Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Metallophosphoesterase MPPED2

Gene

MPPED2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system (By similarity).By similarity

Cofactori

Mn2+By similarity, Co2+By similarity

GO - Molecular functioni

GO - Biological processi

  • nervous system development Source: ProtInc

Keywordsi

Molecular functionHydrolase
LigandCobalt, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Metallophosphoesterase MPPED2 (EC:3.1.-.-)
Alternative name(s):
Fetal brain protein 239
Short name:
239FB
Metallophosphoesterase domain-containing protein 2
Gene namesi
Name:MPPED2
Synonyms:C11orf8, FAM1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000066382.16
HGNCiHGNC:1180 MPPED2
MIMi600911 gene
neXtProtiNX_Q15777

Pathology & Biotechi

Organism-specific databases

DisGeNETi744
OpenTargetsiENSG00000066382
PharmGKBiPA25499

Polymorphism and mutation databases

BioMutaiMPPED2
DMDMi3023214

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000534051 – 294Metallophosphoesterase MPPED2Add BLAST294

Proteomic databases

MaxQBiQ15777
PaxDbiQ15777
PeptideAtlasiQ15777
PRIDEiQ15777

PTM databases

PhosphoSitePlusiQ15777

Expressioni

Tissue specificityi

Expressed predominantly in fetal brain.

Gene expression databases

BgeeiENSG00000066382
CleanExiHS_MPPED2
ExpressionAtlasiQ15777 baseline and differential
GenevisibleiQ15777 HS

Organism-specific databases

HPAiHPA062575

Interactioni

Subunit structurei

Homodimer.By similarity

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi107202, 10 interactors
IntActiQ15777, 9 interactors
MINTiQ15777
STRINGi9606.ENSP00000350833

Structurei

3D structure databases

ProteinModelPortaliQ15777
SMRiQ15777
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0046 family.Curated

Phylogenomic databases

eggNOGiKOG3947 Eukaryota
ENOG4111K47 LUCA
GeneTreeiENSGT00390000007681
HOGENOMiHOG000023302
HOVERGENiHBG000008
InParanoidiQ15777
OMAiMAHGKVT
OrthoDBiEOG091G0CE0
PhylomeDBiQ15777
TreeFamiTF314305

Family and domain databases

Gene3Di3.60.21.10, 1 hit
InterProiView protein in InterPro
IPR024201 Calcineurin-like_Pesterase
IPR004843 Calcineurin-like_PHP_ApaH
IPR029052 Metallo-depent_PP-like
PfamiView protein in Pfam
PF00149 Metallophos, 1 hit
PIRSFiPIRSF035808 Pdiesterase_Brain_239, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15777-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAHGIPSQGK VTITVDEYSS NPTQAFTHYN INQSRFQPPH VHMVDPIPYD
60 70 80 90 100
TPKPAGHTRF VCISDTHSRT DGIQMPYGDI LLHTGDFTEL GLPSEVKKFN
110 120 130 140 150
DWLGNLPYEY KIVIAGNHEL TFDKEFMADL VKQDYYRFPS VSKLKPEDFD
160 170 180 190 200
NVQSLLTNSI YLQDSEVTVK GFRIYGAPWT PWFNGWGFNL PRGQSLLDKW
210 220 230 240 250
NLIPEGIDIL MTHGPPLGFR DWVPKELQRV GCVELLNTVQ RRVRPKLHVF
260 270 280 290
GGIHEGYGIM TDGYTTYINA STCTVSFQPT NPPIIFDLPN PQGS
Length:294
Mass (Da):33,360
Last modified:November 1, 1996 - v1
Checksum:i43B2BC0DA1BFD1F0
GO
Isoform 2 (identifier: Q15777-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     256-294: GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS → VNPVSISKALRTKICSLPSKTS

Note: No experimental confirmation available.
Show »
Length:277
Mass (Da):31,507
Checksum:i13B81CC3F8CB96CF
GO

Sequence cautioni

The sequence BAD92400 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05248767H → R. Corresponds to variant dbSNP:rs11556749Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045627256 – 294GYGIM…NPQGS → VNPVSISKALRTKICSLPSK TS in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U57911 mRNA Translation: AAC50564.1
AB209163 mRNA Translation: BAD92400.1 Different initiation.
AL136088 Genomic DNA No translation available.
AL353699 Genomic DNA No translation available.
AL356240 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68256.1
CH471064 Genomic DNA Translation: EAW68257.1
BC031582 mRNA Translation: AAH31582.1
CCDSiCCDS44560.1 [Q15777-2]
CCDS7870.1 [Q15777-1]
RefSeqiNP_001138871.1, NM_001145399.1 [Q15777-2]
NP_001575.1, NM_001584.2 [Q15777-1]
XP_005253167.1, XM_005253110.3 [Q15777-1]
XP_005253168.1, XM_005253111.2 [Q15777-1]
XP_005253169.1, XM_005253112.1 [Q15777-1]
XP_016873721.1, XM_017018232.1 [Q15777-2]
UniGeneiHs.289795

Genome annotation databases

EnsembliENST00000358117; ENSP00000350833; ENSG00000066382 [Q15777-1]
ENST00000448418; ENSP00000388258; ENSG00000066382 [Q15777-2]
GeneIDi744
KEGGihsa:744
UCSCiuc001msq.4 human [Q15777-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMPPD2_HUMAN
AccessioniPrimary (citable) accession number: Q15777
Secondary accession number(s): D3DQZ5, E9PB10, Q59GE6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: March 28, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
  6. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health