Q16385 (SSX2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein SSX2 Alternative name(s): Cancer/testis antigen 5.2 Short name=CT5.2 Synovial sarcoma, X breakpoint 2 Tumor antigen HOM-MEL-40 | |||||||
| Gene names |
| |||||||
| Organism | Homo sapiens (Human) | |||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 188 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Could act as a modulator of transcription. |
| Subunit structure | Interacts via its N-terminal region with RAB3IP and SSX2IP. Ref.7 |
| Subcellular location | |
| Tissue specificity | Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and epithelial cell lines. |
| Involvement in disease | Note=A chromosomal aberration involving SSX2 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency). |
| Sequence similarities | Belongs to the SSX family. Contains 1 KRAB-related domain. |
| Sequence caution | The sequence AAB35674.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement |
| Disease | Proto-oncogene |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Non-traceable author statement Ref.1. Source: UniProtKB transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from direct assay. Source: LIFEdb |
| Molecular function | nucleic acid binding Inferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction Ref.7. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| RAB3IP | Q96QF0-2 | 4 | EBI-2210673,EBI-747865 | |
| SSX2IP | Q9Y2D8 | 5 | EBI-2210673,EBI-2212028 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q16385-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q16385-2) The sequence of this isoform differs from the canonical sequence as follows: 157-188: PKRGEHAWTHRLRERKQLVIYEEISDPEEDDE → NREAQEKEER...PTDCVRENSW | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 188 | 188 | Protein SSX2 | PRO_0000181829 | |||||
Regions | |||||||||
| Domain | 20 – 83 | 64 | KRAB-related | ||||||
| Region | 1 – 80 | 80 | Interaction with SSX2IP | ||||||
| Region | 25 – 80 | 56 | Interaction with RAB3IP | ||||||
Sites | |||||||||
| Site | 68 – 69 | 2 | Breakpoint for translocation to form the SSXT-SSX2 fusion protein (rare) | ||||||
| Site | 110 – 111 | 2 | Breakpoint for translocation to form the SSXT-SSX2 fusion protein | ||||||
Natural variations | |||||||||
| Alternative sequence | 157 – 188 | 32 | PKRGE…EEDDE → NREAQEKEERRGTAHRWSSQ NTHNIGRFSLSTSMGAVHGT PKTITHNRDPKGGNMPGPTD CVRENSW in isoform 2. | VSP_017595 | |||||
Experimental info | |||||||||
| Sequence conflict | 169 | 1 | R → P in AAH07343. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Fusion of SYT to two genes, SSX1 and SSX2, encoding proteins with homology to the Kruppel-associated box in human synovial sarcoma." Crew A.J., Clark J., Fisher C., Gill S., Grimer R., Chand A., Shipley J., Gusterson B.A., Cooper C.S. EMBO J. 14:2333-2340(1995) [PubMed: 7539744] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed: 15772651] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta and Skin. |
| [4] | "Identification of two alternative fusion genes, SYT-SSX1 and SYT-SSX2, in t(X;18)(p11.2;q11.2)-positive synovial sarcomas." de Leeuw B., Balemans M., Olde Weghuis D., Geurts van Kessel A. Hum. Mol. Genet. 4:1097-1099(1995) [PubMed: 7655467] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 111-188 (ISOFORM 1). Tissue: Synovial sarcoma. |
| [5] | "Identification of novel genes, SYT and SSX, involved in the t(X;18)(p11.2;q11.2) translocation found in human synovial sarcoma." Clark J., Rocques P.J., Crew A.J., Gill S., Shipley J., Chan A.M.-L., Gusterson B.A., Cooper C.S. Nat. Genet. 7:502-508(1994) [PubMed: 7951320] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 111-188 (SSXT-SSX2 FUSION PROTEIN). Tissue: Synovial sarcoma. |
| [6] | "Molecular diagnosis of synovial sarcoma and characterization of a variant SYT-SSX2 fusion transcript." Fligman I., Lonardo F., Jhanwar S.C., Gerald W.L., Woodruff J., Ladanyi M. Am. J. Pathol. 147:1592-1599(1995) [PubMed: 7495284] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 68-116 (SSXT-SSX2 FUSION PROTEIN). |
| [7] | "The cancer-related protein SSX2 interacts with the human homologue of a Ras-like GTPase interactor, RAB3IP, and a novel nuclear protein, SSX2IP." de Bruijn D.R.H., dos Santos N.R., Kater-Baats E., Thijssen J., van den Berk L., Stap J., Balemans M., Schepens M., Merkx G., van Kessel A.G. Genes Chromosomes Cancer 34:285-298(2002) [PubMed: 12007189] [Abstract] Cited for: INTERACTION WITH RAB3IP AND SSX2IP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X86175 mRNA. Translation: CAA60111.1. AL450023 Genomic DNA. Translation: CAI41151.1. AL450023 Genomic DNA. Translation: CAI41152.1. AL445236, AL450023 Genomic DNA. Translation: CAI41623.1. AL445236, AL450023 Genomic DNA. Translation: CAI41624.1. AL450023, AL445236 Genomic DNA. Translation: CAI41157.1. AL450023, AL445236 Genomic DNA. Translation: CAI41158.1. BC002818 mRNA. Translation: AAH02818.1. BC007343 mRNA. Translation: AAH07343.1. BC016957 mRNA. Translation: AAH16957.1. BC069313 mRNA. Translation: AAH69313.1. BC071827 mRNA. Translation: AAH71827.1. BC103863 mRNA. Translation: AAI03864.1. S79332 mRNA. Translation: AAB35379.1. X79200 mRNA. No translation available. S79894 mRNA. Translation: AAB35674.1. Different initiation. |
| IPI | IPI00001520. IPI00305877. |
| PIR | S55058. |
| RefSeq | NP_001157889.1. NM_001164417.1. NP_003138.3. NM_003147.4. NP_783629.1. NM_175698.1. |
| UniGene | Hs.289105. Hs.661107. |
3D structure databases | |
| ProteinModelPortal | Q16385. |
| SMR | Q16385. Positions 20-70. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q16385. 3 interactions. |
| STRING | Q16385. |
Proteomic databases | |
| PRIDE | Q16385. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000337502; ENSP00000338561; ENSG00000241476. ENST00000375515; ENSP00000364665; ENSG00000157950. ENST00000412682; ENSP00000406899; ENSG00000157950. ENST00000447152; ENSP00000397051; ENSG00000157950. |
| GeneID | 6757. 727837. |
| KEGG | hsa:6757. hsa:727837. |
| UCSC | uc004dqz.1. human. |
Organism-specific databases | |
| CTD | 6757. 727837. |
| GeneCards | GC0XM052725. GC0XP052797. |
| HGNC | HGNC:11336. SSX2. HGNC:22263. SSX2B. |
| MIM | 300192. gene. |
| neXtProt | NX_Q16385. |
| Orphanet | 3273. Synovialosarcoma. |
| PharmGKB | PA162404839. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000012484. |
| HOVERGEN | HBG002056. |
| OMA | NTHNIGR. |
| OrthoDB | EOG4G4GRJ. |
Gene expression databases | |
| ArrayExpress | Q16385. |
| Bgee | Q16385. |
| CleanEx | HS_SSX2. |
| Genevestigator | Q16385. |
| GermOnline | ENSG00000187754. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001909. Krueppel-associated_box. IPR003655. Krueppel-associated_box-rel. IPR019041. SSXRD_motif. [Graphical view] |
| KO | K15625. |
| Pfam | PF01352. KRAB. 1 hit. PF09514. SSXRD. 1 hit. [Graphical view] |
| SMART | SM00349. KRAB. 1 hit. [Graphical view] |
| SUPFAM | SSF109640. Krueppel-associated_box. 1 hit. |
| PROSITE | PS50806. KRAB_RELATED. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 26362. |
| SOURCE | Search... |
Entry information
| Entry name | SSX2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q16385 Secondary accession number(s): Q16404 Q9BU88 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with