Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q15777

- MPPD2_HUMAN

UniProt

Q15777 - MPPD2_HUMAN

Protein

Metallophosphoesterase MPPED2

Gene

MPPED2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system By similarity.By similarity

    Cofactori

    Manganese or cobalt.By similarity

    GO - Molecular functioni

    1. hydrolase activity Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. nervous system development Source: ProtInc

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    Cobalt, Manganese, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Metallophosphoesterase MPPED2 (EC:3.1.-.-)
    Alternative name(s):
    Fetal brain protein 239
    Short name:
    239FB
    Metallophosphoesterase domain-containing protein 2
    Gene namesi
    Name:MPPED2
    Synonyms:C11orf8, FAM1B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:1180. MPPED2.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25499.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 294294Metallophosphoesterase MPPED2PRO_0000053405Add
    BLAST

    Proteomic databases

    MaxQBiQ15777.
    PaxDbiQ15777.
    PRIDEiQ15777.

    PTM databases

    PhosphoSiteiQ15777.

    Expressioni

    Tissue specificityi

    Expressed predominantly in fetal brain.

    Gene expression databases

    ArrayExpressiQ15777.
    BgeeiQ15777.
    CleanExiHS_MPPED2.
    GenevestigatoriQ15777.

    Organism-specific databases

    HPAiHPA039265.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Protein-protein interaction databases

    BioGridi107202. 1 interaction.
    IntActiQ15777. 2 interactions.
    STRINGi9606.ENSP00000350833.

    Structurei

    3D structure databases

    ProteinModelPortaliQ15777.
    SMRiQ15777. Positions 11-291.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the UPF0046 family.Curated

    Phylogenomic databases

    eggNOGiNOG72373.
    HOGENOMiHOG000023302.
    HOVERGENiHBG000008.
    InParanoidiQ15777.
    OMAiELVKQDY.
    OrthoDBiEOG7G4QFH.
    PhylomeDBiQ15777.
    TreeFamiTF314305.

    Family and domain databases

    Gene3Di3.60.21.10. 2 hits.
    InterProiIPR024201. Calcineurin-like_Pesterase.
    IPR004843. Calcineurin-like_PHP_apaH.
    IPR029052. Metallo-depent_PP-like.
    [Graphical view]
    PfamiPF00149. Metallophos. 1 hit.
    [Graphical view]
    PIRSFiPIRSF035808. Pdiesterase_Brain_239. 1 hit.
    SUPFAMiSSF56300. SSF56300. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q15777-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAHGIPSQGK VTITVDEYSS NPTQAFTHYN INQSRFQPPH VHMVDPIPYD    50
    TPKPAGHTRF VCISDTHSRT DGIQMPYGDI LLHTGDFTEL GLPSEVKKFN 100
    DWLGNLPYEY KIVIAGNHEL TFDKEFMADL VKQDYYRFPS VSKLKPEDFD 150
    NVQSLLTNSI YLQDSEVTVK GFRIYGAPWT PWFNGWGFNL PRGQSLLDKW 200
    NLIPEGIDIL MTHGPPLGFR DWVPKELQRV GCVELLNTVQ RRVRPKLHVF 250
    GGIHEGYGIM TDGYTTYINA STCTVSFQPT NPPIIFDLPN PQGS 294
    Length:294
    Mass (Da):33,360
    Last modified:November 1, 1996 - v1
    Checksum:i43B2BC0DA1BFD1F0
    GO
    Isoform 2 (identifier: Q15777-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         256-294: GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS → VNPVSISKALRTKICSLPSKTS

    Note: No experimental confirmation available.

    Show »
    Length:277
    Mass (Da):31,507
    Checksum:i13B81CC3F8CB96CF
    GO

    Sequence cautioni

    The sequence BAD92400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti67 – 671H → R.
    Corresponds to variant rs11556749 [ dbSNP | Ensembl ].
    VAR_052487

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei256 – 29439GYGIM…NPQGS → VNPVSISKALRTKICSLPSK TS in isoform 2. 1 PublicationVSP_045627Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U57911 mRNA. Translation: AAC50564.1.
    AB209163 mRNA. Translation: BAD92400.1. Different initiation.
    AL136088 Genomic DNA. No translation available.
    AL353699 Genomic DNA. No translation available.
    AL356240 Genomic DNA. No translation available.
    CH471064 Genomic DNA. Translation: EAW68256.1.
    CH471064 Genomic DNA. Translation: EAW68257.1.
    BC031582 mRNA. Translation: AAH31582.1.
    CCDSiCCDS44560.1. [Q15777-2]
    CCDS7870.1. [Q15777-1]
    RefSeqiNP_001138871.1. NM_001145399.1. [Q15777-2]
    NP_001575.1. NM_001584.2. [Q15777-1]
    XP_005253167.1. XM_005253110.1. [Q15777-1]
    XP_005253168.1. XM_005253111.2. [Q15777-1]
    XP_005253169.1. XM_005253112.1. [Q15777-1]
    UniGeneiHs.289795.

    Genome annotation databases

    EnsembliENST00000358117; ENSP00000350833; ENSG00000066382. [Q15777-1]
    ENST00000448418; ENSP00000388258; ENSG00000066382. [Q15777-2]
    GeneIDi744.
    KEGGihsa:744.
    UCSCiuc001msr.3. human. [Q15777-1]

    Polymorphism databases

    DMDMi3023214.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U57911 mRNA. Translation: AAC50564.1 .
    AB209163 mRNA. Translation: BAD92400.1 . Different initiation.
    AL136088 Genomic DNA. No translation available.
    AL353699 Genomic DNA. No translation available.
    AL356240 Genomic DNA. No translation available.
    CH471064 Genomic DNA. Translation: EAW68256.1 .
    CH471064 Genomic DNA. Translation: EAW68257.1 .
    BC031582 mRNA. Translation: AAH31582.1 .
    CCDSi CCDS44560.1. [Q15777-2 ]
    CCDS7870.1. [Q15777-1 ]
    RefSeqi NP_001138871.1. NM_001145399.1. [Q15777-2 ]
    NP_001575.1. NM_001584.2. [Q15777-1 ]
    XP_005253167.1. XM_005253110.1. [Q15777-1 ]
    XP_005253168.1. XM_005253111.2. [Q15777-1 ]
    XP_005253169.1. XM_005253112.1. [Q15777-1 ]
    UniGenei Hs.289795.

    3D structure databases

    ProteinModelPortali Q15777.
    SMRi Q15777. Positions 11-291.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107202. 1 interaction.
    IntActi Q15777. 2 interactions.
    STRINGi 9606.ENSP00000350833.

    PTM databases

    PhosphoSitei Q15777.

    Polymorphism databases

    DMDMi 3023214.

    Proteomic databases

    MaxQBi Q15777.
    PaxDbi Q15777.
    PRIDEi Q15777.

    Protocols and materials databases

    DNASUi 744.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000358117 ; ENSP00000350833 ; ENSG00000066382 . [Q15777-1 ]
    ENST00000448418 ; ENSP00000388258 ; ENSG00000066382 . [Q15777-2 ]
    GeneIDi 744.
    KEGGi hsa:744.
    UCSCi uc001msr.3. human. [Q15777-1 ]

    Organism-specific databases

    CTDi 744.
    GeneCardsi GC11M030389.
    HGNCi HGNC:1180. MPPED2.
    HPAi HPA039265.
    MIMi 600911. gene.
    neXtProti NX_Q15777.
    PharmGKBi PA25499.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72373.
    HOGENOMi HOG000023302.
    HOVERGENi HBG000008.
    InParanoidi Q15777.
    OMAi ELVKQDY.
    OrthoDBi EOG7G4QFH.
    PhylomeDBi Q15777.
    TreeFami TF314305.

    Miscellaneous databases

    GenomeRNAii 744.
    NextBioi 3012.
    PROi Q15777.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q15777.
    Bgeei Q15777.
    CleanExi HS_MPPED2.
    Genevestigatori Q15777.

    Family and domain databases

    Gene3Di 3.60.21.10. 2 hits.
    InterProi IPR024201. Calcineurin-like_Pesterase.
    IPR004843. Calcineurin-like_PHP_apaH.
    IPR029052. Metallo-depent_PP-like.
    [Graphical view ]
    Pfami PF00149. Metallophos. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF035808. Pdiesterase_Brain_239. 1 hit.
    SUPFAMi SSF56300. SSF56300. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "A WAGR region gene between PAX-6 and FSHB expressed in fetal brain."
      Schwartz F., Neve R., Eisenman R., Gessler M., Bruns G.
      Hum. Genet. 94:658-664(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region."
      Schwartz F., Eisenman R., Knoll J., Gessler M., Bruns G.
      Genomics 29:526-532(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Homo sapiens protein coding cDNA."
      Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon, Kidney and Stomach.

    Entry informationi

    Entry nameiMPPD2_HUMAN
    AccessioniPrimary (citable) accession number: Q15777
    Secondary accession number(s): D3DQZ5, E9PB10, Q59GE6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 112 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families
    6. Uncharacterized protein families (UPF)
      List of uncharacterized protein family (UPF) entries

    External Data

    Dasty 3