Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Metallophosphoesterase MPPED2

Gene

MPPED2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system (By similarity).By similarity

Cofactori

Mn2+By similarity, Co2+By similarity

GO - Molecular functioni

  1. hydrolase activity Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. nervous system development Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Cobalt, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Metallophosphoesterase MPPED2 (EC:3.1.-.-)
Alternative name(s):
Fetal brain protein 239
Short name:
239FB
Metallophosphoesterase domain-containing protein 2
Gene namesi
Name:MPPED2
Synonyms:C11orf8, FAM1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:1180. MPPED2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25499.

Polymorphism and mutation databases

BioMutaiMPPED2.
DMDMi3023214.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 294294Metallophosphoesterase MPPED2PRO_0000053405Add
BLAST

Proteomic databases

MaxQBiQ15777.
PaxDbiQ15777.
PRIDEiQ15777.

PTM databases

PhosphoSiteiQ15777.

Expressioni

Tissue specificityi

Expressed predominantly in fetal brain.

Gene expression databases

BgeeiQ15777.
CleanExiHS_MPPED2.
ExpressionAtlasiQ15777. baseline and differential.
GenevestigatoriQ15777.

Organism-specific databases

HPAiHPA039265.

Interactioni

Subunit structurei

Homodimer.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
CAGE1Q8TC203EBI-2350461,EBI-10196469
FAM72AQ5TYM53EBI-2350461,EBI-10237116
RXRGP484433EBI-2350461,EBI-712405
TRIP13Q156455EBI-2350461,EBI-358993
VAC14Q08AM63EBI-2350461,EBI-2107455

Protein-protein interaction databases

BioGridi107202. 9 interactions.
IntActiQ15777. 6 interactions.
STRINGi9606.ENSP00000350833.

Structurei

3D structure databases

SMRiQ15777. Positions 11-291.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0046 family.Curated

Phylogenomic databases

eggNOGiNOG72373.
GeneTreeiENSGT00390000007681.
HOGENOMiHOG000023302.
HOVERGENiHBG000008.
InParanoidiQ15777.
OMAiRPKLHAF.
OrthoDBiEOG7G4QFH.
PhylomeDBiQ15777.
TreeFamiTF314305.

Family and domain databases

Gene3Di3.60.21.10. 2 hits.
InterProiIPR024201. Calcineurin-like_Pesterase.
IPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
[Graphical view]
PfamiPF00149. Metallophos. 1 hit.
[Graphical view]
PIRSFiPIRSF035808. Pdiesterase_Brain_239. 1 hit.
SUPFAMiSSF56300. SSF56300. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15777-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAHGIPSQGK VTITVDEYSS NPTQAFTHYN INQSRFQPPH VHMVDPIPYD
60 70 80 90 100
TPKPAGHTRF VCISDTHSRT DGIQMPYGDI LLHTGDFTEL GLPSEVKKFN
110 120 130 140 150
DWLGNLPYEY KIVIAGNHEL TFDKEFMADL VKQDYYRFPS VSKLKPEDFD
160 170 180 190 200
NVQSLLTNSI YLQDSEVTVK GFRIYGAPWT PWFNGWGFNL PRGQSLLDKW
210 220 230 240 250
NLIPEGIDIL MTHGPPLGFR DWVPKELQRV GCVELLNTVQ RRVRPKLHVF
260 270 280 290
GGIHEGYGIM TDGYTTYINA STCTVSFQPT NPPIIFDLPN PQGS
Length:294
Mass (Da):33,360
Last modified:November 1, 1996 - v1
Checksum:i43B2BC0DA1BFD1F0
GO
Isoform 2 (identifier: Q15777-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     256-294: GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS → VNPVSISKALRTKICSLPSKTS

Note: No experimental confirmation available.

Show »
Length:277
Mass (Da):31,507
Checksum:i13B81CC3F8CB96CF
GO

Sequence cautioni

The sequence BAD92400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti67 – 671H → R.
Corresponds to variant rs11556749 [ dbSNP | Ensembl ].
VAR_052487

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei256 – 29439GYGIM…NPQGS → VNPVSISKALRTKICSLPSK TS in isoform 2. 1 PublicationVSP_045627Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U57911 mRNA. Translation: AAC50564.1.
AB209163 mRNA. Translation: BAD92400.1. Different initiation.
AL136088 Genomic DNA. No translation available.
AL353699 Genomic DNA. No translation available.
AL356240 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68256.1.
CH471064 Genomic DNA. Translation: EAW68257.1.
BC031582 mRNA. Translation: AAH31582.1.
CCDSiCCDS44560.1. [Q15777-2]
CCDS7870.1. [Q15777-1]
RefSeqiNP_001138871.1. NM_001145399.1. [Q15777-2]
NP_001575.1. NM_001584.2. [Q15777-1]
XP_005253167.1. XM_005253110.2. [Q15777-1]
XP_005253168.1. XM_005253111.2. [Q15777-1]
XP_005253169.1. XM_005253112.1. [Q15777-1]
UniGeneiHs.289795.

Genome annotation databases

EnsembliENST00000358117; ENSP00000350833; ENSG00000066382. [Q15777-1]
ENST00000448418; ENSP00000388258; ENSG00000066382. [Q15777-2]
GeneIDi744.
KEGGihsa:744.
UCSCiuc001msr.3. human. [Q15777-1]

Polymorphism and mutation databases

BioMutaiMPPED2.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U57911 mRNA. Translation: AAC50564.1.
AB209163 mRNA. Translation: BAD92400.1. Different initiation.
AL136088 Genomic DNA. No translation available.
AL353699 Genomic DNA. No translation available.
AL356240 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68256.1.
CH471064 Genomic DNA. Translation: EAW68257.1.
BC031582 mRNA. Translation: AAH31582.1.
CCDSiCCDS44560.1. [Q15777-2]
CCDS7870.1. [Q15777-1]
RefSeqiNP_001138871.1. NM_001145399.1. [Q15777-2]
NP_001575.1. NM_001584.2. [Q15777-1]
XP_005253167.1. XM_005253110.2. [Q15777-1]
XP_005253168.1. XM_005253111.2. [Q15777-1]
XP_005253169.1. XM_005253112.1. [Q15777-1]
UniGeneiHs.289795.

3D structure databases

SMRiQ15777. Positions 11-291.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107202. 9 interactions.
IntActiQ15777. 6 interactions.
STRINGi9606.ENSP00000350833.

PTM databases

PhosphoSiteiQ15777.

Polymorphism and mutation databases

BioMutaiMPPED2.
DMDMi3023214.

Proteomic databases

MaxQBiQ15777.
PaxDbiQ15777.
PRIDEiQ15777.

Protocols and materials databases

DNASUi744.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358117; ENSP00000350833; ENSG00000066382. [Q15777-1]
ENST00000448418; ENSP00000388258; ENSG00000066382. [Q15777-2]
GeneIDi744.
KEGGihsa:744.
UCSCiuc001msr.3. human. [Q15777-1]

Organism-specific databases

CTDi744.
GeneCardsiGC11M030406.
HGNCiHGNC:1180. MPPED2.
HPAiHPA039265.
MIMi600911. gene.
neXtProtiNX_Q15777.
PharmGKBiPA25499.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG72373.
GeneTreeiENSGT00390000007681.
HOGENOMiHOG000023302.
HOVERGENiHBG000008.
InParanoidiQ15777.
OMAiRPKLHAF.
OrthoDBiEOG7G4QFH.
PhylomeDBiQ15777.
TreeFamiTF314305.

Miscellaneous databases

ChiTaRSiMPPED2. human.
GenomeRNAii744.
NextBioi3012.
PROiQ15777.
SOURCEiSearch...

Gene expression databases

BgeeiQ15777.
CleanExiHS_MPPED2.
ExpressionAtlasiQ15777. baseline and differential.
GenevestigatoriQ15777.

Family and domain databases

Gene3Di3.60.21.10. 2 hits.
InterProiIPR024201. Calcineurin-like_Pesterase.
IPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
[Graphical view]
PfamiPF00149. Metallophos. 1 hit.
[Graphical view]
PIRSFiPIRSF035808. Pdiesterase_Brain_239. 1 hit.
SUPFAMiSSF56300. SSF56300. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A WAGR region gene between PAX-6 and FSHB expressed in fetal brain."
    Schwartz F., Neve R., Eisenman R., Gessler M., Bruns G.
    Hum. Genet. 94:658-664(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region."
    Schwartz F., Eisenman R., Knoll J., Gessler M., Bruns G.
    Genomics 29:526-532(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Homo sapiens protein coding cDNA."
    Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon, Kidney and Stomach.

Entry informationi

Entry nameiMPPD2_HUMAN
AccessioniPrimary (citable) accession number: Q15777
Secondary accession number(s): D3DQZ5, E9PB10, Q59GE6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: April 29, 2015
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
  6. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.