Q15858 (SCN9A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium channel protein type 9 subunit alpha Alternative name(s): Neuroendocrine sodium channel Short name=hNE-Na Peripheral sodium channel 1 Short name=PN1 Sodium channel protein type IX subunit alpha Voltage-gated sodium channel subunit alpha Nav1.7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1988 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na+ channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain By similarity. Ref.1 Ref.8 |
| Subunit structure | The sodium channel consists of a large polypeptide and 2-3 smaller ones. This sequence represents a large polypeptide. Interacts with NEDD4 and NEDD4L By similarity. |
| Subcellular location | Membrane; Multi-pass membrane protein. Note: In neurite terminals By similarity. |
| Tissue specificity | Expressed strongly in dorsal root ganglion, with only minor levels elsewhere in the body, smooth muscle cells, MTC cell line and C-cell carcinoma. Isoform 1 is expressed preferentially in the central and peripheral nervous system. Isoform 2 is expressed preferentially in the dorsal root ganglion. Ref.1 Ref.4 Ref.7 Ref.8 |
| Domain | The sequence contains 4 internal repeats, each with 5 hydrophobic segments (S1,S2,S3,S5,S6) and one positively charged segment (S4). Segments S4 are probably the voltage-sensors and are characterized by a series of positively charged amino acids at every third position. |
| Post-translational modification | Ubiquitinated by NEDD4L; which may promote its endocytosis. Does not seem to be ubiquitinated by NEDD4 By similarity. |
| Involvement in disease | Primary erythermalgia (PERYTHM) [MIM:133020]: Autosomal dominant disease characterized by recurrent episodes of severe pain associated with redness and warmth in the feet or hands. Congenital indifference to pain autosomal recessive (CIPAR) [MIM:243000]: A disorder characterized by congenital inability to perceive any form of pain, in any part of the body. All other sensory modalities are preserved and the peripheral and central nervous systems are apparently intact. Patients perceive the sensations of touch, warm and cold temperature, proprioception, tickle and pressure, but not painful stimuli. There is no evidence of a motor or sensory neuropathy, either axonal or demyelinating. Paroxysmal extreme pain disorder (PEPD) [MIM:167400]: Autosomal dominant paroxysmal disorder of pain and autonomic dysfunction. The distinctive features are paroxysmal episodes of burning pain in the rectal, ocular, and mandibular areas accompanied by autonomic manifestations such as skin flushing. Generalized epilepsy with febrile seizures plus 7 (GEFS+7) [MIM:613863]: A rare autosomal dominant, familial condition with incomplete penetrance and large intrafamilial variability. Patients display febrile seizures persisting sometimes beyond the age of 6 years and/or a variety of afebrile seizure types. This disease combines febrile seizures, generalized seizures often precipitated by fever at age 6 years or more, and partial seizures, with a variable degree of severity. Familial febrile convulsions 3B (FEB3B) [MIM:613863]: Seizures associated with febrile episodes in childhood without any evidence of intracranial infection or defined pathologic or traumatic cause. It is a common condition, affecting 2-5% of children aged 3 months to 5 years. The majority are simple febrile seizures (generally defined as generalized onset, single seizures with a duration of less than 30 minutes). Complex febrile seizures are characterized by focal onset, duration greater than 30 minutes, and/or more than one seizure in a 24 hour period. The likelihood of developing epilepsy following simple febrile seizures is low. Complex febrile seizures are associated with a moderately increased incidence of epilepsy. |
| Sequence similarities | Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.7/SCN9A subfamily. [View classification] Contains 1 IQ domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15858-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15858-2) The sequence of this isoform differs from the canonical sequence as follows: 200-229: YLTEFVNLGNVSALRTFRVLRALKTISVIP → YVTEFVDLGNVSALRTFRVLRALKTISVIP | ||||||
| Isoform 3 (identifier: Q15858-3) The sequence of this isoform differs from the canonical sequence as follows: 648-658: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1988 | 1988 | Sodium channel protein type 9 subunit alpha | PRO_0000048502 | |||||
Regions | |||||||||
| Transmembrane | 122 – 145 | 24 | Helical; Name=S1 of repeat I; Potential | ||||||
| Transmembrane | 154 – 173 | 20 | Helical; Name=S2 of repeat I; Potential | ||||||
| Transmembrane | 187 – 205 | 19 | Helical; Name=S3 of repeat I; Potential | ||||||
| Transmembrane | 212 – 231 | 20 | Helical; Voltage-sensor; Name=S4 of repeat I; Potential | ||||||
| Transmembrane | 248 – 271 | 24 | Helical; Name=S5 of repeat I; Potential | ||||||
| Transmembrane | 379 – 404 | 26 | Helical; Name=S6 of repeat I; Potential | ||||||
| Transmembrane | 739 – 763 | 25 | Helical; Name=S1 of repeat II; Potential | ||||||
| Transmembrane | 775 – 798 | 24 | Helical; Name=S2 of repeat II; Potential | ||||||
| Transmembrane | 807 – 826 | 20 | Helical; Name=S3 of repeat II; Potential | ||||||
| Transmembrane | 833 – 852 | 20 | Helical; Voltage-sensor; Name=S4 of repeat II; Potential | ||||||
| Transmembrane | 869 – 889 | 21 | Helical; Name=S5 of repeat II; Potential | ||||||
| Transmembrane | 943 – 968 | 26 | Helical; Name=S6 of repeat II; Potential | ||||||
| Transmembrane | 1188 – 1211 | 24 | Helical; Name=S1 of repeat III; Potential | ||||||
| Transmembrane | 1225 – 1250 | 26 | Helical; Name=S2 of repeat III; Potential | ||||||
| Transmembrane | 1257 – 1278 | 22 | Helical; Name=S3 of repeat III; Potential | ||||||
| Transmembrane | 1283 – 1304 | 22 | Helical; Voltage-sensor; Name=S4 of repeat III; Potential | ||||||
| Transmembrane | 1324 – 1351 | 28 | Helical; Name=S5 of repeat III; Potential | ||||||
| Transmembrane | 1431 – 1457 | 27 | Helical; Name=S6 of repeat III; Potential | ||||||
| Transmembrane | 1511 – 1534 | 24 | Helical; Name=S1 of repeat IV; Potential | ||||||
| Transmembrane | 1546 – 1569 | 24 | Helical; Name=S2 of repeat IV; Potential | ||||||
| Transmembrane | 1576 – 1599 | 24 | Helical; Name=S3 of repeat IV; Potential | ||||||
| Transmembrane | 1610 – 1631 | 22 | Helical; Voltage-sensor; Name=S4 of repeat IV; Potential | ||||||
| Transmembrane | 1647 – 1669 | 23 | Helical; Name=S5 of repeat IV; Potential | ||||||
| Transmembrane | 1736 – 1760 | 25 | Helical; Name=S6 of repeat IV; Potential | ||||||
| Repeat | 121 – 405 | 285 | I | ||||||
| Repeat | 738 – 969 | 232 | II | ||||||
| Repeat | 1187 – 1458 | 272 | III | ||||||
| Repeat | 1510 – 1761 | 252 | IV | ||||||
| Domain | 1889 – 1918 | 30 | IQ | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 209 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 283 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1352 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1366 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1375 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 200 – 229 | 30 | YLTEF…ISVIP → YVTEFVDLGNVSALRTFRVL RALKTISVIP in isoform 2. | VSP_012028 | |||||
| Alternative sequence | 648 – 658 | 11 | Missing in isoform 3. | VSP_012029 | |||||
| Natural variant | 10 | 1 | Q → R in PERYTHM; causes a hyperpolarizing shift of -5.3 mV for the midpoint of activation which is smaller than that seen in other mutations causing early-onset erythromelalgia mutations; also causes a faster rate of activation and slower deactivation compared to wild-type; expression of the mutant protein induced hyperexcitability in dorsal root ganglion neurons but the increase is smaller than that produced by Thr-859. Ref.17 | VAR_064595 | |||||
| Natural variant | 62 | 1 | I → V in FEB3B. Ref.18 | VAR_064596 | |||||
| Natural variant | 149 | 1 | P → Q in FEB3B. Ref.18 | VAR_064597 | |||||
| Natural variant | 216 | 1 | F → S in PERYTHM; hyperpolarizes the voltage dependence of activation by 11 mV, accelerates activation, slows deactivation and enhances the response to slow, small depolarizations. Ref.12 Ref.14 | VAR_064598 | |||||
| Natural variant | 228 | 1 | I → M. Ref.18 | VAR_064599 | |||||
| Natural variant | 241 | 1 | S → T in PERYTHM. Ref.10 | VAR_032014 | |||||
| Natural variant | 395 | 1 | N → K in PERYTHM. Ref.12 | VAR_064600 | |||||
| Natural variant | 406 | 1 | E → K in PERYTHM. | VAR_064601 | |||||
| Natural variant | 490 | 1 | S → N. Ref.18 | VAR_064602 | |||||
| Natural variant | 519 | 1 | E → K. Ref.18 | VAR_064603 | |||||
| Natural variant | 641 | 1 | N → Y in GEFS+7. Ref.18 | VAR_064604 | |||||
| Natural variant | 666 | 1 | K → R in GEFS+7; also found in a patient with severe myoclonic epilepsy in infancy. Ref.18 | VAR_064605 | |||||
| Natural variant | 695 | 1 | I → M. Ref.18 | VAR_064606 | |||||
| Natural variant | 710 | 1 | C → Y Found in a patient with severe myoclonic epilepsy in infancy. Ref.18 | VAR_064607 | |||||
| Natural variant | 750 | 1 | I → V. Ref.18 | VAR_064608 | |||||
| Natural variant | 859 | 1 | I → T in PERYTHM; sporadic; activated at more negative potentials; slower inactivation kinetics than wild-type channels. Ref.6 Ref.9 Ref.12 Ref.17 | VAR_019947 | |||||
| Natural variant | 869 | 1 | L → F in PERYTHM; causes a hyperpolarizing shift in channel activation, a depolarizing shift of inactivation and an 18-fold increase in deactivation time compared to wild-type; the mean ramp current amplitude in response to slow depolarization is higher in the mutant channels. Ref.12 Ref.13 | VAR_064609 | |||||
| Natural variant | 869 | 1 | L → H in PERYTHM; activated at more negative potentials; slower inactivation kinetics than wild-type channels. Ref.6 Ref.9 Ref.16 | VAR_019948 | |||||
| Natural variant | 907 | 1 | R → Q in CIPAR; significant reduction in membrane localization of the mutant protein compared to the wild-type; complete loss of function of the sodium channel. Ref.19 | VAR_064610 | |||||
| Natural variant | 932 | 1 | M → L. Corresponds to variant rs12478318 [ dbSNP | Ensembl ]. | VAR_030444 | |||||
| Natural variant | 943 | 1 | M → L. Corresponds to variant rs12478318 [ dbSNP | Ensembl ]. | VAR_055646 | |||||
| Natural variant | 1007 | 1 | R → C in PEPD. Ref.15 | VAR_032015 | |||||
| Natural variant | 1134 | 1 | L → F. Ref.18 | VAR_064611 | |||||
| Natural variant | 1161 | 1 | W → R. Ref.1 Ref.2 Ref.12 Corresponds to variant rs6746030 [ dbSNP | Ensembl ]. | VAR_019949 | |||||
| Natural variant | 1171 | 1 | E → Q Found in a patient with severe myoclonic epilepsy in infancy. Ref.18 | VAR_064612 | |||||
| Natural variant | 1278 | 1 | L → V. Ref.18 | VAR_064613 | |||||
| Natural variant | 1309 | 1 | V → D in PEPD. Ref.15 | VAR_032016 | |||||
| Natural variant | 1309 | 1 | V → F in PEPD. Ref.15 | VAR_032017 | |||||
| Natural variant | 1310 | 1 | V → F in PEPD. Ref.15 | VAR_032018 | |||||
| Natural variant | 1381 – 1385 | 5 | Missing in CIPAR; significant reduction in membrane localization of the mutant protein compared to the wild-type; complete loss of function of the sodium channel. | VAR_064614 | |||||
| Natural variant | 1460 | 1 | F → V in PERYTHM; produces a hyperpolarizing shift in channel activation and a depolarizing shift in steady-state activation. Ref.11 | VAR_032019 | |||||
| Natural variant | 1472 | 1 | I → T in PEPD; reduction in fast inactivation leading to persistent sodium current. Ref.15 | VAR_032020 | |||||
| Natural variant | 1473 | 1 | F → V in PEPD. Ref.15 | VAR_032021 | |||||
| Natural variant | 1475 | 1 | T → I in PEPD; reduction in fast inactivation leading to persistent sodium current. Ref.15 | VAR_032022 | |||||
| Natural variant | 1638 | 1 | M → K in PEPD; reduction in fast inactivation leading to persistent sodium current. Ref.15 | VAR_032023 | |||||
| Natural variant | 1919 | 1 | D → G. Corresponds to variant rs3750904 [ dbSNP | Ensembl ]. | VAR_019950 | |||||
Experimental info | |||||||||
| Sequence conflict | 201 | 1 | L → V in AAT85835. Ref.4 | ||||||
| Sequence conflict | 201 | 1 | L → V in AAT85833. Ref.4 | ||||||
| Sequence conflict | 206 | 1 | N → D in AAT85835. Ref.4 | ||||||
| Sequence conflict | 206 | 1 | N → D in AAT85833. Ref.4 | ||||||
| Sequence conflict | 267 | 1 | F → S in AAT85834. Ref.4 | ||||||
| Sequence conflict | 301 | 1 | K → R in AAT85835. Ref.4 | ||||||
| Sequence conflict | 309 | 1 | S → P in AAT85834. Ref.4 | ||||||
| Sequence conflict | 420 | 1 | E → G in AAT85834. Ref.4 | ||||||
| Sequence conflict | 430 | 1 | L → P in AAT85834. Ref.4 | ||||||
| Sequence conflict | 501 | 1 | S → P in AAT85835. Ref.4 | ||||||
| Sequence conflict | 610 | 1 | P → T in AAT85835. Ref.4 | ||||||
| Sequence conflict | 642 | 1 | G → R in AAT85835. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and functional expression of a new member of the tetrodotoxin-sensitive voltage-activated sodium channel family from human neuroendocrine cells." Klugbauer N., Lacinova L., Flockerzi V., Hofmann F. EMBO J. 14:1084-1090(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION IN VOLTAGE-EVOKED DEPOLARIZATION, TISSUE SPECIFICITY, VARIANT ARG-1161. Tissue: Thyroid. |
| [2] | "An SCN9A channelopathy causes congenital inability to experience pain." Cox J.J., Reimann F., Nicholas A.K., Thornton G., Roberts E., Springell K., Karbani G., Jafri H., Mannan J., Raashid Y., Al-Gazali L., Hamamy H., Valente E.M., Gorman S., Williams R., McHale D.P., Wood J.N., Gribble F.M., Woods C.G. Nature 444:894-898(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INVOLVEMENT IN CONGENITAL INSENSITIVITY TO PAIN, CHARACTERIZATION, VARIANT ARG-1161. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Expression of alternatively spliced sodium channel alpha-subunit genes: unique splicing patterns are observed in dorsal root ganglia." Raymond C.K., Castle J.C., Garrett-Engele P.W., Armour C.D., Kan Z.G., Tsinoremas N.T., Johnson J.M. J. Biol. Chem. 279:46234-46241(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 136-674 (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY. Tissue: Spinal ganglion. |
| [5] | "Upregulation of voltage-gated Na+ channel expression and metastatic potential in human breast cancer: correlative studies on cell lines and biopsy tissues." Diss J.K.J., Fraser S.P., Coombes R.C., Djamgoz M.B.A. Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 150-264 AND 1340-1400. |
| [6] | "Mutations in SCN9A, encoding a sodium channel alpha subunit, in patients with primary erythermalgia." Yang Y., Wang Y., Li S., Xu Z., Li H., Ma L., Fan J., Bu D., Liu B., Fan Z., Wu G., Jin J., Ding B., Zhu X., Shen Y. J. Med. Genet. 41:171-174(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 840-958, VARIANTS PERYTHM THR-859 AND HIS-869. |
| [7] | "A novel tetrodotoxin-sensitive, voltage-gated sodium channel expressed in rat and human dorsal root ganglia." Sangameswaran L., Fish L.M., Koch B.D., Rabert D.K., Delgado S.G., Ilnicka M., Jakeman L.B., Novakovic S., Wong K., Sze P., Tzoumaka E., Stewart G.R., Herman R.C., Chan H., Eglen R.M., Hunter J.C. J. Biol. Chem. 272:14805-14809(1997) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "Voltage-gated sodium channel expressed in cultured human smooth muscle cells: involvement of SCN9A." Jo T., Nagata T., Iida H., Imuta H., Iwasawa K., Ma J., Hara K., Omata M., Nagai R., Takizawa H., Nagase T., Nakajima T. FEBS Lett. 567:339-343(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN VOLTAGE-EVOKED DEPOLARIZATION, TISSUE SPECIFICITY. |
| [9] | "Electrophysiological properties of mutant Nav1.7 sodium channels in a painful inherited neuropathy." Cummins T.R., Dib-Hajj S.D., Waxman S.G. J. Neurosci. 24:8232-8236(2004) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS PERYTHM THR-859 AND HIS-869. |
| [10] | "Autosomal dominant erythermalgia associated with a novel mutation in the voltage-gated sodium channel alpha subunit Nav1.7." Michiels J.J., te Morsche R.H.M., Jansen J.B.M.J., Drenth J.P.H. Arch. Neurol. 62:1587-1590(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PERYTHM THR-241. |
| [11] | "Gain-of-function mutation in Nav1.7 in familial erythromelalgia induces bursting of sensory neurons." Dib-Hajj S.D., Rush A.M., Cummins T.R., Hisama F.M., Novella S., Tyrrell L., Marshall L., Waxman S.G. Brain 128:1847-1854(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PERYTHM VAL-1460, CHARACTERIZATION OF VARIANT PERYTHM VAL-1460. |
| [12] | "SCN9A mutations define primary erythermalgia as a neuropathic disorder of voltage gated sodium channels." Drenth J.P., te Morsche R.H., Guillet G., Taieb A., Kirby R.L., Jansen J.B. J. Invest. Dermatol. 124:1333-1338(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PERYTHM SER-216; LYS-395; THR-859 AND PHE-869, VARIANT ARG-1161. |
| [13] | "Sporadic onset of erythermalgia: a gain-of-function mutation in Nav1.7." Han C., Rush A.M., Dib-Hajj S.D., Li S., Xu Z., Wang Y., Tyrrell L., Wang X., Yang Y., Waxman S.G. Ann. Neurol. 59:553-558(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PERYTHM PHE-869, CHARACTERIZATION OF VARIANT PERYTHM PHE-869. |
| [14] | "Inherited erythermalgia: limb pain from an S4 charge-neutral Na channelopathy." Choi J.S., Dib-Hajj S.D., Waxman S.G. Neurology 67:1563-1567(2006) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANT PERYTHM SER-216. |
| [15] | "SCN9A mutations in paroxysmal extreme pain disorder: allelic variants underlie distinct channel defects and phenotypes." Fertleman C.R., Baker M.D., Parker K.A., Moffatt S., Elmslie F.V., Abrahamsen B., Ostman J., Klugbauer N., Wood J.N., Gardiner R.M., Rees M. Neuron 52:767-774(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PEPD CYS-1007; PHE-1309; ASP-1309; PHE-1310; THR-1472; VAL-1473; ILE-1475 AND LYS-1638, CHARACTERIZATION OF VARIANTS PEPD THR-1472; ILE-1475 AND LYS-1638. |
| [16] | "A single sodium channel mutation produces hyper- or hypoexcitability in different types of neurons." Rush A.M., Dib-Hajj S.D., Liu S., Cummins T.R., Black J.A., Waxman S.G. Proc. Natl. Acad. Sci. U.S.A. 103:8245-8250(2006) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANT PERYTHM HIS-869. |
| [17] | "Early- and late-onset inherited erythromelalgia: genotype-phenotype correlation." Han C., Dib-Hajj S.D., Lin Z., Li Y., Eastman E.M., Tyrrell L., Cao X., Yang Y., Waxman S.G. Brain 132:1711-1722(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PERYTHM ARG-10, CHARACTERIZATION OF VARIANTS PERYTHM ARG-10 AND THR-859. |
| [18] | "A role of SCN9A in human epilepsies, as a cause of febrile seizures and as a potential modifier of Dravet syndrome." Singh N.A., Pappas C., Dahle E.J., Claes L.R., Pruess T.H., De Jonghe P., Thompson J., Dixon M., Gurnett C., Peiffer A., White H.S., Filloux F., Leppert M.F. PLoS Genet. 5:E1000649-E1000649(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS GEFS+7 TYR-641 AND ARG-666, VARIANTS FEB3B VAL-62 AND GLN-149, VARIANTS MET-228; ASN-490; LYS-519; MET-695; TYR-710; VAL-750; PHE-1134; GLN-1171 AND VAL-1278. |
| [19] | "Congenital insensitivity to pain: novel SCN9A missense and in-frame deletion mutations." Cox J.J., Sheynin J., Shorer Z., Reimann F., Nicholas A.K., Zubovic L., Baralle M., Wraige E., Manor E., Levy J., Woods C.G., Parvari R. Hum. Mutat. 31:E1670-E1686(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CIPAR GLN-907 AND 1381-ARG--LEU-1385 DEL, CHARACTERIZATION OF VARIANTS CIPAR GLN-907 AND 1381-ARG--LEU-1385 DEL. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Wikipedia SCN9A entry |
| Protein Spotlight Silent pain - Issue 102 of February 2009 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X82835 mRNA. Translation: CAA58042.1. DQ857292 mRNA. Translation: ABI51981.1. AC074101 Genomic DNA. No translation available. AC107082 Genomic DNA. No translation available. AC108146 Genomic DNA. No translation available. AY682084 mRNA. Translation: AAT85833.1. AY682085 mRNA. Translation: AAT85834.1. AY682086 mRNA. Translation: AAT85835.1. AJ310882 mRNA. Translation: CAC84550.1. AJ310883 mRNA. Translation: CAC84551.1. AJ310897 mRNA. Translation: CAC84537.1. AJ580918 Genomic DNA. Translation: CAE45644.1. AJ580919 Genomic DNA. Translation: CAE45645.1. |
| IPI | IPI00154944. IPI00479414. IPI00745570. |
| PIR | S54771. |
| RefSeq | NP_002968.1. NM_002977.3. |
| UniGene | Hs.439145. |
3D structure databases | |
| ProteinModelPortal | Q15858. |
| SMR | Q15858. Positions 1761-1916. |
| ModBase | Search... |
Protein family/group databases | |
| TCDB | 1.A.1.10.5. voltage-gated ion channel (VIC) superfamily. |
PTM databases | |
| PhosphoSite | Q15858. |
Polymorphism databases | |
| DMDM | 55976302. |
Proteomic databases | |
| PaxDb | Q15858. |
| PRIDE | Q15858. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000409435; ENSP00000386330; ENSG00000169432. ENST00000409672; ENSP00000386306; ENSG00000169432. ENST00000454569; ENSP00000413212; ENSG00000169432. |
| GeneID | 6335. |
| KEGG | hsa:6335. |
Organism-specific databases | |
| CTD | 6335. |
| GeneCards | GC02M167051. |
| HGNC | HGNC:10597. SCN9A. |
| HPA | CAB013679. |
| MIM | 133020. phenotype. 167400. phenotype. 243000. phenotype. 603415. gene. 613863. phenotype. |
| neXtProt | NX_Q15858. |
| Orphanet | 88642. Channelopathy-associated congenital insensitivity to pain. 33069. Dravet syndrome. 1956. Erythromelalgia. 36387. Generalized epilepsy with febrile seizures-plus context. 46348. Paroxysmal extreme pain disorder. 90026. Primary erythermalgia. |
| PharmGKB | PA35010. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1226. |
| HOVERGEN | HBG053100. |
| KO | K04841. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | Q15858. |
| Bgee | Q15858. |
| CleanEx | HS_SCN9A. |
| Genevestigator | Q15858. |
| GermOnline | ENSG00000169432. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR024583. DUF3451. IPR005821. Ion_trans_dom. IPR000048. IQ_motif_EF-hand-BS. IPR001696. Na_channel_asu. IPR010526. Na_trans_assoc. [Graphical view] |
| Pfam | PF11933. DUF3451. 1 hit. PF00520. Ion_trans. 4 hits. PF06512. Na_trans_assoc. 1 hit. [Graphical view] |
| PRINTS | PR00170. NACHANNEL. |
| SMART | SM00015. IQ. 1 hit. [Graphical view] |
| PROSITE | PS50096. IQ. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q15858. |
| ChEMBL | CHEMBL4296. |
| DrugBank | DB00555. Lamotrigine. DB00281. Lidocaine. |
| GenomeRNAi | 6335. |
| NextBio | 24600. |
| SOURCE | Search... |
Entry information
| Entry name | SCN9A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15858 Secondary accession number(s): A1BUH5 Q8WWN4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |

Clusters with
