQX-ray1.80A1-151[»]
ProteinModelPortaliQ16548.
SMRiQ16548.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ16548.

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi77 – 97BH1Add BLAST21
Motifi132 – 147BH2Add BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi24 – 33Ala/Pro-rich10

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

eggNOGiKOG4728. Eukaryota.
ENOG41123S0. LUCA.
GeneTreeiENSGT00510000048456.
HOGENOMiHOG000059278.
HOVERGENiHBG004840.
InParanoidiQ16548.
KOiK02162.
OMAiENTAEWI.
OrthoDBiEOG091G0N5N.
PhylomeDBiQ16548.
TreeFamiTF315834.

Family and domain databases

InterProiIPR002475. Bcl2-like.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR013282. Bcl2A1.
IPR026298. Blc2_fam.
[Graphical view]
PANTHERiPTHR11256. PTHR11256. 1 hit.
PTHR11256:SF10. PTHR11256:SF10. 1 hit.
PfamiPF00452. Bcl-2. 1 hit.
[Graphical view]
PRINTSiPR01862. BCL2FAMILY.
PR01867. BCL2RLATEDA1.
PROSITEiPS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16548-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTDCEFGYIY RLAQDYLQCV LQIPQPGSGP SKTSRVLQNV AFSVQKEVEK
60 70 80 90 100
NLKSCLDNVN VVSVDTARTL FNQVMEKEFE DGIINWGRIV TIFAFEGILI
110 120 130 140 150
KKLLRQQIAP DVDTYKEISY FVAEFIMNNT GEWIRQNGGW ENGFVKKFEP
160 170
KSGWMTFLEV TGKICEMLSL LKQYC
Length:175
Mass (Da):20,132
Last modified:November 1, 1996 - v1
Checksum:i329D98AF2BE07A0D
GO
Isoform 2 (identifier: Q16548-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-175: ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC → GKWHNHTPMLVESVAHKKRKMAL

Show »
Length:163
Mass (Da):18,746
Checksum:i200ED46EECAAF317
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti72N → T in CAA70566 (PubMed:9050999).Curated1
Sequence conflicti107Q → H in CAA70566 (PubMed:9050999).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02034219C → Y.1 PublicationCorresponds to variant rs1138357dbSNPEnsembl.1
Natural variantiVAR_02034339N → K.1 PublicationCorresponds to variant rs1138358dbSNPEnsembl.1
Natural variantiVAR_02034482G → D.1 PublicationCorresponds to variant rs3826007dbSNPEnsembl.1
Natural variantiVAR_044059117E → D.Corresponds to variant rs34080999dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043106141 – 175ENGFV…LKQYC → GKWHNHTPMLVESVAHKKRK MAL in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27467 mRNA. Translation: AAC50288.1.
U29680 mRNA. Translation: AAC50438.1.
Y09397 mRNA. Translation: CAA70566.1.
AY234180 mRNA. Translation: AAO89009.1.
BT007103 mRNA. Translation: AAP35767.1.
CR541937 mRNA. Translation: CAG46735.1.
CR541962 mRNA. Translation: CAG46760.1.
AC015871 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99129.1.
BC016281 mRNA. Translation: AAH16281.1.
CCDSiCCDS10312.1. [Q16548-1]
CCDS45322.1. [Q16548-2]
PIRiI39055.
RefSeqiNP_001108207.1. NM_001114735.1. [Q16548-2]
NP_004040.1. NM_004049.3. [Q16548-1]
UniGeneiHs.227817.

Genome annotation databases

EnsembliENST00000267953; ENSP00000267953; ENSG00000140379. [Q16548-1]
ENST00000335661; ENSP00000335250; ENSG00000140379. [Q16548-2]
GeneIDi597.
KEGGihsa:597.
UCSCiuc002bfc.5. human. [Q16548-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27467 mRNA. Translation: AAC50288.1.
U29680 mRNA. Translation: AAC50438.1.
Y09397 mRNA. Translation: CAA70566.1.
AY234180 mRNA. Translation: AAO89009.1.
BT007103 mRNA. Translation: AAP35767.1.
CR541937 mRNA. Translation: CAG46735.1.
CR541962 mRNA. Translation: CAG46760.1.
AC015871 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99129.1.
BC016281 mRNA. Translation: AAH16281.1.
CCDSiCCDS10312.1. [Q16548-1]
CCDS45322.1. [Q16548-2]
PIRiI39055.
RefSeqiNP_001108207.1. NM_001114735.1. [Q16548-2]
NP_004040.1. NM_004049.3. [Q16548-1]
UniGeneiHs.227817.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2VM6X-ray2.20A1-149[»]
3I1HX-ray2.20A1-151[»]
3MQPX-ray2.24A1-151[»]
4ZEQX-ray1.80A1-151[»]
ProteinModelPortaliQ16548.
SMRiQ16548.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107069. 16 interactors.
IntActiQ16548. 10 interactors.
MINTiMINT-89617.
STRINGi9606.ENSP00000267953.

Chemistry databases

BindingDBiQ16548.
ChEMBLiCHEMBL6044.

PTM databases

iPTMnetiQ16548.
PhosphoSitePlusiQ16548.

Polymorphism and mutation databases

BioMutaiBCL2A1.
DMDMi2493280.

Proteomic databases

MaxQBiQ16548.
PaxDbiQ16548.
PeptideAtlasiQ16548.
PRIDEiQ16548.

Protocols and materials databases

DNASUi597.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267953; ENSP00000267953; ENSG00000140379. [Q16548-1]
ENST00000335661; ENSP00000335250; ENSG00000140379. [Q16548-2]
GeneIDi597.
KEGGihsa:597.
UCSCiuc002bfc.5. human. [Q16548-1]

Organism-specific databases

CTDi597.
DisGeNETi597.
GeneCardsiBCL2A1.
HGNCiHGNC:991. BCL2A1.
MIMi601056. gene.
neXtProtiNX_Q16548.
OpenTargetsiENSG00000140379.
PharmGKBiPA25303.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4728. Eukaryota.
ENOG41123S0. LUCA.
GeneTreeiENSGT00510000048456.
HOGENOMiHOG000059278.
HOVERGENiHBG004840.
InParanoidiQ16548.
KOiK02162.
OMAiENTAEWI.
OrthoDBiEOG091G0N5N.
PhylomeDBiQ16548.
TreeFamiTF315834.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140379-MONOMER.
SIGNORiQ16548.

Miscellaneous databases

ChiTaRSiBCL2A1. human.
EvolutionaryTraceiQ16548.
GeneWikiiBCL2-related_protein_A1.
GenomeRNAii597.
PROiQ16548.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000140379.
CleanExiHS_BCL2A1.
GenevisibleiQ16548. HS.

Family and domain databases

InterProiIPR002475. Bcl2-like.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR013282. Bcl2A1.
IPR026298. Blc2_fam.
[Graphical view]
PANTHERiPTHR11256. PTHR11256. 1 hit.
PTHR11256:SF10. PTHR11256:SF10. 1 hit.
PfamiPF00452. Bcl-2. 1 hit.
[Graphical view]
PRINTSiPR01862. BCL2FAMILY.
PR01867. BCL2RLATEDA1.
PROSITEiPS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiB2LA1_HUMAN
AccessioniPrimary (citable) accession number: Q16548
Secondary accession number(s): Q6FGZ4
, Q6FH19, Q86W13, Q99524
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 160 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.