Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15772 (SPEG_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 137. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Striated muscle preferentially expressed protein kinase

EC=2.7.11.1
Alternative name(s):
Aortic preferentially expressed protein 1
Short name=APEG-1
Gene names
Name:SPEG
Synonyms:APEG1, KIAA1297
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length3267 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Subunit structure

Isoform 3 is found as a monomer or homodimer. Ref.10

Subcellular location

Isoform 3: Nucleus Ref.1.

Tissue specificity

Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis. Ref.1 Ref.8

Induction

Isoform 3 is quickly down-regulated in response to vascular injury, when ASMC cells change from a quiescent to a proliferative phenotype. Ref.1

Post-translational modification

May be autophosphorylated.

Miscellaneous

Expression is under the tight control of the locus control region (LCRs).

Sequence similarities

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.

Contains 2 fibronectin type-III domains.

Contains 9 Ig-like (immunoglobulin-like) domains.

Contains 2 protein kinase domains.

Sequence caution

The sequence AAY15052.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence ABD61734.1 differs from that shown. Reason: Frameshift at positions 31 and 35.

Alternative products

This entry describes 4 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select]
Isoform 4 (identifier: Q15772-5)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q15772-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-792: Missing.
     961-962: AH → GE
     963-3267: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q15772-4)

Also known as: APEG1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-849: Missing.
     961-962: AH → GE
     963-3267: Missing.
Note: Produced by alternative promoter usage.
Isoform 1 (identifier: Q15772-1)

Also known as: SPEG;

The sequence of this isoform differs from the canonical sequence as follows:
     3209-3267: LQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKEFLGEQRRRRAEAATRHKVLLRSYPGGP → SCLSVCHKEIKMASS
Note: Produced by alternative splicing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 32673267Striated muscle preferentially expressed protein kinase
PRO_0000072666

Regions

Domain43 – 12482Ig-like 1
Domain722 – 81089Ig-like 2
Domain869 – 95890Ig-like 3
Domain963 – 105795Ig-like 4
Domain1064 – 115289Ig-like 5
Domain1188 – 127891Ig-like 6
Domain1285 – 138298Fibronectin type-III 1
Domain1384 – 148097Ig-like 7
Domain1485 – 157389Ig-like 8
Domain1601 – 1854254Protein kinase 1
Domain2583 – 267391Ig-like 9
Domain2680 – 277495Fibronectin type-III 2
Domain2966 – 3218253Protein kinase 2
Nucleotide binding1607 – 16159ATP By similarity
Nucleotide binding2972 – 29809ATP By similarity
Compositional bias284 – 34562Pro-rich
Compositional bias525 – 634110Pro-rich
Compositional bias1919 – 19246Poly-Ser
Compositional bias1925 – 19317Poly-Glu
Compositional bias2175 – 2316142Pro-rich
Compositional bias2339 – 2503165Arg-rich
Compositional bias2786 – 2965180Pro-rich

Sites

Active site17191Proton acceptor By similarity
Active site30851Proton acceptor By similarity
Binding site16301ATP By similarity
Binding site29951ATP By similarity

Amino acid modifications

Modified residue11721Phosphoserine By similarity
Disulfide bond989 ↔ 1041 By similarity
Disulfide bond2605 ↔ 2657 By similarity

Natural variations

Alternative sequence1 – 849849Missing in isoform 3.
VSP_018258
Alternative sequence1 – 792792Missing in isoform 2.
VSP_018259
Alternative sequence961 – 9622AH → GE in isoform 2 and isoform 3.
VSP_018261
Alternative sequence963 – 32672305Missing in isoform 2 and isoform 3.
VSP_018262
Alternative sequence3209 – 326759LQDCL…YPGGP → SCLSVCHKEIKMASS in isoform 1.
VSP_036071
Natural variant2061R → H. Ref.11
Corresponds to variant rs55821435 [ dbSNP | Ensembl ].
VAR_041101
Natural variant9341R → C. Ref.11
Corresponds to variant rs34398769 [ dbSNP | Ensembl ].
VAR_041102
Natural variant9661R → Q. Ref.11
Corresponds to variant rs34861443 [ dbSNP | Ensembl ].
VAR_041103
Natural variant11031P → L. Ref.11
Corresponds to variant rs56334571 [ dbSNP | Ensembl ].
VAR_041104
Natural variant11351A → V. Ref.11
Corresponds to variant rs55670811 [ dbSNP | Ensembl ].
VAR_041105
Natural variant11781E → D in a gastric adenocarcinoma sample; somatic mutation. Ref.11
VAR_041106
Natural variant12341R → W. Ref.11
Corresponds to variant rs55916864 [ dbSNP | Ensembl ].
VAR_041107
Natural variant13401R → Q. Ref.11
Corresponds to variant rs34994343 [ dbSNP | Ensembl ].
VAR_041108
Natural variant16211R → C. Ref.11
Corresponds to variant rs55646900 [ dbSNP | Ensembl ].
VAR_041109
Natural variant19031R → W in an ovarian mucinous carcinoma sample; somatic mutation. Ref.11
VAR_041110
Natural variant21891P → L.
Corresponds to variant rs10755037 [ dbSNP | Ensembl ].
VAR_059769
Natural variant26871P → T. Ref.8 Ref.9 Ref.11
Corresponds to variant rs13026308 [ dbSNP | Ensembl ].
VAR_041111
Natural variant27421V → M in a gastric adenocarcinoma sample; somatic mutation. Ref.11
VAR_041112
Natural variant30791H → R. Ref.11
Corresponds to variant rs12464085 [ dbSNP | Ensembl ].
VAR_041113

Experimental info

Sequence conflict711Q → H in ABD61734. Ref.7
Sequence conflict731S → I in ABD61734. Ref.7
Sequence conflict20471S → G in AAT80901. Ref.8
Sequence conflict20471S → G in BAA92535. Ref.9
Sequence conflict30051R → P in AAT80901. Ref.8
Sequence conflict30051R → P in BAA92535. Ref.9

Secondary structure

.................... 3267
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 4 [UniParc].

Last modified December 16, 2008. Version 4.
Checksum: E67BEB5624144233

FASTA3,267354,289
        10         20         30         40         50         60 
MQKARGTRGE DAGTRAPPSP GVPPKRAKVG AGGGAPVAVA GAPVFLRPLK NAAVCAGSDV 

        70         80         90        100        110        120 
RLRVVVSGTP QPSLRWFRDG QLLPAPAPEP SCLWLRRCGA QDAGVYSCMA QNERGRASCE 

       130        140        150        160        170        180 
AVLTVLEVGD SETAEDDISD VQGTQRLELR DDGAFSTPTG GSDTLVGTSL DTPPTSVTGT 

       190        200        210        220        230        240 
SEEQVSWWGS GQTVLEQEAG SGGGTRRLPG SPRQAQATGA GPRHLGVEPL VRASRANLVG 

       250        260        270        280        290        300 
ASWGSEDSLS VASDLYGSAF SLYRGRALSI HVSVPQSGLR REEPDLQPQL ASEAPRRPAQ 

       310        320        330        340        350        360 
PPPSKSALLP PPSPRVGKRS PPGPPAQPAA TPTSPHRRTQ EPVLPEDTTT EEKRGKKSKS 

       370        380        390        400        410        420 
SGPSLAGTAE SRPQTPLSEA SGRLSALGRS PRLVRAGSRI LDKLQFFEER RRSLERSDSP 

       430        440        450        460        470        480 
PAPLRPWVPL RKARSLEQPK SERGAPWGTP GASQEELRAP GSVAERRRLF QQKAASLDER 

       490        500        510        520        530        540 
TRQRSPASDL ELRFAQELGR IRRSTSREEL VRSHESLRAT LQRAPSPREP GEPPLFSRPS 

       550        560        570        580        590        600 
TPKTSRAVSP AAAQPPSPSS AEKPGDEPGR PRSRGPAGRT EPGEGPQQEV RRRDQFPLTR 

       610        620        630        640        650        660 
SRAIQECRSP VPPPAADPPE ARTKAPPGRK REPPAQAVRF LPWATPGLEG AAVPQTLEKN 

       670        680        690        700        710        720 
RAGPEAEKRL RRGPEEDGPW GPWDRRGARS QGKGRRARPT SPELESSDDS YVSAGEEPLE 

       730        740        750        760        770        780 
APVFEIPLQN VVVAPGADVL LKCIITANPP PQVSWHKDGS ALRSEGRLLL RAEGERHTLL 

       790        800        810        820        830        840 
LREARAADAG SYMATATNEL GQATCAASLT VRPGGSTSPF SSPITSDEEY LSPPEEFPEP 

       850        860        870        880        890        900 
GETWPRTPTM KPSPSQNRRS SDTGSKAPPT FKVSLMDQSV REGQDVIMSI RVQGEPKPVV 

       910        920        930        940        950        960 
SWLRNRQPVR PDQRRFAEEA EGGLCRLRIL AAERGDAGFY TCKAVNEYGA RQCEARLEVR 

       970        980        990       1000       1010       1020 
AHPESRSLAV LAPLQDVDVG AGEMALFECL VAGPTDVEVD WLCRGRLLQP ALLKCKMHFD 

      1030       1040       1050       1060       1070       1080 
GRKCKLLLTS VHEDDSGVYT CKLSTAKDEL TCSARLTVRP SLAPLFTRLL EDVEVLEGRA 

      1090       1100       1110       1120       1130       1140 
ARFDCKISGT PPPVVTWTHF GCPMEESENL RLRQDGGLHS LHIAHVGSED EGLYAVSAVN 

      1150       1160       1170       1180       1190       1200 
THGQAHCSAQ LYVEEPRTAA SGPSSKLEKM PSIPEEPEQG ELERLSIPDF LRPLQDLEVG 

      1210       1220       1230       1240       1250       1260 
LAKEAMLECQ VTGLPYPTIS WFHNGHRIQS SDDRRMTQYR DVHRLVFPAV GPQHAGVYKS 

      1270       1280       1290       1300       1310       1320 
VIANKLGKAA CYAHLYVTDV VPGPPDGAPQ VVAVTGRMVT LTWNPPRSLD MAIDPDSLTY 

      1330       1340       1350       1360       1370       1380 
TVQHQVLGSD QWTALVTGLR EPGWAATGLR KGVQHIFRVL STTVKSSSKP SPPSEPVQLL 

      1390       1400       1410       1420       1430       1440 
EHGPTLEEAP AMLDKPDIVY VVEGQPASVT VTFNHVEAQV VWRSCRGALL EARAGVYELS 

      1450       1460       1470       1480       1490       1500 
QPDDDQYCLR ICRVSRRDMG ALTCTARNRH GTQTCSVTLE LAEAPRFESI MEDVEVGAGE 

      1510       1520       1530       1540       1550       1560 
TARFAVVVEG KPLPDIMWYK DEVLLTESSH VSFVYEENEC SLVVLSTGAQ DGGVYTCTAQ 

      1570       1580       1590       1600       1610       1620 
NLAGEVSCKA ELAVHSAQTA MEVEGVGEDE DHRGRRLSDF YDIHQEIGRG AFSYLRRIVE 

      1630       1640       1650       1660       1670       1680 
RSSGLEFAAK FIPSQAKPKA SARREARLLA RLQHDCVLYF HEAFERRRGL VIVTELCTEE 

      1690       1700       1710       1720       1730       1740 
LLERIARKPT VCESEIRAYM RQVLEGIHYL HQSHVLHLDV KPENLLVWDG AAGEQQVRIC 

      1750       1760       1770       1780       1790       1800 
DFGNAQELTP GEPQYCQYGT PEFVAPEIVN QSPVSGVTDI WPVGVVAFLC LTGISPFVGE 

      1810       1820       1830       1840       1850       1860 
NDRTTLMNIR NYNVAFEETT FLSLSREARG FLIKVLVQDR LRPTAEETLE HPWFKTQAKG 

      1870       1880       1890       1900       1910       1920 
AEVSTDHLKL FLSRRRWQRS QISYKCHLVL RPIPELLRAP PERVWVTMPR RPPPSGGLSS 

      1930       1940       1950       1960       1970       1980 
SSDSEEEELE ELPSVPRPLQ PEFSGSRVSL TDIPTEDEAL GTPETGAATP MDWQEQGRAP 

      1990       2000       2010       2020       2030       2040 
SQDQEAPSPE ALPSPGQEPA AGASPRRGEL RRGSSAESAL PRAGPRELGR GLHKAASVEL 

      2050       2060       2070       2080       2090       2100 
PQRRSPSPGA TRLARGGLGE GEYAQRLQAL RQRLLRGGPE DGKVSGLRGP LLESLGGRAR 

      2110       2120       2130       2140       2150       2160 
DPRMARAASS EAAPHHQPPL ENRGLQKSSS FSQGEAEPRG RHRRAGAPLE IPVARLGARR 

      2170       2180       2190       2200       2210       2220 
LQESPSLSAL SEAQPSSPAR PSAPKPSTPK SAEPSATTPS DAPQPPAPQP AQDKAPEPRP 

      2230       2240       2250       2260       2270       2280 
EPVRASKPAP PPQALQTLAL PLTPYAQIIQ SLQLSGHAQG PSQGPAAPPS EPKPHAAVFA 

      2290       2300       2310       2320       2330       2340 
RVASPPPGAP EKRVPSAGGP PVLAEKARVP TVPPRPGSSL SSSIENLESE AVFEAKFKRS 

      2350       2360       2370       2380       2390       2400 
RESPLSLGLR LLSRSRSEER GPFRGAEEED GIYRPSPAGT PLELVRRPER SRSVQDLRAV 

      2410       2420       2430       2440       2450       2460 
GEPGLVRRLS LSLSQRLRRT PPAQRHPAWE ARGGDGESSE GGSSARGSPV LAMRRRLSFT 

      2470       2480       2490       2500       2510       2520 
LERLSSRLQR SGSSEDSGGA SGRSTPLFGR LRRATSEGES LRRLGLPHNQ LAAQAGATTP 

      2530       2540       2550       2560       2570       2580 
SAESLGSEAS ATSGSSAPGE SRSRLRWGFS RPRKDKGLSP PNLSASVQEE LGHQYVRSES 

      2590       2600       2610       2620       2630       2640 
DFPPVFHIKL KDQVLLEGEA ATLLCLPAAC PAPHISWMKD KKSLRSEPSV IIVSCKDGRQ 

      2650       2660       2670       2680       2690       2700 
LLSIPRAGKR HAGLYECSAT NVLGSITSSC TVAVARVPGK LAPPEVPQTY QDTALVLWKP 

      2710       2720       2730       2740       2750       2760 
GDSRAPCTYT LERRVDGESV WHPVSSGIPD CYYNVTHLPV GVTVRFRVAC ANRAGQGPFS 

      2770       2780       2790       2800       2810       2820 
NSSEKVFVRG TQDSSAVPSA AHQEAPVTSR PARARPPDSP TSLAPPLAPA APTPPSVTVS 

      2830       2840       2850       2860       2870       2880 
PSSPPTPPSQ ALSSLKAVGP PPQTPPRRHR GLQAARPAEP TLPSTHVTPS EPKPFVLDTG 

      2890       2900       2910       2920       2930       2940 
TPIPASTPQG VKPVSSSTPV YVVTSFVSAP PAPEPPAPEP PPEPTKVTVQ SLSPAKEVVS 

      2950       2960       2970       2980       2990       3000 
SPGSSPRSSP RPEGTTLRQG PPQKPYTFLE EKARGRFGVV RACRENATGR TFVAKIVPYA 

      3010       3020       3030       3040       3050       3060 
AEGKRRVLQE YEVLRTLHHE RIMSLHEAYI TPRYLVLIAE SCGNRELLCG LSDRFRYSED 

      3070       3080       3090       3100       3110       3120 
DVATYMVQLL QGLDYLHGHH VLHLDIKPDN LLLAPDNALK IVDFGSAQPY NPQALRPLGH 

      3130       3140       3150       3160       3170       3180 
RTGTLEFMAP EMVKGEPIGS ATDIWGAGVL TYIMLSGRSP FYEPDPQETE ARIVGGRFDA 

      3190       3200       3210       3220       3230       3240 
FQLYPNTSQS ATLFLRKVLS VHPWSRPSLQ DCLAHPWLQD AYLMKLRRQT LTFTTNRLKE 

      3250       3260 
FLGEQRRRRA EAATRHKVLL RSYPGGP 

« Hide

Isoform 2 [UniParc].

Checksum: 275949922564F798
Show »

FASTA17018,673
Isoform 3 (APEG1) [UniParc].

Checksum: 04F367263A1397C5
Show »

FASTA11312,692
Isoform 1 (SPEG) [UniParc].

Checksum: FBF1188F9F1B883A
Show »

FASTA3,223348,903

References

« Hide 'large scale' references
[1]"APEG-1, a novel gene preferentially expressed in aortic smooth muscle cells, is down-regulated by vascular injury."
Hsieh C.-M., Yoshizumi M., Endege W.O., Kho C.-J., Jain M.K., Kashiki S., de Los Santos R., Lee W.-S., Perrella M.A., Lee M.-E.
J. Biol. Chem. 271:17354-17359(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Cerebellum and Uterus.
[3]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[7]"The human desmin locus: gene organization and LCR-mediated transcriptional control."
Tam J.L.Y., Triantaphyllopoulos K., Todd H., Raguz S., de Wit T., Morgan J.E., Partridge T.A., Makrinou E., Grosveld F., Antoniou M.
Genomics 87:733-746(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 12-129 (ISOFORM 1), ALTERNATIVE PROMOTER USAGE.
[8]"Orthologous relationship of obscurin and Unc-89: phylogeny of a novel family of tandem myosin light chain kinases."
Sutter S.B., Raeker M.O., Borisov A.B., Russell M.W.
Dev. Genes Evol. 214:352-359(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 130-3267 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT THR-2687.
[9]"Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 982-3267 (ISOFORM 1), VARIANT THR-2687.
Tissue: Brain.
[10]"X-ray structure of engineered human aortic preferentially expressed protein-1 (APEG-1)."
Manjasetty B.A., Niesen F.H., Scheich C., Roske Y., Goetz F., Behlke J., Sievert V., Heinemann U., Bussow K.
BMC Struct. Biol. 5:21-21(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (0.96 ANGSTROMS) OF 864-962, SUBUNIT.
[11]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-206; CYS-934; GLN-966; LEU-1103; VAL-1135; ASP-1178; TRP-1234; GLN-1340; CYS-1621; TRP-1903; THR-2687; MET-2742 AND ARG-3079.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U57099 mRNA. Translation: AAC50599.1.
AK126500 mRNA. Translation: BAC86568.1.
AK289531 mRNA. Translation: BAF82220.1.
CR542201 mRNA. Translation: CAG46998.1.
AC053503 Genomic DNA. Translation: AAY15052.1. Sequence problems.
CH471063 Genomic DNA. Translation: EAW70747.1.
BC006346 mRNA. Translation: AAH06346.1.
DQ395348 mRNA. Translation: ABD61734.1. Frameshift.
AY603755 mRNA. Translation: AAT80901.1.
AB037718 mRNA. Translation: BAA92535.1.
CCDSCCDS42824.1. [Q15772-5]
CCDS54432.1. [Q15772-4]
RefSeqNP_001166947.1. NM_001173476.1. [Q15772-4]
NP_005867.3. NM_005876.4. [Q15772-5]
UniGeneHs.21639.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1U2HX-ray0.96A864-960[»]
ProteinModelPortalQ15772.
SMRQ15772. Positions 866-961.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115579. 3 interactions.
IntActQ15772. 1 interaction.

PTM databases

PhosphoSiteQ15772.

Polymorphism databases

DMDM218512143.

Proteomic databases

MaxQBQ15772.
PaxDbQ15772.
PRIDEQ15772.

Protocols and materials databases

DNASU10290.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000312358; ENSP00000311684; ENSG00000072195. [Q15772-5]
ENST00000396686; ENSP00000379917; ENSG00000072195. [Q15772-4]
ENST00000396688; ENSP00000379919; ENSG00000072195. [Q15772-4]
ENST00000396689; ENSP00000379920; ENSG00000072195. [Q15772-4]
ENST00000396695; ENSP00000379923; ENSG00000072195. [Q15772-3]
GeneID10290.
KEGGhsa:10290.
UCSCuc002vln.1. human. [Q15772-3]
uc002vlq.3. human. [Q15772-4]
uc010fwg.3. human. [Q15772-5]

Organism-specific databases

CTD10290.
GeneCardsGC02P220299.
H-InvDBHIX0002864.
HGNCHGNC:16901. SPEG.
HPAHPA018904.
neXtProtNX_Q15772.
PharmGKBPA142672598.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0515.
HOVERGENHBG083339.
KOK08809.
OMAQYRDVHR.
OrthoDBEOG7QC7V5.
PhylomeDBQ15772.
TreeFamTF331962.

Enzyme and pathway databases

SignaLinkQ15772.

Gene expression databases

ArrayExpressQ15772.
BgeeQ15772.
CleanExHS_SPEG.
GenevestigatorQ15772.

Family and domain databases

Gene3D2.60.40.10. 11 hits.
InterProIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF07679. I-set. 9 hits.
PF00069. Pkinase. 2 hits.
[Graphical view]
SMARTSM00060. FN3. 2 hits.
SM00409. IG. 3 hits.
SM00408. IGc2. 6 hits.
SM00220. S_TKc. 2 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 2 hits.
SSF56112. SSF56112. 2 hits.
PROSITEPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 8 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 2 hits.
PS00108. PROTEIN_KINASE_ST. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ15772.
GeneWikiSPEG.
GenomeRNAi10290.
NextBio38992.
PROQ15772.

Entry information

Entry nameSPEG_HUMAN
AccessionPrimary (citable) accession number: Q15772
Secondary accession number(s): A8K0G6 expand/collapse secondary AC list , A8MRU0, Q27J74, Q695L1, Q6FGA6, Q6ZQW1, Q6ZTL8, Q9P2P9
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 16, 2008
Last modified: July 9, 2014
This is version 137 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM