SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15777

- MPPD2_HUMAN

UniProt

Q15777 - MPPD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Metallophosphoesterase MPPED2

Gene
MPPED2, C11orf8, FAM1B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system By similarity.

Cofactori

Manganese or cobalt By similarity.

GO - Molecular functioni

  1. hydrolase activity Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. nervous system development Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Cobalt, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Metallophosphoesterase MPPED2 (EC:3.1.-.-)
Alternative name(s):
Fetal brain protein 239
Short name:
239FB
Metallophosphoesterase domain-containing protein 2
Gene namesi
Name:MPPED2
Synonyms:C11orf8, FAM1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:1180. MPPED2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25499.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 294294Metallophosphoesterase MPPED2PRO_0000053405Add
BLAST

Proteomic databases

MaxQBiQ15777.
PaxDbiQ15777.
PRIDEiQ15777.

PTM databases

PhosphoSiteiQ15777.

Expressioni

Tissue specificityi

Expressed predominantly in fetal brain.

Gene expression databases

ArrayExpressiQ15777.
BgeeiQ15777.
CleanExiHS_MPPED2.
GenevestigatoriQ15777.

Organism-specific databases

HPAiHPA039265.

Interactioni

Subunit structurei

Homodimer By similarity.

Protein-protein interaction databases

BioGridi107202. 1 interaction.
IntActiQ15777. 2 interactions.
STRINGi9606.ENSP00000350833.

Structurei

3D structure databases

ProteinModelPortaliQ15777.
SMRiQ15777. Positions 11-291.

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0046 family.

Phylogenomic databases

eggNOGiNOG72373.
HOGENOMiHOG000023302.
HOVERGENiHBG000008.
InParanoidiQ15777.
OMAiELVKQDY.
OrthoDBiEOG7G4QFH.
PhylomeDBiQ15777.
TreeFamiTF314305.

Family and domain databases

Gene3Di3.60.21.10. 2 hits.
InterProiIPR024201. Calcineurin-like_Pesterase.
IPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
[Graphical view]
PfamiPF00149. Metallophos. 1 hit.
[Graphical view]
PIRSFiPIRSF035808. Pdiesterase_Brain_239. 1 hit.
SUPFAMiSSF56300. SSF56300. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q15777-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAHGIPSQGK VTITVDEYSS NPTQAFTHYN INQSRFQPPH VHMVDPIPYD    50
TPKPAGHTRF VCISDTHSRT DGIQMPYGDI LLHTGDFTEL GLPSEVKKFN 100
DWLGNLPYEY KIVIAGNHEL TFDKEFMADL VKQDYYRFPS VSKLKPEDFD 150
NVQSLLTNSI YLQDSEVTVK GFRIYGAPWT PWFNGWGFNL PRGQSLLDKW 200
NLIPEGIDIL MTHGPPLGFR DWVPKELQRV GCVELLNTVQ RRVRPKLHVF 250
GGIHEGYGIM TDGYTTYINA STCTVSFQPT NPPIIFDLPN PQGS 294
Length:294
Mass (Da):33,360
Last modified:November 1, 1996 - v1
Checksum:i43B2BC0DA1BFD1F0
GO
Isoform 2 (identifier: Q15777-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     256-294: GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS → VNPVSISKALRTKICSLPSKTS

Note: No experimental confirmation available.

Show »
Length:277
Mass (Da):31,507
Checksum:i13B81CC3F8CB96CF
GO

Sequence cautioni

The sequence BAD92400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti67 – 671H → R.
Corresponds to variant rs11556749 [ dbSNP | Ensembl ].
VAR_052487

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei256 – 29439GYGIM…NPQGS → VNPVSISKALRTKICSLPSK TS in isoform 2. VSP_045627Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U57911 mRNA. Translation: AAC50564.1.
AB209163 mRNA. Translation: BAD92400.1. Different initiation.
AL136088 Genomic DNA. No translation available.
AL353699 Genomic DNA. No translation available.
AL356240 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68256.1.
CH471064 Genomic DNA. Translation: EAW68257.1.
BC031582 mRNA. Translation: AAH31582.1.
CCDSiCCDS44560.1. [Q15777-2]
CCDS7870.1. [Q15777-1]
RefSeqiNP_001138871.1. NM_001145399.1. [Q15777-2]
NP_001575.1. NM_001584.2. [Q15777-1]
XP_005253167.1. XM_005253110.1. [Q15777-1]
XP_005253168.1. XM_005253111.2. [Q15777-1]
XP_005253169.1. XM_005253112.1. [Q15777-1]
UniGeneiHs.289795.

Genome annotation databases

EnsembliENST00000358117; ENSP00000350833; ENSG00000066382. [Q15777-1]
ENST00000448418; ENSP00000388258; ENSG00000066382. [Q15777-2]
GeneIDi744.
KEGGihsa:744.
UCSCiuc001msr.3. human. [Q15777-1]

Polymorphism databases

DMDMi3023214.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U57911 mRNA. Translation: AAC50564.1 .
AB209163 mRNA. Translation: BAD92400.1 . Different initiation.
AL136088 Genomic DNA. No translation available.
AL353699 Genomic DNA. No translation available.
AL356240 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68256.1 .
CH471064 Genomic DNA. Translation: EAW68257.1 .
BC031582 mRNA. Translation: AAH31582.1 .
CCDSi CCDS44560.1. [Q15777-2 ]
CCDS7870.1. [Q15777-1 ]
RefSeqi NP_001138871.1. NM_001145399.1. [Q15777-2 ]
NP_001575.1. NM_001584.2. [Q15777-1 ]
XP_005253167.1. XM_005253110.1. [Q15777-1 ]
XP_005253168.1. XM_005253111.2. [Q15777-1 ]
XP_005253169.1. XM_005253112.1. [Q15777-1 ]
UniGenei Hs.289795.

3D structure databases

ProteinModelPortali Q15777.
SMRi Q15777. Positions 11-291.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107202. 1 interaction.
IntActi Q15777. 2 interactions.
STRINGi 9606.ENSP00000350833.

PTM databases

PhosphoSitei Q15777.

Polymorphism databases

DMDMi 3023214.

Proteomic databases

MaxQBi Q15777.
PaxDbi Q15777.
PRIDEi Q15777.

Protocols and materials databases

DNASUi 744.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000358117 ; ENSP00000350833 ; ENSG00000066382 . [Q15777-1 ]
ENST00000448418 ; ENSP00000388258 ; ENSG00000066382 . [Q15777-2 ]
GeneIDi 744.
KEGGi hsa:744.
UCSCi uc001msr.3. human. [Q15777-1 ]

Organism-specific databases

CTDi 744.
GeneCardsi GC11M030389.
HGNCi HGNC:1180. MPPED2.
HPAi HPA039265.
MIMi 600911. gene.
neXtProti NX_Q15777.
PharmGKBi PA25499.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG72373.
HOGENOMi HOG000023302.
HOVERGENi HBG000008.
InParanoidi Q15777.
OMAi ELVKQDY.
OrthoDBi EOG7G4QFH.
PhylomeDBi Q15777.
TreeFami TF314305.

Miscellaneous databases

GenomeRNAii 744.
NextBioi 3012.
PROi Q15777.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q15777.
Bgeei Q15777.
CleanExi HS_MPPED2.
Genevestigatori Q15777.

Family and domain databases

Gene3Di 3.60.21.10. 2 hits.
InterProi IPR024201. Calcineurin-like_Pesterase.
IPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
[Graphical view ]
Pfami PF00149. Metallophos. 1 hit.
[Graphical view ]
PIRSFi PIRSF035808. Pdiesterase_Brain_239. 1 hit.
SUPFAMi SSF56300. SSF56300. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A WAGR region gene between PAX-6 and FSHB expressed in fetal brain."
    Schwartz F., Neve R., Eisenman R., Gessler M., Bruns G.
    Hum. Genet. 94:658-664(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region."
    Schwartz F., Eisenman R., Knoll J., Gessler M., Bruns G.
    Genomics 29:526-532(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Homo sapiens protein coding cDNA."
    Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon, Kidney and Stomach.

Entry informationi

Entry nameiMPPD2_HUMAN
AccessioniPrimary (citable) accession number: Q15777
Secondary accession number(s): D3DQZ5, E9PB10, Q59GE6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
  6. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3

Similar proteinsi