Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15777 (MPPD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Metallophosphoesterase MPPED2

EC=3.1.-.-
Alternative name(s):
Fetal brain protein 239
Short name=239FB
Metallophosphoesterase domain-containing protein 2
Gene names
Name:MPPED2
Synonyms:C11orf8, FAM1B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length294 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system By similarity.

Cofactor

Manganese or cobalt By similarity.

Subunit structure

Homodimer By similarity.

Tissue specificity

Expressed predominantly in fetal brain.

Sequence similarities

Belongs to the UPF0046 family.

Sequence caution

The sequence BAD92400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandCobalt
Manganese
Metal-binding
   Molecular functionHydrolase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processnervous system development

Traceable author statement Ref.1. Source: ProtInc

   Molecular_functionhydrolase activity

Inferred from electronic annotation. Source: UniProtKB-KW

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q15777-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q15777-2)

The sequence of this isoform differs from the canonical sequence as follows:
     256-294: GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS → VNPVSISKALRTKICSLPSKTS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 294294Metallophosphoesterase MPPED2
PRO_0000053405

Natural variations

Alternative sequence256 – 29439GYGIM…NPQGS → VNPVSISKALRTKICSLPSK TS in isoform 2.
VSP_045627
Natural variant671H → R.
Corresponds to variant rs11556749 [ dbSNP | Ensembl ].
VAR_052487

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 43B2BC0DA1BFD1F0

FASTA29433,360
        10         20         30         40         50         60 
MAHGIPSQGK VTITVDEYSS NPTQAFTHYN INQSRFQPPH VHMVDPIPYD TPKPAGHTRF 

        70         80         90        100        110        120 
VCISDTHSRT DGIQMPYGDI LLHTGDFTEL GLPSEVKKFN DWLGNLPYEY KIVIAGNHEL 

       130        140        150        160        170        180 
TFDKEFMADL VKQDYYRFPS VSKLKPEDFD NVQSLLTNSI YLQDSEVTVK GFRIYGAPWT 

       190        200        210        220        230        240 
PWFNGWGFNL PRGQSLLDKW NLIPEGIDIL MTHGPPLGFR DWVPKELQRV GCVELLNTVQ 

       250        260        270        280        290 
RRVRPKLHVF GGIHEGYGIM TDGYTTYINA STCTVSFQPT NPPIIFDLPN PQGS 

« Hide

Isoform 2 [UniParc].

Checksum: 13B81CC3F8CB96CF
Show »

FASTA27731,507

References

« Hide 'large scale' references
[1]"A WAGR region gene between PAX-6 and FSHB expressed in fetal brain."
Schwartz F., Neve R., Eisenman R., Gessler M., Bruns G.
Hum. Genet. 94:658-664(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region."
Schwartz F., Eisenman R., Knoll J., Gessler M., Bruns G.
Genomics 29:526-532(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Homo sapiens protein coding cDNA."
Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[4]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Colon, Kidney and Stomach.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U57911 mRNA. Translation: AAC50564.1.
AB209163 mRNA. Translation: BAD92400.1. Different initiation.
AL136088 Genomic DNA. No translation available.
AL353699 Genomic DNA. No translation available.
AL356240 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68256.1.
CH471064 Genomic DNA. Translation: EAW68257.1.
BC031582 mRNA. Translation: AAH31582.1.
CCDSCCDS44560.1. [Q15777-2]
CCDS7870.1. [Q15777-1]
RefSeqNP_001138871.1. NM_001145399.1. [Q15777-2]
NP_001575.1. NM_001584.2. [Q15777-1]
XP_005253167.1. XM_005253110.1. [Q15777-1]
XP_005253168.1. XM_005253111.2. [Q15777-1]
XP_005253169.1. XM_005253112.1. [Q15777-1]
UniGeneHs.289795.

3D structure databases

ProteinModelPortalQ15777.
SMRQ15777. Positions 11-291.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107202. 1 interaction.
IntActQ15777. 2 interactions.
STRING9606.ENSP00000350833.

PTM databases

PhosphoSiteQ15777.

Polymorphism databases

DMDM3023214.

Proteomic databases

MaxQBQ15777.
PaxDbQ15777.
PRIDEQ15777.

Protocols and materials databases

DNASU744.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000358117; ENSP00000350833; ENSG00000066382. [Q15777-1]
ENST00000448418; ENSP00000388258; ENSG00000066382. [Q15777-2]
GeneID744.
KEGGhsa:744.
UCSCuc001msr.3. human. [Q15777-1]

Organism-specific databases

CTD744.
GeneCardsGC11M030389.
HGNCHGNC:1180. MPPED2.
HPAHPA039265.
MIM600911. gene.
neXtProtNX_Q15777.
PharmGKBPA25499.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG72373.
HOGENOMHOG000023302.
HOVERGENHBG000008.
InParanoidQ15777.
OMAELVKQDY.
OrthoDBEOG7G4QFH.
PhylomeDBQ15777.
TreeFamTF314305.

Gene expression databases

ArrayExpressQ15777.
BgeeQ15777.
CleanExHS_MPPED2.
GenevestigatorQ15777.

Family and domain databases

Gene3D3.60.21.10. 2 hits.
InterProIPR024201. Calcineurin-like_Pesterase.
IPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
[Graphical view]
PfamPF00149. Metallophos. 1 hit.
[Graphical view]
PIRSFPIRSF035808. Pdiesterase_Brain_239. 1 hit.
SUPFAMSSF56300. SSF56300. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi744.
NextBio3012.
PROQ15777.
SOURCESearch...

Entry information

Entry nameMPPD2_HUMAN
AccessionPrimary (citable) accession number: Q15777
Secondary accession number(s): D3DQZ5, E9PB10, Q59GE6
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Uncharacterized protein families (UPF)

List of uncharacterized protein family (UPF) entries

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM