Reviewed,
UniProtKB/Swiss-Prot Q15788 (NCOA1_HUMAN)
Last modified
June 16, 2009.
Version 73.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Nuclear receptor coactivator 1 Short name=NCoA-1 EC=2.3.1.48 Alternative name(s): Steroid receptor coactivator 1 Short name=SRC-1 RIP160 Protein Hin-2 Renal carcinoma antigen NY-REN-52 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1441 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER), retinoids (RXRs), thyroid hormone (TRs) and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via remodeling of chromatin, and possibly acts by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3. Ref.2 Ref.8 Ref.11 Ref.12 Ref.13 Ref.16 Ref.23 |
| Catalytic activity | Acetyl-CoA + histone = CoA + acetylhistone. |
| Subunit structure | Interacts with the methyltransferase CARM1 By similarity. Interacts with NCOA6 and NCOA2. Interacts with the FDL motif of STAT5A and STAT5B. Interacts with the LXXLL motif of STAT6. Interacts with STAT3 following IL-6 stimulation. Interacts with the basal transcription factor GTF2B. Interacts with the histone acetyltransferases EP300 and CREBBP. Interacts with PCAF, COPS5, NR3C1 and TTLL5/STAMP. |
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | |
| Domain | The C-terminal (1107-1441) part mediates the histone acetyltransferase (HAT) activity. Contains 7 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. LXXLL motifs 3, 4 and 5 are essential for the association with nuclear receptors. LXXLL motif 7, which is not present in isoform 2, increases the affinity for steroid receptors in vitro. |
| Post-translational modification | Sumoylated; sumoylation increases its interaction with PGR and prolongs its retention in the nucleus. It does not prevent its ubiquitination and does not exert a clear effect on the stability of the protein. Ref.22 Ubiquitinated; leading to proteasome-mediated degradation. Ubiquitination and sumoylation take place at different sites. Ref.22 Phosphorylated upon DNA damage, probably by ATM or ATR. Ref.17 Ref.26 |
| Involvement in disease | A chromosomal aberration involving NCOA1 is a cause of rhabdomyosarcoma. Translocation t(2;2)(q35;p23) with PAX3 generates the NCOA1-PAX3 oncogene consisting of the N-terminus part of PAX3 and the C-terminus part of NCOA1. The fusion protein acts as a transcriptional activator. Rhabdomyosarcoma is the most common soft tissue carcinoma in childhood, representing 5-8% of all malignancies in children. |
| Sequence similarities | Belongs to the SRC/p160 nuclear receptor coactivator family. Contains 1 basic helix-loop-helix (bHLH) domain. Contains 1 PAS (PER-ARNT-SIM) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Nfkb1 | P25799 | 1 | EBI-455189,EBI-643958 | From a different organism. |
| Nr3c1 | P06536 | 2 | EBI-455189,EBI-1187143 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15788-1) Also known as: SRC-1A; SRC1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15788-2) Also known as: SRC-1E; SRC1e; The sequence of this isoform differs from the canonical sequence as follows: 1386-1441: QVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE → DKKTEEFFSVVTTD | ||||||
| Note: Major form. Contains a domain at its C-terminus (1241-1399) that is able to mediate transactivation. | ||||||
| Isoform 3 (identifier: Q15788-3) Also known as: SRC-1 (-Q); The sequence of this isoform differs from the canonical sequence as follows: 1385-1385: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1441 | 1441 | Nuclear receptor coactivator 1 | PRO_0000094400 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 21 – 81 | 61 | Helix-loop-helix motif | ||||||||||||||||||||||
| Domain | 109 – 180 | 72 | PAS | ||||||||||||||||||||||
| DNA binding | 17 – 20 | 4 | Basic motif | ||||||||||||||||||||||
| Region | 361 – 567 | 207 | Interaction with STAT3 | ||||||||||||||||||||||
| Region | 781 – 988 | 208 | Interaction with CREBBP | ||||||||||||||||||||||
| Motif | 46 – 50 | 5 | LXXLL motif 1 | ||||||||||||||||||||||
| Motif | 112 – 116 | 5 | LXXLL motif 2 | ||||||||||||||||||||||
| Motif | 633 – 637 | 5 | LXXLL motif 3 | ||||||||||||||||||||||
| Motif | 690 – 694 | 5 | LXXLL motif 4 | ||||||||||||||||||||||
| Motif | 749 – 753 | 5 | LXXLL motif 5 | ||||||||||||||||||||||
| Motif | 913 – 917 | 5 | LXXLL motif 6 | ||||||||||||||||||||||
| Motif | 1435 – 1439 | 5 | LXXLL motif 7 | ||||||||||||||||||||||
| Compositional bias | 389 – 682 | 294 | Ser-rich | ||||||||||||||||||||||
| Compositional bias | 1053 – 1138 | 86 | Gln-rich | ||||||||||||||||||||||
Sites | |||||||||||||||||||||||||
| Site | 867 – 868 | 2 | Breakpoint for translocation to form PAX3-NCOA1 oncogene | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 22 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||
| Modified residue | 103 | 1 | Phosphoserine Ref.26 | ||||||||||||||||||||||
| Modified residue | 372 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||
| Modified residue | 395 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||
| Modified residue | 517 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||
| Modified residue | 569 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||
| Modified residue | 1033 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||
| Modified residue | 1179 | 1 | Phosphothreonine Ref.17 | ||||||||||||||||||||||
| Modified residue | 1185 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||
| Cross-link | 732 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.22 | |||||||||||||||||||||||
| Cross-link | 774 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.22 | |||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1385 | 1 | Missing in isoform 3. | VSP_011738 | |||||||||||||||||||||
| Alternative sequence | 1386 – 1441 | 56 | QVQQV…QLLTE → DKKTEEFFSVVTTD in isoform 2. | VSP_011739 | |||||||||||||||||||||
| Natural variant | 457 | 1 | Q → K: dbSNP rs1049015. Ref.8 Ref.1 Ref.3 | VAR_019768 | |||||||||||||||||||||
| Natural variant | 466 | 1 | N → K: dbSNP rs1049016. Ref.8 Ref.1 Ref.3 | VAR_019769 | |||||||||||||||||||||
| Natural variant | 474 | 1 | S → P: dbSNP rs1049018. Ref.8 Ref.1 Ref.3 | VAR_019770 | |||||||||||||||||||||
| Natural variant | 591 | 1 | I → T: dbSNP rs1049020. Ref.8 Ref.1 Ref.3 | VAR_019771 | |||||||||||||||||||||
| Natural variant | 685 | 1 | E → A: dbSNP rs1049021. Ref.8 Ref.1 Ref.3 | VAR_019772 | |||||||||||||||||||||
| Natural variant | 794 | 1 | P → A: dbSNP rs1049025. Ref.8 | VAR_019773 | |||||||||||||||||||||
| Natural variant | 999 | 1 | S → F: dbSNP rs1049032. Ref.8 Ref.1 Ref.3 | VAR_019774 | |||||||||||||||||||||
| Natural variant | 1154 | 1 | M → T: dbSNP rs1049038. Ref.8 Ref.1 Ref.3 | VAR_019775 | |||||||||||||||||||||
| Natural variant | 1238 | 1 | V → I Ref.4 | VAR_038832 | |||||||||||||||||||||
| Natural variant | 1272 | 1 | P → S: dbSNP rs1804645. Ref.4 | VAR_034882 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 636 – 637 | 2 | LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-693; A-694; A-752 and A-753. Ref.2 | ||||||||||||||||||||||
| Mutagenesis | 693 – 694 | 2 | LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-636; A-637; A-752 and A-753. Ref.2 | ||||||||||||||||||||||
| Mutagenesis | 732 | 1 | K → R: Abolishes sumoylation; when associated with R-774. Ref.2 Ref.22 | ||||||||||||||||||||||
| Mutagenesis | 752 – 753 | 2 | LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-636; A-637; A-693 and A-694. Ref.2 | ||||||||||||||||||||||
| Mutagenesis | 774 | 1 | K → R: Abolishes sumoylation; when associated with R-732. Ref.2 Ref.22 | ||||||||||||||||||||||
| Mutagenesis | 800 | 1 | K → R: Does not affect sumoylation of the protein. Ref.2 Ref.22 | ||||||||||||||||||||||
| Mutagenesis | 846 | 1 | K → R: Does not affect sumoylation of the protein. Ref.2 Ref.22 | ||||||||||||||||||||||
| Mutagenesis | 1378 | 1 | K → R: Does not affect sumoylation of the protein. Ref.2 Ref.22 | ||||||||||||||||||||||
| Sequence conflict | 1035 | 1 | Missing in AAT47737. Ref.10 | ||||||||||||||||||||||
| Sequence conflict | 1370 | 1 | Q → H in AAA64187. Ref.9 | ||||||||||||||||||||||
| Sequence conflict | 1382 | 1 | D → G in AAT47737. Ref.10 | ||||||||||||||||||||||
| Sequence conflict | 1435 | 1 | L → R in AAB50242. Ref.3 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Helix | 688 – 694 | 7 | |||||||||||||||||||||||
| Turn | 924 – 926 | 3 | |||||||||||||||||||||||
| Helix | 929 – 941 | 13 | |||||||||||||||||||||||
| Helix | 945 – 947 | 3 | |||||||||||||||||||||||
| Helix | 952 – 954 | 3 | |||||||||||||||||||||||
| Turn | 958 – 962 | 5 | |||||||||||||||||||||||
| Beta strand | 964 – 966 | 3 | |||||||||||||||||||||||
| Helix | 1434 – 1440 | 7 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator." Takeshita A., Yen P.M., Misiti S., Cardona G.R., Liu Y., Chin W.W. Endocrinology 137:3594-3597(1996) [PubMed: 8754792] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH GTF2B, VARIANTS LYS-457; LYS-466; PRO-474; THR-591; ALA-685; PHE-999 AND THR-1154. |
| [2] | "Isoforms of steroid receptor coactivator 1 differ in their ability to potentiate transcription by the oestrogen receptor." Kalkhoven E., Valentine J.E., Heery D.M., Parker M.G. EMBO J. 17:232-243(1998) [PubMed: 9427757] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, MUTAGENESIS OF 636-LEU-LEU-637; 693-LEU-LEU-694 AND 752-LEU-LEU-753. |
| [3] | "The steroid receptor coactivator-1 contains multiple receptor interacting and activation domains that cooperatively enhance the activation function 1 (AF1) and AF2 domains of steroid receptors." Onate S.A., Boonyaratanakornkit V., Spencer T.E., Tsai S.Y., Tsai M.-J., Edwards D.P., O'Malley B.W. J. Biol. Chem. 273:12101-12108(1998) [PubMed: 9575154] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS LYS-457; LYS-466; PRO-474; THR-591; ALA-685; PHE-999 AND THR-1154. Tissue: Heart muscle and Skeletal muscle. |
| [4] | SeattleSNPs variation discovery resource Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-1238 AND SER-1272. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). |
| [8] | "Sequence and characterization of a coactivator for the steroid hormone receptor superfamily." Onate S.A., Tsai S.Y., Tsai M.-J., O'Malley B.W. Science 270:1354-1357(1995) [PubMed: 7481822] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 363-1441 (ISOFORM 1), FUNCTION, INTERACTION WITH ESR1; RXRA; GCCR; PGR AND THRA, VARIANTS LYS-457; LYS-466; PRO-474; THR-591; ALA-685; ALA-794; PHE-999 AND THR-1154. |
| [9] | "Analysis of human immunodeficiency virus type 1 promoter insertion in vivo." Raineri I., Soler M., Senn H.-P. Virology 208:359-364(1995) [PubMed: 11831720] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 865-1441 (ISOFORM 2). |
| [10] | "Gene expression signatures identify rhabdomyosarcoma subtypes and detect a novel t(2;2)(q35;p23) translocation fusing PAX3 to NCOA1." Wachtel M., Dettling M., Koscielniak E., Stegmaier S., Treuner J., Simon-Klingenstein K., Buehlmann P., Niggli F.K., Schaefer B.W. Cancer Res. 64:5539-5545(2004) [PubMed: 15313887] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 868-1441 (ISOFORM 2), CHROMOSOMAL TRANSLOCATION WITH PAX3, TISSUE SPECIFICITY. |
| [11] | "A splicing variant of steroid receptor coactivator-1 (SRC-1E): the major isoform of SRC-1 to mediate thyroid hormone action." Hayashi Y., Ohmori S., Ito T., Seo H. Biochem. Biophys. Res. Commun. 236:83-87(1997) [PubMed: 9223431] [Abstract] Cited for: IDENTIFICATION OF ISOFORM 2, FUNCTION, ALTERNATIVE SPLICING. |
| [12] | "Steroid receptor coactivator-1 is a histone acetyltransferase." Spencer T.E., Jenster G., Burcin M.M., Allis C.D., Zhou J., Mizzen C.A., McKenna N.J., Onate S.A., Tsai S.Y., Tsai M.-J., O'Malley B.W. Nature 389:194-198(1997) [PubMed: 9296499] [Abstract] Cited for: FUNCTION AS A HISTONE ACETYLTRANSFERASE, INTERACTION WITH PCAF. |
| [13] | "Steroid receptor induction of gene transcription: a two-step model." Jenster G., Spencer T.E., Burcin M.M., Tsai S.Y., Tsai M.-J., O'Malley B.W. Proc. Natl. Acad. Sci. U.S.A. 94:7879-7884(1997) [PubMed: 9223281] [Abstract] Cited for: FUNCTION. |
| [14] | "Antigens recognized by autologous antibody in patients with renal-cell carcinoma." Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999) [PubMed: 10508479] [Abstract] Cited for: IDENTIFICATION AS A RENAL CANCER ANTIGEN. Tissue: Renal cell carcinoma. |
| [15] | "A nuclear factor ASC-2, as a cancer-amplified transcriptional coactivator essential for ligand-dependent transactivation by nuclear receptors in vivo." Lee S.-K., Anzick S.L., Choi J.-E., Bubendorf L., Guan X.-Y., Jung Y.-K., Kallioniemi O.-P., Kononen J., Trent J.M., Azorsa D., Jhun B.-H., Cheong J.H., Lee Y.C., Meltzer P.S., Lee J.W. J. Biol. Chem. 274:34283-34293(1999) [PubMed: 10567404] [Abstract] Cited for: INTERACTION WITH NCOA6. |
| [16] | "Steroid receptor coactivator-1 (SRC-1) enhances ligand-dependent and receptor-dependent cell-free transcription of chromatin." Liu Z., Wong J., Tsai S.Y., Tsai M.-J., O'Malley B.W. Proc. Natl. Acad. Sci. U.S.A. 96:9485-9490(1999) [PubMed: 10449719] [Abstract] Cited for: FUNCTION. |
| [17] | "Phosphorylation of steroid receptor coactivator-1. Identification of the phosphorylation sites and phosphorylation through the mitogen-activated protein kinase pathway." Rowan B.G., Weigel N.L., O'Malley B.W. J. Biol. Chem. 275:4475-4483(2000) [PubMed: 10660621] [Abstract] Cited for: PHOSPHORYLATION AT SER-372; SER-395; SER-517; SER-569; SER-1033; THR-1179 AND SER-1185. |
| [18] | "JAB1 interacts with both the progesterone receptor and SRC-1." Chauchereau A., Georgiakaki M., Perrin-Wolff M., Milgrom E., Loosfelt H. J. Biol. Chem. 275:8540-8548(2000) [PubMed: 10722692] [Abstract] Cited for: INTERACTION WITH COPS5. |
| [19] | "Redox-regulated recruitment of the transcriptional coactivators CREB-binding protein and SRC-1 to hypoxia-inducible factor 1alpha." Carrero P., Okamoto K., Coumailleau P., O'Brien S., Tanaka H., Poellinger L. Mol. Cell. Biol. 20:402-415(2000) [PubMed: 10594042] [Abstract] Cited for: INTERACTION WITH NCOA2. |
| [20] | "Functional interaction of STAT3 transcription factor with the coactivator NcoA/SRC1a." Giraud S., Bienvenu F., Avril S., Gascan H., Heery D.M., Coqueret O. J. Biol. Chem. 277:8004-8011(2002) [PubMed: 11773079] [Abstract] Cited for: INTERACTION WITH STAT3. |
| [21] | "An LXXLL motif in the transactivation domain of STAT6 mediates recruitment of NCoA-1/SRC-1." Litterst C.M., Pfitzner E. J. Biol. Chem. 277:36052-36060(2002) [PubMed: 12138096] [Abstract] Cited for: INTERACTION WITH STAT6. |
| [22] | "Sumoylation of the progesterone receptor and of the steroid receptor coactivator SRC-1." Chauchereau A., Amazit L., Quesne M., Guiochon-Mantel A., Milgrom E. J. Biol. Chem. 278:12335-12343(2003) [PubMed: 12529333] [Abstract] Cited for: SUMOYLATION AT LYS-732 AND LYS-774, UBIQUITINATION, MUTAGENESIS OF LYS-732; LYS-774; LYS-800; LYS-846 AND LYS-1378. |
| [23] | "NCoA-1/SRC-1 is an essential coactivator of STAT5 that binds to the FDL motif in the alpha-helical region of the STAT5 transactivation domain." Litterst C.M., Kliem S., Marilley D., Pfitzner E. J. Biol. Chem. 278:45340-45351(2003) [PubMed: 12954634] [Abstract] Cited for: FUNCTION, INTERACTION WITH STAT5A AND STAT5B. |
| [24] | "BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation." Hsiao P.W., Fryer C.J., Trotter K.W., Wang W., Archer T.K. Mol. Cell. Biol. 23:6210-6220(2003) [PubMed: 12917342] [Abstract] Cited for: INTERACTION WITH NR3C1. |
| [25] | "STAMP, a novel predicted factor assisting TIF2 actions in glucocorticoid receptor-mediated induction and repression." He Y., Simons S.S. Jr. Mol. Cell. Biol. 27:1467-1485(2007) [PubMed: 17116691] [Abstract] Cited for: INTERACTION WITH TTLL5. Tissue: Testis. |
| [26] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-103, MASS SPECTROMETRY. |
| [27] | "Ligand binding and co-activator assembly of the peroxisome proliferator-activated receptor-gamma." Nolte R.T., Wisely G.B., Westin S., Cobb J.E., Lambert M.H., Kurokawa R., Rosenfeld M.G., Willson T.M., Glass C.K., Milburn M.V. Nature 395:137-143(1998) [PubMed: 9744270] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 623-710 IN COMPLEX WITH PPARG. |
| [28] | "Structural determinants of ligand binding selectivity between the peroxisome proliferator-activated receptors." Xu H.E., Lambert M.H., Montana V.G., Plunket K.D., Moore L.B., Collins J.L., Oplinger J.A., Kliewer S.A., Gampe R.T. Jr., McKee D.D., Moore J.T., Willson T.M. Proc. Natl. Acad. Sci. U.S.A. 98:13919-13924(2001) [PubMed: 11698662] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 687-696 IN COMPLEX WITH PPARA. |
| [29] | "Structural and functional evidence for ligand-independent transcriptional activation by the estrogen-related receptor 3." Greschik H., Wurtz J.-M., Sanglier S., Bourguet W., van Dorsselaer A., Moras D., Renaud J.-P. Mol. Cell 9:303-313(2002) [PubMed: 11864604] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 686-700 IN COMPLEX WITH ESRRG. |
| [30] | "Structure of the NCoA-1/SRC-1 PAS-B domain bound to the LXXLL motif of the STAT6 transactivation domain." Razeto A., Ramakrishnan V., Litterst C.M., Giller K., Griesinger C., Carlomagno T., Lakomek N., Heimburg T., Lodrini M., Pfitzner E., Becker S. J. Mol. Biol. 336:319-329(2004) [PubMed: 14757047] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 257-385 IN COMPLEX WITH 795-808 OF STAT6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U59302 mRNA. Translation: AAC50631.1. AJ000881 mRNA. Translation: CAA04371.1. AJ000882 mRNA. Translation: CAA04372.1. U90661 mRNA. Translation: AAB50242.1. EF660499 Genomic DNA. Translation: ABS29266.1. AC013459 Genomic DNA. Translation: AAX93184.1. CH471053 Genomic DNA. Translation: EAX00746.1. BC111533 mRNA. Translation: AAI11534.1. BC111534 mRNA. Translation: AAI11535.1. U40396 mRNA. Translation: AAC50305.1. Different initiation. U19179 mRNA. Translation: AAA64187.1. Different initiation. AY633656 mRNA. Translation: AAT47737.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00470490. IPI00470491. IPI00470492. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A57620. PC4363. PC4364. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_003734.3. NP_671756.1. NP_671766.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.596314 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q15788. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q15788. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q15788. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000084676. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 8648. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:8648. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC02P024568. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7668. NCOA1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB019402. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602691. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA31470. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q15788. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | Q15788. RFPPQQA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.3.1.48. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | hif1_tfpathway. HIF-1-alpha transcription factor network. ar_tf_pathway. Regulation of Androgen receptor activity. smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. retinoic_acid_pathway. Retinoic acid receptors-mediated signaling. rxr_vdr_pathway. RXR and RAR hetrodimerization with other nuclear receptor. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q15788. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q15788. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000084676. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR010011. DUF1518. IPR001092. HLH_basic. IPR011598. HLH_DNA_bd. IPR014920. Nuc_rcpt_coact_Ncoa-typ. IPR017426. Nuclear_rcpt_coactivator. IPR000014. PAS. IPR013767. PAS_fold. IPR014935. SRC-1. IPR008955. Src1_rcpt_coact. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:4.10.280.10. HLH_DNA_bd. 1 hit. G3DSA:4.10.630.10. Src1_rcpt_coact. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF07469. DUF1518. 2 hits. PF00010. HLH. 1 hit. PF08815. Nuc_rec_co-act. 1 hit. PF00989. PAS. 1 hit. PF08832. SRC-1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF038181. Nuclear_receptor_coactivator. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00353. HLH. 1 hit. SM00091. PAS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50888. HLH. 1 hit. PS50112. PAS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 32423. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | NCOA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15788 Secondary accession number(s): O00150 Q7KYV3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


