Reviewed,
UniProtKB/Swiss-Prot Q15858 (SCN9A_HUMAN)
Last modified
May 26, 2009.
Version 82.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Sodium channel protein type 9 subunit alpha Alternative name(s): Sodium channel protein type IX subunit alpha Voltage-gated sodium channel subunit alpha Nav1.7 Neuroendocrine sodium channel Short name=hNE-Na Peripheral sodium channel 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1988 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na+ channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain By similarity. |
| Subunit structure | The sodium channel consists of a large polypeptide and 2-3 smaller ones. This sequence represents a large polypeptide. Interacts with NEDD4 and NEDD4L By similarity. |
| Subcellular location | Membrane; Multi-pass membrane protein. Note: In neurite terminals By similarity. |
| Tissue specificity | Expressed strongly in dorsal root ganglion, with only minor levels elsewhere in the body, smooth muscle cells, MTC cell line and C-cell carcinoma. Isoform 1 is expressed preferentially in the central and peripheral nervous system while isoform 2 is expressed preferentially in the dorsal root ganglion. Ref.1 Ref.3 Ref.6 Ref.7 |
| Domain | The sequence contains 4 internal repeats, each with 5 hydrophobic segments (S1,S2,S3,S5,S6) and one positively charged segment (S4). Segments S4 are probably the voltage-sensors and are characterized by a series of positively charged amino acids at every third position. |
| Post-translational modification | Ubiquitinated by NEDD4L; which may promote its endocytosis. Does not seem to be ubiquitinated by NEDD4 By similarity. |
| Involvement in disease | Defects in SCN9A are the cause of primary erythermalgia [MIM:133020]. It is an autosomal dominant disease characterized by recurrent episodes of severe pain associated with redness and warmth in the feet or hands. Ref.5 Ref.9 Ref.10 Ref.11 Ref.13 Defects in SCN9A are the cause of autosomal recessive congenital indifference to pain [MIM:243000]; also known as channelopathy-associated insensitivity to pain. Affected individuals have a congenital inability to perceive any form of pain, in any part of the body. All other sensory modalities are preserved and the peripheral and central nervous systems are apparently intact. Patients perceive the sensations of touch, warm and cold temperature, proprioception, tickle and pressure, but not painful stimuli. There is no evidence of a motor or sensory neuropathy, either axonal or demyelinating. Defects in SCN9A are a cause of paroxysmal extreme pain disorder (PEPD) [MIM:167400]; previously known as familial rectal pain (FRP). PEPD is an autosomal dominant paroxysmal disorder of pain and autonomic dysfunction. The distinctive features are paroxysmal episodes of burning pain in the rectal, ocular, and mandibular areas accompanied by autonomic manifestations such as skin flushing. Ref.12 |
| Sequence similarities | Belongs to the sodium channel family. Contains 1 IQ domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Sodium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Repeat Transmembrane |
| Ligand | Sodium |
| Molecular function | Ionic channel Sodium channel Voltage-gated channel |
| PTM | Glycoprotein Phosphoprotein Ubl conjugation |
| Gene Ontology (GO) | |
| Biological process | sodium ion transport Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | voltage-gated sodium channel complex Inferred from electronic annotation. Source: InterPro |
| Molecular function | sodium ion binding Inferred from electronic annotation. Source: UniProtKB-KW voltage-gated sodium channel activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15858-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15858-2) The sequence of this isoform differs from the canonical sequence as follows: 200-229: YLTEFVNLGNVSALRTFRVLRALKTISVIP → YVTEFVDLGNVSALRTFRVLRALKTISVIP | ||||||
| Isoform 3 (identifier: Q15858-3) The sequence of this isoform differs from the canonical sequence as follows: 648-658: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1988 | 1988 | Sodium channel protein type 9 subunit alpha | PRO_0000048502 | |||||
Regions | |||||||||
| Transmembrane | 122 – 145 | 24 | S1 of repeat I By similarity | ||||||
| Transmembrane | 154 – 173 | 20 | S2 of repeat I By similarity | ||||||
| Transmembrane | 187 – 205 | 19 | S3 of repeat I By similarity | ||||||
| Transmembrane | 212 – 231 | 20 | S4 of repeat I By similarity | ||||||
| Transmembrane | 248 – 271 | 24 | S5 of repeat I By similarity | ||||||
| Transmembrane | 379 – 404 | 26 | S6 of repeat I By similarity | ||||||
| Transmembrane | 739 – 763 | 25 | S1 of repeat II By similarity | ||||||
| Transmembrane | 775 – 798 | 24 | S2 of repeat II By similarity | ||||||
| Transmembrane | 807 – 826 | 20 | S3 of repeat II By similarity | ||||||
| Transmembrane | 833 – 852 | 20 | S4 of repeat II By similarity | ||||||
| Transmembrane | 869 – 889 | 21 | S5 of repeat II By similarity | ||||||
| Transmembrane | 943 – 968 | 26 | S6 of repeat II By similarity | ||||||
| Transmembrane | 1188 – 1211 | 24 | S1 of repeat III By similarity | ||||||
| Transmembrane | 1225 – 1250 | 26 | S2 of repeat III By similarity | ||||||
| Transmembrane | 1257 – 1278 | 22 | S3 of repeat III By similarity | ||||||
| Transmembrane | 1283 – 1304 | 22 | S4 of repeat III By similarity | ||||||
| Transmembrane | 1324 – 1351 | 28 | S5 of repeat III By similarity | ||||||
| Transmembrane | 1431 – 1457 | 27 | S6 of repeat III By similarity | ||||||
| Transmembrane | 1511 – 1534 | 24 | S1 of repeat IV By similarity | ||||||
| Transmembrane | 1546 – 1569 | 24 | S2 of repeat IV By similarity | ||||||
| Transmembrane | 1576 – 1599 | 24 | S3 of repeat IV By similarity | ||||||
| Transmembrane | 1610 – 1631 | 22 | S4 of repeat IV By similarity | ||||||
| Transmembrane | 1647 – 1669 | 23 | S5 of repeat IV By similarity | ||||||
| Transmembrane | 1736 – 1760 | 25 | S6 of repeat IV By similarity | ||||||
| Repeat | 121 – 405 | 285 | I | ||||||
| Repeat | 738 – 969 | 232 | II | ||||||
| Repeat | 1187 – 1458 | 272 | III | ||||||
| Repeat | 1510 – 1761 | 252 | IV | ||||||
| Domain | 1889 – 1918 | 30 | IQ | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1413 | 1 | Phosphotyrosine Ref.8 | ||||||
| Modified residue | 1418 | 1 | Phosphoserine Ref.8 | ||||||
| Glycosylation | 209 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 283 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1352 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1366 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1375 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 200 – 229 | 30 | YLTEF…ISVIP → YVTEFVDLGNVSALRTFRVL RALKTISVIP in isoform 2. | VSP_012028 | |||||
| Alternative sequence | 648 – 658 | 11 | Missing in isoform 3. | VSP_012029 | |||||
| Natural variant | 241 | 1 | S → T in primary erythermalgia. Ref.10 | VAR_032014 | |||||
| Natural variant | 859 | 1 | I → T in primary erythermalgia; sporadic; activated at more negative potentials; slower inactivation kinetics than wild-type channels. Ref.5 Ref.9 | VAR_019947 | |||||
| Natural variant | 869 | 1 | L → H in primary erythermalgia; activated at more negative potentials; slower inactivation kinetics than wild-type channels. Ref.5 Ref.9 Ref.13 | VAR_019948 | |||||
| Natural variant | 932 | 1 | M → L: dbSNP rs12478318. | VAR_030444 | |||||
| Natural variant | 943 | 1 | M → L: dbSNP rs12478318. | VAR_055646 | |||||
| Natural variant | 1007 | 1 | R → C in PEPD. Ref.12 | VAR_032015 | |||||
| Natural variant | 1161 | 1 | R → W: dbSNP rs6746030. | VAR_019949 | |||||
| Natural variant | 1309 | 1 | V → D in PEPD. Ref.12 | VAR_032016 | |||||
| Natural variant | 1309 | 1 | V → F in PEPD. Ref.12 | VAR_032017 | |||||
| Natural variant | 1310 | 1 | V → F in PEPD. Ref.12 | VAR_032018 | |||||
| Natural variant | 1460 | 1 | F → V in primary erythermalgia; produces a hyperpolarizing shift in channel activation and a depolarizing shift in steady-state activation. Ref.11 | VAR_032019 | |||||
| Natural variant | 1472 | 1 | I → T in PEPD; reduction in fast inactivation leading to persistent sodium current. Ref.12 | VAR_032020 | |||||
| Natural variant | 1473 | 1 | F → V in PEPD. Ref.12 | VAR_032021 | |||||
| Natural variant | 1475 | 1 | T → I in PEPD; reduction in fast inactivation leading to persistent sodium current. Ref.12 | VAR_032022 | |||||
| Natural variant | 1638 | 1 | M → K in PEPD; reduction in fast inactivation leading to persistent sodium current. Ref.12 | VAR_032023 | |||||
| Natural variant | 1919 | 1 | D → G: dbSNP rs3750904. | VAR_019950 | |||||
Experimental info | |||||||||
| Sequence conflict | 201 | 1 | L → V in AAT85835. Ref.3 | ||||||
| Sequence conflict | 201 | 1 | L → V in AAT85833. Ref.3 | ||||||
| Sequence conflict | 206 | 1 | N → D in AAT85835. Ref.3 | ||||||
| Sequence conflict | 206 | 1 | N → D in AAT85833. Ref.3 | ||||||
| Sequence conflict | 267 | 1 | F → S in AAT85834. Ref.3 | ||||||
| Sequence conflict | 301 | 1 | K → R in AAT85835. Ref.3 | ||||||
| Sequence conflict | 309 | 1 | S → P in AAT85834. Ref.3 | ||||||
| Sequence conflict | 420 | 1 | E → G in AAT85834. Ref.3 | ||||||
| Sequence conflict | 430 | 1 | L → P in AAT85834. Ref.3 | ||||||
| Sequence conflict | 501 | 1 | S → P in AAT85835. Ref.3 | ||||||
| Sequence conflict | 610 | 1 | P → T in AAT85835. Ref.3 | ||||||
| Sequence conflict | 642 | 1 | G → R in AAT85835. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and functional expression of a new member of the tetrodotoxin-sensitive voltage-activated sodium channel family from human neuroendocrine cells." Klugbauer N., Lacinova L., Flockerzi V., Hofmann F. EMBO J. 14:1084-1090(1995) [PubMed: 7720699] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION IN VOLTAGE-EVOKED DEPOLARIZATION, TISSUE SPECIFICITY. Tissue: Thyroid. |
| [2] | "An SCN9A channelopathy causes congenital inability to experience pain." Cox J.J., Reimann F., Nicholas A.K., Thornton G., Roberts E., Springell K., Karbani G., Jafri H., Mannan J., Raashid Y., Al-Gazali L., Hamamy H., Valente E.M., Gorman S., Williams R., McHale D.P., Wood J.N., Gribble F.M., Woods C.G. Nature 444:894-898(2006) [PubMed: 17167479] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INVOLVEMENT IN CONGENITAL INSENSITIVITY TO PAIN, CHARACTERIZATION. |
| [3] | "Expression of alternatively spliced sodium channel alpha-subunit genes: unique splicing patterns are observed in dorsal root ganglia." Raymond C.K., Castle J.C., Garrett-Engele P.W., Armour C.D., Kan Z.G., Tsinoremas N.T., Johnson J.M. J. Biol. Chem. 279:46234-46241(2004) [PubMed: 15302875] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 136-674 (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY. Tissue: Spinal ganglion. |
| [4] | "Upregulation of voltage-gated Na+ channel expression and metastatic potential in human breast cancer: correlative studies on cell lines and biopsy tissues." Diss J.K.J., Fraser S.P., Coombes R.C., Djamgoz M.B.A. Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 150-264 AND 1340-1400. |
| [5] | "Mutations in SCN9A, encoding a sodium channel alpha subunit, in patients with primary erythermalgia." Yang Y., Wang Y., Li S., Xu Z., Li H., Ma L., Fan J., Bu D., Liu B., Fan Z., Wu G., Jin J., Ding B., Zhu X., Shen Y. J. Med. Genet. 41:171-174(2004) [PubMed: 14985375] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 840-958, VARIANTS PRIMARY ERYTHERMALGIA THR-859 AND HIS-869. |
| [6] | "A novel tetrodotoxin-sensitive, voltage-gated sodium channel expressed in rat and human dorsal root ganglia." Sangameswaran L., Fish L.M., Koch B.D., Rabert D.K., Delgado S.G., Ilnicka M., Jakeman L.B., Novakovic S., Wong K., Sze P., Tzoumaka E., Stewart G.R., Herman R.C., Chan H., Eglen R.M., Hunter J.C. J. Biol. Chem. 272:14805-14809(1997) [PubMed: 9169448] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [7] | "Voltage-gated sodium channel expressed in cultured human smooth muscle cells: involvement of SCN9A." Jo T., Nagata T., Iida H., Imuta H., Iwasawa K., Ma J., Hara K., Omata M., Nagai R., Takizawa H., Nagase T., Nakajima T. FEBS Lett. 567:339-343(2004) [PubMed: 15178348] [Abstract] Cited for: FUNCTION IN VOLTAGE-EVOKED DEPOLARIZATION, TISSUE SPECIFICITY. |
| [8] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1413 AND SER-1418, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "Electrophysiological properties of mutant Nav1.7 sodium channels in a painful inherited neuropathy." Cummins T.R., Dib-Hajj S.D., Waxman S.G. J. Neurosci. 24:8232-8236(2004) [PubMed: 15385606] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS PRIMARY ERYTHERMALGIA THR-859 AND HIS-869. |
| [10] | "Autosomal dominant erythermalgia associated with a novel mutation in the voltage-gated sodium channel alpha subunit Nav1.7." Michiels J.J., te Morsche R.H.M., Jansen J.B.M.J., Drenth J.P.H. Arch. Neurol. 62:1587-1590(2005) [PubMed: 16216943] [Abstract] Cited for: VARIANT PRIMARY ERYTHERMALGIA THR-241. |
| [11] | "Gain-of-function mutation in Nav1.7 in familial erythromelalgia induces bursting of sensory neurons." Dib-Hajj S.D., Rush A.M., Cummins T.R., Hisama F.M., Novella S., Tyrrell L., Marshall L., Waxman S.G. Brain 128:1847-1854(2005) [PubMed: 15958509] [Abstract] Cited for: VARIANT PRIMARY ERYTHERMALGIA VAL-1460, CHARACTERIZATION OF VARIANT PRIMARY ERYTHERMALGIA VAL-1460. |
| [12] | "SCN9A mutations in paroxysmal extreme pain disorder: allelic variants underlie distinct channel defects and phenotypes." Fertleman C.R., Baker M.D., Parker K.A., Moffatt S., Elmslie F.V., Abrahamsen B., Ostman J., Klugbauer N., Wood J.N., Gardiner R.M., Rees M. Neuron 52:767-774(2006) [PubMed: 17145499] [Abstract] Cited for: VARIANTS PEPD CYS-1007; PHE-1309; ASP-1309; PHE-1310; THR-1472; VAL-1473; ILE-1475 AND LYS-1638, CHARACTERIZATION OF VARIANTS PEPD THR-1472; ILE-1475 AND LYS-1638. |
| [13] | "A single sodium channel mutation produces hyper- or hypoexcitability in different types of neurons." Rush A.M., Dib-Hajj S.D., Liu S., Cummins T.R., Black J.A., Waxman S.G. Proc. Natl. Acad. Sci. U.S.A. 103:8245-8250(2006) [PubMed: 16702558] [Abstract] Cited for: CHARACTERIZATION OF VARIANT PRIMARY ERYTHERMALGIA HIS-869. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Wikipedia SCN9A entry |
| Protein Spotlight Silent pain - Issue 102 of February 2009 |
Cross-references
Sequence databases | |
|---|---|
| X82835 mRNA. Translation: CAA58042.1. DQ857292 mRNA. Translation: ABI51981.1. AY682084 mRNA. Translation: AAT85833.1. AY682085 mRNA. Translation: AAT85834.1. AY682086 mRNA. Translation: AAT85835.1. AJ310882 mRNA. Translation: CAC84550.1. AJ310883 mRNA. Translation: CAC84551.1. AJ310897 mRNA. Translation: CAC84537.1. AJ580918 Genomic DNA. Translation: CAE45644.1. AJ580919 Genomic DNA. Translation: CAE45645.1. | |
| IPI | IPI00154944. IPI00479414. IPI00745570. |
| PIR | S54771. |
| RefSeq | NP_002968.1. |
| UniGene | Hs.439145 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1BYY based on UniProtKB P04775. |
| ModBase | Search... |
Protein family/group databases | |
| TCDB | 1.A.1.10.5. voltage-gated ion channel (VIC) superfamily. |
Proteomic databases | |
| PRIDE | Q15858. |
Genome annotation databases | |
| Ensembl | ENSG00000169432. Homo sapiens. [Contig view] |
| GeneID | 6335. |
| KEGG | hsa:6335. |
Organism-specific databases | |
| GeneCards | GC02M166763. |
| H-InvDB | HIX0029861. |
| HGNC | HGNC:10597. SCN9A. |
| HPA | CAB013679. |
| MIM | 133020. phenotype. 167400. phenotype. 243000. phenotype. 603415. gene. |
| Orphanet | 88642. Congenital indifference to pain. 1956. Erythromelalgia. 46348. Paroxysmal extreme pain disorder. 90026. Primary erythermalgia. |
| PharmGKB | PA35010. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q15858. |
Gene expression databases | |
| ArrayExpress | Q15858. |
| Bgee | Q15858. |
| CleanEx | HS_SCN9A. |
| GermOnline | ENSG00000169432. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005821. Ion_trans. IPR000048. IQ_CaM_bd_region. IPR001696. Na_channel. IPR010526. Na_trans_assoc. [Graphical view] |
| Pfam | PF00520. Ion_trans. 4 hits. PF00612. IQ. 1 hit. PF06512. Na_trans_assoc. 1 hit. [Graphical view] |
| PRINTS | PR00170. NACHANNEL. |
| SMART | SM00015. IQ. 1 hit. [Graphical view] |
| PROSITE | PS50096. IQ. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00555. Lamotrigine. DB00281. Lidocaine. |
| NextBio | 24600. |
| SOURCE | Search... |
Entry information
| Entry name | SCN9A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15858 Secondary accession number(s): A1BUH5 Q8WWN4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


