Q15910 (EZH2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone-lysine N-methyltransferase EZH2 EC=2.1.1.43 Alternative name(s): ENX-1 Enhancer of zeste homolog 2 Lysine N-methyltransferase 6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 746 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Compared to EZH2-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1, CDKN2A and retinoic acid target genes. Ref.15 Ref.16 Ref.17 Ref.19 Ref.22 Ref.26 Ref.28 Ref.31 Ref.33 Ref.34 Ref.39 Ref.41 Ref.45 |
| Catalytic activity | S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone]. |
| Subunit structure | Binds ATRX via the SET domain Probable. Component of the PRC2/EED-EZH2 complex, which includes EED, EZH2, SUZ12, RBBP4 and RBBP7 and possibly AEBP2. The minimum components required for methyltransferase activity of the PRC2/EED-EZH2 complex are EED, EZH2 and SUZ12. The PRC2 complex may also interact with DNMT1, DNMT3A, DNMT3B and PHF1 via the EZH2 subunit and with SIRT1 via the SUZ12 subunit. Interacts with HDAC1 and HDAC2. Interacts with PRAME. Ref.8 Ref.9 Ref.10 Ref.11 Ref.16 Ref.22 Ref.24 Ref.28 Ref.41 |
| Subcellular location | |
| Tissue specificity | Expressed in many tissues. Overexpressed in numerous tumor types including carcinomas of the breast, colon, larynx, lymphoma and testis. Ref.15 |
| Developmental stage | Expression decreases during senescence of embryonic fibroblasts (HEFs). Expression peaks at the G1/S phase boundary. Ref.15 Ref.20 Ref.34 |
| Induction | Expression is induced by E2F1, E2F2 and E2F3. Expression is reduced in cells subject to numerous types of stress including UV-, IR- and bleomycin-induced DNA damage and by activation of p53/TP53. Ref.15 Ref.20 Ref.34 |
| Post-translational modification | Phosphorylated by AKT1. Phosphorylation by AKT1 reduces methyltransferase activity. Phosphorylation at Thr-345 by CDK1 and CDK2 promotes maintenance of H3K27me3 levels at EZH2-target loci, thus leading to epigenetic gene silencing. Ref.21 Ref.24 Ref.25 Ref.30 Ref.32 Ref.36 Ref.37 Ref.38 Ref.42 Ref.43 Ref.44 Ref.45 |
| Sequence similarities | Belongs to the histone-lysine methyltransferase family. EZ subfamily. Contains 1 SET domain. |
| Caution | Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined. The PRC2 and PRC4 complexes may also methylate 'Lys-26' of histone H1 in addition to 'Lys-27' of histone H3 (Ref.18 and Ref.23), although other studies have demonstrated no methylation of 'Lys-26' of histone H1 by PRC2 (Ref.27). |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DNMT1 | P26358 | 4 | EBI-530054,EBI-719459 | |
| DNMT3A | Q9Y6K1 | 4 | EBI-530054,EBI-923653 | |
| DNMT3B | Q9UBC3 | 4 | EBI-530054,EBI-80125 | |
| PML-RAR | Q15156 | 8 | EBI-530054,EBI-867256 | |
| RARA | P10276 | 2 | EBI-530054,EBI-413374 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15910-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15910-2) The sequence of this isoform differs from the canonical sequence as follows: 297-298: HP → HRKCNYS | ||||||
| Isoform 3 (identifier: Q15910-3) The sequence of this isoform differs from the canonical sequence as follows: 83-121: Missing. | ||||||
| Isoform 4 (identifier: Q15910-4) The sequence of this isoform differs from the canonical sequence as follows: 74-82: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q15910-5) The sequence of this isoform differs from the canonical sequence as follows: 74-82: Missing. 511-553: DGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSEC → G | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 746 | 746 | Histone-lysine N-methyltransferase EZH2 | PRO_0000213992 | |||||
Regions | |||||||||
| Domain | 611 – 731 | 121 | SET | ||||||
| Region | 1 – 340 | 340 | Interaction with DNMT1, DNMT3A and DNMT3B | ||||||
| Region | 39 – 68 | 30 | Interaction with EED By similarity | ||||||
| Compositional bias | 523 – 605 | 83 | Cys-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 21 | 1 | Phosphoserine; by PKB/AKT1 | ||||||
| Modified residue | 339 | 1 | Phosphothreonine Ref.42 | ||||||
| Modified residue | 345 | 1 | Phosphothreonine; by CDK1 and CDK2 Ref.45 | ||||||
| Modified residue | 363 | 1 | Phosphoserine Ref.44 | ||||||
| Modified residue | 366 | 1 | Phosphoserine Ref.42 | ||||||
| Modified residue | 367 | 1 | Phosphothreonine Ref.42 | ||||||
| Modified residue | 380 | 1 | Phosphoserine Ref.36 | ||||||
| Modified residue | 487 | 1 | Phosphothreonine Ref.21 Ref.25 Ref.30 Ref.32 Ref.37 Ref.38 Ref.42 Ref.43 Ref.44 | ||||||
Natural variations | |||||||||
| Alternative sequence | 74 – 82 | 9 | Missing in isoform 4 and isoform 5. | VSP_038813 | |||||
| Alternative sequence | 83 – 121 | 39 | Missing in isoform 3. | VSP_038814 | |||||
| Alternative sequence | 297 – 298 | 2 | HP → HRKCNYS in isoform 2. | VSP_038815 | |||||
| Alternative sequence | 511 – 553 | 43 | DGSSN…CSSEC → G in isoform 5. | VSP_038816 | |||||
| Natural variant | 185 | 1 | D → H. Corresponds to variant rs2302427 [ dbSNP | Ensembl ]. | VAR_055795 | |||||
Experimental info | |||||||||
| Mutagenesis | 21 | 1 | S → A: Enhances methyltransferase activity towards 'Lys-27' of histone H3 and abrogates phosphorylation by PKB/AKT1. Ref.24 | ||||||
| Mutagenesis | 21 | 1 | S → D: Reduces methyltransferase activity towards 'Lys-27' of histone H3 and abrogates phosphorylation by PKB/AKT1. Ref.24 | ||||||
| Mutagenesis | 345 | 1 | T → A: Impaired CDK1- and CDK-2 mediated phosphorylation and subsequent gene silencing. Altered EZH2-mediated cell proliferation and migration. Ref.45 | ||||||
| Mutagenesis | 588 | 1 | C → Y: Strongly impairs methyltransferase activity towards 'Lys-27' of histone H3. Ref.12 | ||||||
| Mutagenesis | 689 | 1 | H → A: Abrogates methyltransferase activity. Ref.12 Ref.41 | ||||||
| Sequence conflict | 39 | 1 | K → N in BAG52592. Ref.3 | ||||||
| Sequence conflict | 224 | 1 | F → L in CAA64955. Ref.1 | ||||||
| Sequence conflict | 724 | 1 | F → V in CAA64955. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of a human homolog of the Drosophila enhancer of zeste gene (EZH2) that maps to chromosome 21q22.2." Chen H., Rossier C., Antonarakis S.E. Genomics 38:30-37(1996) [PubMed: 8954776] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Mammalian homologues of the Polycomb-group gene Enhancer of zeste mediate gene silencing in Drosophila heterochromatin and at S. cerevisiae telomeres." Laible G., Wolf A., Dorn R., Reuter G., Nislow C., Lebersorger A., Popkin D., Pillus L., Jenuwein T. EMBO J. 16:3219-3232(1997) [PubMed: 9214638] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5). Tissue: Brain and Testis. |
| [4] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Pancreas. |
| [7] | "Interaction of Vav with ENX-1, a putative transcriptional regulator of homeobox gene expression." Hobert O., Jallal B., Ullrich A. Mol. Cell. Biol. 16:3066-3073(1996) [PubMed: 8649418] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 134-746. |
| [8] | "Specific interaction between the XNP/ATR-X gene product and the SET domain of the human EZH2 protein." Cardoso C., Timsit S., Villard L., Khrestchatisky M., Fontes M., Colleaux L. Hum. Mol. Genet. 7:679-684(1998) [PubMed: 9499421] [Abstract] Cited for: INTERACTION WITH ATRX. |
| [9] | "Characterization of interactions between the mammalian polycomb-group proteins Enx1/EZH2 and EED suggests the existence of different mammalian polycomb-group protein complexes." Sewalt R.G.A.B., van der Vlag J., Gunster M.J., Hamer K.M., den Blaauwen J.L., Satijn D.P.E., Hendrix T., van Driel R., Otte A.P. Mol. Cell. Biol. 18:3586-3595(1998) [PubMed: 9584199] [Abstract] Cited for: INTERACTION WITH EED, SUBCELLULAR LOCATION. |
| [10] | "Transcriptional repression mediated by the human polycomb-group protein EED involves histone deacetylation." van der Vlag J., Otte A.P. Nat. Genet. 23:474-478(1999) [PubMed: 10581039] [Abstract] Cited for: INTERACTION WITH EED; HDAC1 AND HDAC2. |
| [11] | "The polycomb group protein EED interacts with YY1, and both proteins induce neural tissue in Xenopus embryos." Satijn D.P.E., Hamer K.M., den Blaauwen J., Otte A.P. Mol. Cell. Biol. 21:1360-1369(2001) [PubMed: 11158321] [Abstract] Cited for: INTERACTION WITH EED. |
| [12] | "Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein." Kuzmichev A., Nishioka K., Erdjument-Bromage H., Tempst P., Reinberg D. Genes Dev. 16:2893-2905(2002) [PubMed: 12435631] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE PRC2 COMPLEX WITH EED; RBBP4; RBBP7 AND SUZ12, METHYLTRANSFERASE ACTIVITY OF THE PRC2 COMPLEX, MUTAGENESIS OF CYS-588 AND HIS-689. |
| [13] | "Selective interactions between vertebrate polycomb homologs and the SUV39H1 histone lysine methyltransferase suggest that histone H3-K9 methylation contributes to chromosomal targeting of Polycomb group proteins." Sewalt R.G.A.B., Lachner M., Vargas M., Hamer K.M., den Blaauwen J.L., Hendrix T., Melcher M., Schweizer D., Jenuwein T., Otte A.P. Mol. Cell. Biol. 22:5539-5553(2002) [PubMed: 12101246] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [14] | "Role of histone H3 lysine 27 methylation in Polycomb-group silencing." Cao R., Wang L., Wang H., Xia L., Erdjument-Bromage H., Tempst P., Jones R.S., Zhang Y. Science 298:1039-1043(2002) [PubMed: 12351676] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE PRC2 COMPLEX WITH EED; RBBP4; RBBP7 AND SUZ12, METHYLTRANSFERASE ACTIVITY OF THE PRC2 COMPLEX. |
| [15] | "EZH2 is downstream of the pRB-E2F pathway, essential for proliferation and amplified in cancer." Bracken A.P., Pasini D., Capra M., Prosperini E., Colli E., Helin K. EMBO J. 22:5323-5335(2003) [PubMed: 14532106] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, INDUCTION, TISSUE SPECIFICITY. |
| [16] | "Suz12 is essential for mouse development and for EZH2 histone methyltransferase activity." Pasini D., Bracken A.P., Jensen M.R., Lazzerini Denchi E., Helin K. EMBO J. 23:4061-4071(2004) [PubMed: 15385962] [Abstract] Cited for: FUNCTION, INTERACTION WITH EED AND SUZ12, METHYLTRANSFERASE ACTIVITY OF THE PRC2 COMPLEX. |
| [17] | "Silencing of human polycomb target genes is associated with methylation of histone H3 Lys 27." Kirmizis A., Bartley S.M., Kuzmichev A., Margueron R., Reinberg D., Green R., Farnham P.J. Genes Dev. 18:1592-1605(2004) [PubMed: 15231737] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [18] | "Different EZH2-containing complexes target methylation of histone H1 or nucleosomal histone H3." Kuzmichev A., Jenuwein T., Tempst P., Reinberg D. Mol. Cell 14:183-193(2004) [PubMed: 15099518] [Abstract] Cited for: CHARACTERIZATION OF THE PRC2 AND PRC3 COMPLEXES INCLUDING EED; EZH2; RBBP4; RBBP7 AND SUZ12, METHYLTRANSFERASE ACTIVITY OF THE PRC2 AND PRC3 COMPLEXES. |
| [19] | "SUZ12 is required for both the histone methyltransferase activity and the silencing function of the EED-EZH2 complex." Cao R., Zhang Y. Mol. Cell 15:57-67(2004) [PubMed: 15225548] [Abstract] Cited for: FUNCTION, CHARACTERIZATION OF THE PRC2 COMPLEX INCLUDING AEBP2; EED; EZH2; RBBP4 AND SUZ12, METHYLTRANSFERASE ACTIVITY OF THE PRC2 COMPLEX. |
| [20] | "Activated p53 suppresses the histone methyltransferase EZH2 gene." Tang X., Milyavsky M., Shats I., Erez N., Goldfinger N., Rotter V. Oncogene 23:5759-5769(2004) [PubMed: 15208672] [Abstract] Cited for: DEVELOPMENTAL STAGE, INDUCTION. |
| [21] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-487, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "The human tumor antigen PRAME is a dominant repressor of retinoic acid receptor signaling." Epping M.T., Wang L., Edel M.J., Carlee L., Hernandez M., Bernards R. Cell 122:835-847(2005) [PubMed: 16179254] [Abstract] Cited for: FUNCTION IN RETINOIC ACID SIGNALING, INTERACTION WITH PRAME. |
| [23] | "Composition and histone substrates of polycomb repressive group complexes change during cellular differentiation." Kuzmichev A., Margueron R., Vaquero A., Preissner T.S., Scher M., Kirmizis A., Ouyang X., Brockdorff N., Abate-Shen C., Farnham P.J., Reinberg D. Proc. Natl. Acad. Sci. U.S.A. 102:1859-1864(2005) [PubMed: 15684044] [Abstract] Cited for: CHARACTERIZATION OF THE PRC4 COMPLEX INCLUDING EED; EZH2; RBBP4; RBBP7; SUZ12 AND SIRT1, METHYLTRANSFERASE ACTIVITY OF THE PRC4 COMPLEX. |
| [24] | "Akt-mediated phosphorylation of EZH2 suppresses methylation of lysine 27 in histone H3." Cha T.-L., Zhou B.P., Xia W., Wu Y., Yang C.-C., Chen C.-T., Ping B., Otte A.P., Hung M.-C. Science 310:306-310(2005) [PubMed: 16224021] [Abstract] Cited for: INTERACTION WITH EED AND SUZ12, PHOSPHORYLATION BY AKT1, MUTAGENESIS OF SER-21. |
| [25] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-487, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [26] | "Genome-wide mapping of Polycomb target genes unravels their roles in cell fate transitions." Bracken A.P., Dietrich N., Pasini D., Hansen K.H., Helin K. Genes Dev. 20:1123-1136(2006) [PubMed: 16618801] [Abstract] Cited for: FUNCTION. |
| [27] | "Substrate preferences of the EZH2 histone methyltransferase complex." Martin C., Cao R., Zhang Y. J. Biol. Chem. 281:8365-8370(2006) [PubMed: 16431907] [Abstract] Cited for: METHYLTRANSFERASE ACTIVITY OF THE PRC2 COMPLEX. |
| [28] | "The Polycomb group protein EZH2 directly controls DNA methylation." Vire E., Brenner C., Deplus R., Blanchon L., Fraga M., Didelot C., Morey L., Van Eynde A., Bernard D., Vanderwinden J.-M., Bollen M., Esteller M., Di Croce L., de Launoit Y., Fuks F. Nature 439:871-874(2006) [PubMed: 16357870] [Abstract] Cited for: FUNCTION, INTERACTION OF THE PRC2 COMPLEX WITH DNMT1; DNMT3A AND DNMT3B. |
| [29] | Erratum Vire E., Brenner C., Deplus R., Blanchon L., Fraga M., Didelot C., Morey L., Van Eynde A., Bernard D., Vanderwinden J.-M., Bollen M., Esteller M., Di Croce L., de Launoit Y., Fuks F. Nature 446:824-824(2006) |
| [30] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-487, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [31] | "Argonaute-1 directs siRNA-mediated transcriptional gene silencing in human cells." Kim D.H., Villeneuve L.M., Morris K.V., Rossi J.J. Nat. Struct. Mol. Biol. 13:793-797(2006) [PubMed: 16936726] [Abstract] Cited for: FUNCTION. |
| [32] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-487, MASS SPECTROMETRY. Tissue: Cervix adenocarcinoma. |
| [33] | "pRB family proteins are required for H3K27 trimethylation and Polycomb repression complexes binding to and silencing p16INK4alpha tumor suppressor gene." Kotake Y., Cao R., Viatour P., Sage J., Zhang Y., Xiong Y. Genes Dev. 21:49-54(2007) [PubMed: 17210787] [Abstract] Cited for: FUNCTION. |
| [34] | "The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells." Bracken A.P., Kleine-Kohlbrecher D., Dietrich N., Pasini D., Gargiulo G., Beekman C., Theilgaard-Moench K., Minucci S., Porse B.T., Marine J.-C., Hansen K.H., Helin K. Genes Dev. 21:525-530(2007) [PubMed: 17344414] [Abstract] Cited for: FUNCTION, DEVELOPMENTAL STAGE, INDUCTION. |
| [35] | "Polycomb-mediated methylation on Lys27 of histone H3 pre-marks genes for de novo methylation in cancer." Schlesinger Y., Straussman R., Keshet I., Farkash S., Hecht M., Zimmerman J., Eden E., Yakhini Z., Ben-Shushan E., Reubinoff B.E., Bergman Y., Simon I., Cedar H. Nat. Genet. 39:232-236(2007) [PubMed: 17200670] [Abstract] Cited for: DE NOVO DNA METHYLATION OF PRC2 TARGET GENES. |
| [36] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-380, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [37] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-487, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [38] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-487, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [39] | "Ezh1 and Ezh2 maintain repressive chromatin through different mechanisms." Margueron R., Li G., Sarma K., Blais A., Zavadil J., Woodcock C.L., Dynlacht B.D., Reinberg D. Mol. Cell 32:503-518(2008) [PubMed: 19026781] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE PRC2/EED-EZH1 COMPLEX. |
| [40] | "Role of hPHF1 in H3K27 methylation and Hox gene silencing." Cao R., Wang H., He J., Erdjument-Bromage H., Tempst P., Zhang Y. Mol. Cell. Biol. 28:1862-1872(2008) [PubMed: 18086877] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE PRC2 COMPLEX, METHYLTRANSFERASE ACTIVITY OF THE PRC2 COMPLEX. |
| [41] | "Ezh2 requires PHF1 to efficiently catalyze H3 lysine 27 trimethylation in vivo." Sarma K., Margueron R., Ivanov A., Pirrotta V., Reinberg D. Mol. Cell. Biol. 28:2718-2731(2008) [PubMed: 18285464] [Abstract] Cited for: FUNCTION, INTERACTION WITH EED; SUZ12 AND PHF1, METHYLTRANSFERASE ACTIVITY OF THE PRC2 COMPLEX, MUTAGENESIS OF HIS-689. |
| [42] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-339; SER-366; THR-367 AND THR-487, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [43] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-487, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [44] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-363 AND THR-487, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [45] | "Cyclin-dependent kinases regulate epigenetic gene silencing through phosphorylation of EZH2." Chen S., Bohrer L.R., Rai A.N., Pan Y., Gan L., Zhou X., Bagchi A., Simon J.A., Huang H. Nat. Cell Biol. 12:1108-1114(2010) [PubMed: 20935635] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT THR-345 BY CDK1 AND CDK2, MUTAGENESIS OF THR-345. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X95653 mRNA. Translation: CAA64955.1. U61145 mRNA. Translation: AAC51520.1. AK302216 mRNA. Translation: BAH13652.1. AK092676 mRNA. Translation: BAG52592.1. AK293239 mRNA. Translation: BAH11472.1. AK314291 mRNA. Translation: BAG36948.1. AC006323 Genomic DNA. No translation available. AC073140 Genomic DNA. No translation available. CH471146 Genomic DNA. Translation: EAW80067.1. CH471146 Genomic DNA. Translation: EAW80070.1. BC010858 mRNA. Translation: AAH10858.1. U52965 Genomic DNA. Translation: AAC50591.1. | ||||||||||||
| IPI | IPI00171252. IPI00376787. IPI00945286. IPI00947348. IPI00947357. | ||||||||||||
| PIR | G02838. | ||||||||||||
| RefSeq | NP_001190176.1. NM_001203247.1. NP_001190177.1. NM_001203248.1. NP_001190178.1. NM_001203249.1. NP_004447.2. NM_004456.4. NP_694543.1. NM_152998.2. | ||||||||||||
| UniGene | Hs.444082. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q15910. | ||||||||||||
| SMR | Q15910. Positions 40-68, 533-733. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-34002N. | ||||||||||||
| IntAct | Q15910. 19 interactions. | ||||||||||||
| MINT | MINT-1371596. | ||||||||||||
| STRING | Q15910. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q15910. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 3334180. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q15910. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000350995; ENSP00000223193; ENSG00000106462. ENST00000460911; ENSP00000419711; ENSG00000106462. ENST00000476773; ENSP00000419050; ENSG00000106462. ENST00000478654; ENSP00000417062; ENSG00000106462. ENST00000483967; ENSP00000419856; ENSG00000106462. | ||||||||||||
| GeneID | 2146. | ||||||||||||
| KEGG | hsa:2146. | ||||||||||||
| UCSC | uc003wfd.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 2146. | ||||||||||||
| GeneCards | GC07M148504. | ||||||||||||
| HGNC | HGNC:3527. EZH2. | ||||||||||||
| HPA | CAB009589. | ||||||||||||
| MIM | 601573. gene. | ||||||||||||
| neXtProt | NX_Q15910. | ||||||||||||
| PharmGKB | PA27939. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG17111. | ||||||||||||
| GeneTree | ENSGT00560000076698. | ||||||||||||
| HOVERGEN | HBG002453. | ||||||||||||
| InParanoid | Q15910. | ||||||||||||
| OMA | PDEREEK. | ||||||||||||
| OrthoDB | EOG4WWRJ0. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q15910. | ||||||||||||
| Bgee | Q15910. | ||||||||||||
| CleanEx | HS_EZH2. | ||||||||||||
| Genevestigator | Q15910. | ||||||||||||
| GermOnline | ENSG00000106462. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR021654. EZH2_WD-Binding. IPR001005. SANT_DNA-bd. IPR001214. SET_dom. [Graphical view] | ||||||||||||
| KO | K11430. | ||||||||||||
| Pfam | PF11616. EZH2_WD-Binding. 1 hit. PF00856. SET. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00717. SANT. 2 hits. SM00317. SET. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50280. SET. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | EZH2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15910 Secondary accession number(s): B2RAQ1 Q96FI6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with