Reviewed,
UniProtKB/Swiss-Prot Q15788 (NCOA1_HUMAN)
Last modified
November 25, 2008.
Version 65.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Nuclear receptor coactivator 1 Short name=NCoA-1 EC=2.3.1.48 Alternative name(s): Steroid receptor coactivator 1 Short name=SRC-1 RIP160 Protein Hin-2 Renal carcinoma antigen NY-REN-52 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1441 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER), retinoids (RXRs), thyroid hormone (TRs) and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via remodeling of chromatin, and possibly acts by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3. |
| Catalytic activity | Acetyl-CoA + histone = CoA + acetylhistone. |
| Subunit structure | Interacts with the methyltransferase CARM1 By similarity. Interacts with NCOA6 and NCOA2. Interacts with the FDL motif of STAT5A and STAT5B. Interacts with the LXXLL motif of STAT6. Interacts with STAT3 following IL-6 stimulation. Interacts with the basal transcription factor GTF2B. Interacts with the histone acetyltransferases EP300 and CREBBP. Interacts with PCAF, COPS5, NR3C1 and TTLL5/STAMP. |
| Subcellular location | NucleusBy similarity. |
| Tissue specificity | Widely expressed. |
| Domain | The C-terminal (1107-1441) part mediates the histone acetyltransferase (HAT) activity. Contains 7 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. LXXLL motifs 3, 4 and 5 are essential for the association with nuclear receptors. LXXLL motif 7, which is not present in isoform 2, increases the affinity for steroid receptors in vitro. |
| Post-translational modification | Sumoylated; sumoylation increases its interaction with PGR and prolongs its retention in the nucleus. It does not prevent its ubiquitination and does not exert a clear effect on the stability of the protein. Ubiquitinated; leading to proteasome-mediated degradation. Ubiquitination and sumoylation take place at different sites. Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Involvement in disease | A chromosomal aberration involving NCOA1 is a cause of rhabdomyosarcoma. Translocation t(2;2)(q35;p23) with PAX3 generates the NCOA1-PAX3 oncogene consisting of the N-terminus part of PAX3 and the C-terminus part of NCOA1. The fusion protein acts as a transcriptional activator. Rhabdomyosarcoma is the most common soft tissue carcinoma in childhood, representing 5-8% of all malignancies in children. |
| Sequence similarities | Belongs to the SRC/p160 nuclear receptor coactivator family. Contains 1 basic helix-loop-helix (bHLH) domain. Contains 1 PAS (PER-ARNT-SIM) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Nfkb1 | P25799 | 1 | EBI-455189,EBI-643958 | From a different organism. |
| Nr3c1 | P06536 | 2 | EBI-455189,EBI-1187143 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15788-1) Also known as: SRC-1A; SRC1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15788-2) Also known as: SRC-1E; SRC1e; The sequence of this isoform differs from the canonical sequence as follows: 1386-1441: QVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE → DKKTEEFFSVVTTD | ||||||
| Notes: Major form. Contains a domain at its C-terminus (1241-1399) that is able to mediate transactivation. | ||||||
| Isoform 3 (identifier: Q15788-3) Also known as: SRC-1 (-Q); The sequence of this isoform differs from the canonical sequence as follows: 1385-1385: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1441 | 1441 | Nuclear receptor coactivator 1 | PRO_0000094400 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 21 – 81 | 61 | Helix-loop-helix motif | ||||||||||||||||||||||
| Domain | 109 – 180 | 72 | PAS | ||||||||||||||||||||||
| DNA binding | 17 – 20 | 4 | Basic motif | ||||||||||||||||||||||
| Region | 361 – 567 | 207 | Interaction with STAT3 | ||||||||||||||||||||||
| Region | 781 – 988 | 208 | Interaction with CREBBP | ||||||||||||||||||||||
| Motif | 46 – 50 | 5 | LXXLL motif 1 | ||||||||||||||||||||||
| Motif | 112 – 116 | 5 | LXXLL motif 2 | ||||||||||||||||||||||
| Motif | 633 – 637 | 5 | LXXLL motif 3 | ||||||||||||||||||||||
| Motif | 690 – 694 | 5 | LXXLL motif 4 | ||||||||||||||||||||||
| Motif | 749 – 753 | 5 | LXXLL motif 5 | ||||||||||||||||||||||
| Motif | 913 – 917 | 5 | LXXLL motif 6 | ||||||||||||||||||||||
| Motif | 1435 – 1439 | 5 | LXXLL motif 7 | ||||||||||||||||||||||
| Compositional bias | 389 – 682 | 294 | Ser-rich | ||||||||||||||||||||||
| Compositional bias | 1053 – 1138 | 86 | Gln-rich | ||||||||||||||||||||||
Sites | |||||||||||||||||||||||||
| Site | 867 – 868 | 2 | Breakpoint for translocation to form PAX3-NCOA1 oncogene | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 103 | 1 | Phosphoserine | ||||||||||||||||||||||
| Modified residue | 372 | 1 | Phosphoserine | ||||||||||||||||||||||
| Modified residue | 395 | 1 | Phosphoserine | ||||||||||||||||||||||
| Modified residue | 517 | 1 | Phosphoserine | ||||||||||||||||||||||
| Modified residue | 569 | 1 | Phosphoserine | ||||||||||||||||||||||
| Modified residue | 1033 | 1 | Phosphoserine | ||||||||||||||||||||||
| Modified residue | 1179 | 1 | Phosphothreonine | ||||||||||||||||||||||
| Modified residue | 1185 | 1 | Phosphoserine | ||||||||||||||||||||||
| Cross-link | 732 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | |||||||||||||||||||||||
| Cross-link | 774 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | |||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1385 | 1 | Missing in isoform 3. | VSP_011738 | |||||||||||||||||||||
| Alternative sequence | 1386 – 1441 | 56 | QVQQV…QLLTE → DKKTEEFFSVVTTD in isoform 2. | VSP_011739 | |||||||||||||||||||||
| Natural variant | 457 | 1 | Q → K: dbSNP rs1049015. | VAR_019768 | |||||||||||||||||||||
| Natural variant | 466 | 1 | N → K: dbSNP rs1049016. | VAR_019769 | |||||||||||||||||||||
| Natural variant | 474 | 1 | S → P: dbSNP rs1049018. | VAR_019770 | |||||||||||||||||||||
| Natural variant | 591 | 1 | I → T: dbSNP rs1049020. | VAR_019771 | |||||||||||||||||||||
| Natural variant | 685 | 1 | E → A: dbSNP rs1049021. | VAR_019772 | |||||||||||||||||||||
| Natural variant | 794 | 1 | P → A: dbSNP rs1049025. | VAR_019773 | |||||||||||||||||||||
| Natural variant | 999 | 1 | S → F: dbSNP rs1049032. | VAR_019774 | |||||||||||||||||||||
| Natural variant | 1154 | 1 | M → T: dbSNP rs1049038. | VAR_019775 | |||||||||||||||||||||
| Natural variant | 1238 | 1 | V → I | VAR_038832 | |||||||||||||||||||||
| Natural variant | 1272 | 1 | P → S: dbSNP rs1804645. | VAR_034882 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 636 – 637 | 2 | LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-693; A-694; A-752 and A-753 | ||||||||||||||||||||||
| Mutagenesis | 693 – 694 | 2 | LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-636; A-637; A-752 and A-753 | ||||||||||||||||||||||
| Mutagenesis | 732 | 1 | K → R: Abolishes sumoylation; when associated with R-774 | ||||||||||||||||||||||
| Mutagenesis | 752 – 753 | 2 | LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-636; A-637; A-693 and A-694 | ||||||||||||||||||||||
| Mutagenesis | 774 | 1 | K → R: Abolishes sumoylation; when associated with R-732 | ||||||||||||||||||||||
| Mutagenesis | 800 | 1 | K → R: Does not affect sumoylation of the protein | ||||||||||||||||||||||
| Mutagenesis | 846 | 1 | K → R: Does not affect sumoylation of the protein | ||||||||||||||||||||||
| Mutagenesis | 1378 | 1 | K → R: Does not affect sumoylation of the protein | ||||||||||||||||||||||
| Sequence conflict | 1035 | 1 | Missing in AAT47737. Ref.10 | ||||||||||||||||||||||
| Sequence conflict | 1370 | 1 | Q → H in AAA64187. Ref.9 | ||||||||||||||||||||||
| Sequence conflict | 1382 | 1 | D → G in AAT47737. Ref.10 | ||||||||||||||||||||||
| Sequence conflict | 1435 | 1 | L → R in AAB50242. Ref.3 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Helix | 688 – 694 | 7 | |||||||||||||||||||||||
| Turn | 924 – 926 | 3 | |||||||||||||||||||||||
| Helix | 929 – 941 | 13 | |||||||||||||||||||||||
| Helix | 945 – 947 | 3 | |||||||||||||||||||||||
| Helix | 952 – 954 | 3 | |||||||||||||||||||||||
| Turn | 958 – 962 | 5 | |||||||||||||||||||||||
| Beta strand | 964 – 966 | 3 | |||||||||||||||||||||||
| Helix | 1434 – 1440 | 7 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator." Takeshita A., Yen P.M., Misiti S., Cardona G.R., Liu Y., Chin W.W. Endocrinology 137:3594-3597(1996) [PubMed: 8754792] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH GTF2B, VARIANTS LYS-457; LYS-466; PRO-474; THR-591; ALA-685; PHE-999 AND THR-1154. |
| [2] | "Isoforms of steroid receptor coactivator 1 differ in their ability to potentiate transcription by the oestrogen receptor." Kalkhoven E., Valentine J.E., Heery D.M., Parker M.G. EMBO J. 17:232-243(1998) [PubMed: 9427757] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, MUTAGENESIS OF 636-LEU-LEU-637; 693-LEU-LEU-694 AND 752-LEU-LEU-753. |
| [3] | "The steroid receptor coactivator-1 contains multiple receptor interacting and activation domains that cooperatively enhance the activation function 1 (AF1) and AF2 domains of steroid receptors." Onate S.A., Boonyaratanakornkit V., Spencer T.E., Tsai S.Y., Tsai M.-J., Edwards D.P., O'Malley B.W. J. Biol. Chem. 273:12101-12108(1998) [PubMed: 9575154] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS LYS-457; LYS-466; PRO-474; THR-591; ALA-685; PHE-999 AND THR-1154. Tissue: Heart muscle and Skeletal muscle. |
| [4] | SeattleSNPs program for genomic applications Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-1238 AND SER-1272. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." |

Clusters with