Q15772 (SPEG_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Striated muscle preferentially expressed protein kinase EC=2.7.11.1 Alternative name(s): Aortic preferentially expressed protein 1 Short name=APEG-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 3267 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis. Ref.1 Ref.8 |
| Induction | Isoform 3 is quickly down-regulated in response to vascular injury, when ASMC cells change from a quiescent to a proliferative phenotype. Ref.1 |
| Post-translational modification | May be autophosphorylated. |
| Miscellaneous | Expression is under the tight control of the locus control region (LCRs). |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Contains 2 fibronectin type-III domains. Contains 9 Ig-like (immunoglobulin-like) domains. Contains 2 protein kinase domains. |
| Sequence caution | The sequence AAY15052.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence ABD61734.1 differs from that shown. Reason: Frameshift at positions 31 and 35. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Differentiation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative promoter usage Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Disulfide bond Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | muscle cell differentiation Inferred from electronic annotation. Source: Compara muscle organ developmentTraceable author statement Ref.1. Source: ProtInc negative regulation of cell proliferationTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | nucleus Traceable author statement Ref.1. Source: ProtInc |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 4 (identifier: Q15772-5) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q15772-3) The sequence of this isoform differs from the canonical sequence as follows: 1-792: Missing. 961-962: AH → GE 963-3267: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q15772-4) Also known as: APEG1; The sequence of this isoform differs from the canonical sequence as follows: 1-849: Missing. 961-962: AH → GE 963-3267: Missing. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 1 (identifier: Q15772-1) Also known as: SPEG; The sequence of this isoform differs from the canonical sequence as follows: 3209-3267: LQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKEFLGEQRRRRAEAATRHKVLLRSYPGGP → SCLSVCHKEIKMASS | ||||||
| Note: Produced by alternative splicing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 3267 | 3267 | Striated muscle preferentially expressed protein kinase | PRO_0000072666 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 43 – 124 | 82 | Ig-like 1 | |||||||||||||||||||||||||
| Domain | 722 – 810 | 89 | Ig-like 2 | |||||||||||||||||||||||||
| Domain | 869 – 958 | 90 | Ig-like 3 | |||||||||||||||||||||||||
| Domain | 963 – 1057 | 95 | Ig-like 4 | |||||||||||||||||||||||||
| Domain | 1064 – 1152 | 89 | Ig-like 5 | |||||||||||||||||||||||||
| Domain | 1188 – 1278 | 91 | Ig-like 6 | |||||||||||||||||||||||||
| Domain | 1282 – 1377 | 96 | Fibronectin type-III 1 | |||||||||||||||||||||||||
| Domain | 1384 – 1480 | 97 | Ig-like 7 | |||||||||||||||||||||||||
| Domain | 1485 – 1573 | 89 | Ig-like 8 | |||||||||||||||||||||||||
| Domain | 1601 – 1854 | 254 | Protein kinase 1 | |||||||||||||||||||||||||
| Domain | 2583 – 2673 | 91 | Ig-like 9 | |||||||||||||||||||||||||
| Domain | 2678 – 2769 | 92 | Fibronectin type-III 2 | |||||||||||||||||||||||||
| Domain | 2966 – 3218 | 253 | Protein kinase 2 | |||||||||||||||||||||||||
| Nucleotide binding | 1607 – 1615 | 9 | ATP By similarity | |||||||||||||||||||||||||
| Nucleotide binding | 2972 – 2980 | 9 | ATP By similarity | |||||||||||||||||||||||||
| Compositional bias | 284 – 345 | 62 | Pro-rich | |||||||||||||||||||||||||
| Compositional bias | 525 – 634 | 110 | Pro-rich | |||||||||||||||||||||||||
| Compositional bias | 1919 – 1924 | 6 | Poly-Ser | |||||||||||||||||||||||||
| Compositional bias | 1925 – 1931 | 7 | Poly-Glu | |||||||||||||||||||||||||
| Compositional bias | 2175 – 2316 | 142 | Pro-rich | |||||||||||||||||||||||||
| Compositional bias | 2339 – 2503 | 165 | Arg-rich | |||||||||||||||||||||||||
| Compositional bias | 2786 – 2965 | 180 | Pro-rich | |||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||
| Active site | 1719 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||
| Active site | 3085 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||
| Binding site | 1630 | 1 | ATP By similarity | |||||||||||||||||||||||||
| Binding site | 2995 | 1 | ATP By similarity | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 313 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||
| Modified residue | 435 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||
| Modified residue | 476 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||
| Modified residue | 1172 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||
| Disulfide bond | 989 ↔ 1041 | By similarity | ||||||||||||||||||||||||||
| Disulfide bond | 2605 ↔ 2657 | By similarity | ||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 1 – 849 | 849 | Missing in isoform 3. | VSP_018258 | ||||||||||||||||||||||||
| Alternative sequence | 1 – 792 | 792 | Missing in isoform 2. | VSP_018259 | ||||||||||||||||||||||||
| Alternative sequence | 961 – 962 | 2 | AH → GE in isoform 2 and isoform 3. | VSP_018261 | ||||||||||||||||||||||||
| Alternative sequence | 963 – 3267 | 2305 | Missing in isoform 2 and isoform 3. | VSP_018262 | ||||||||||||||||||||||||
| Alternative sequence | 3209 – 3267 | 59 | LQDCL…YPGGP → SCLSVCHKEIKMASS in isoform 1. | VSP_036071 | ||||||||||||||||||||||||
| Natural variant | 206 | 1 | R → H. Ref.11 Corresponds to variant rs55821435 [ dbSNP | Ensembl ]. | VAR_041101 | ||||||||||||||||||||||||
| Natural variant | 934 | 1 | R → C. Ref.11 Corresponds to variant rs34398769 [ dbSNP | Ensembl ]. | VAR_041102 | ||||||||||||||||||||||||
| Natural variant | 966 | 1 | R → Q. Ref.11 Corresponds to variant rs34861443 [ dbSNP | Ensembl ]. | VAR_041103 | ||||||||||||||||||||||||
| Natural variant | 1103 | 1 | P → L. Ref.11 Corresponds to variant rs56334571 [ dbSNP | Ensembl ]. | VAR_041104 | ||||||||||||||||||||||||
| Natural variant | 1135 | 1 | A → V. Ref.11 Corresponds to variant rs55670811 [ dbSNP | Ensembl ]. | VAR_041105 | ||||||||||||||||||||||||
| Natural variant | 1178 | 1 | E → D in a gastric adenocarcinoma sample; somatic mutation. Ref.11 | VAR_041106 | ||||||||||||||||||||||||
| Natural variant | 1234 | 1 | R → W. Ref.11 Corresponds to variant rs55916864 [ dbSNP | Ensembl ]. | VAR_041107 | ||||||||||||||||||||||||
| Natural variant | 1340 | 1 | R → Q. Ref.11 Corresponds to variant rs34994343 [ dbSNP | Ensembl ]. | VAR_041108 | ||||||||||||||||||||||||
| Natural variant | 1621 | 1 | R → C. Ref.11 Corresponds to variant rs55646900 [ dbSNP | Ensembl ]. | VAR_041109 | ||||||||||||||||||||||||
| Natural variant | 1903 | 1 | R → W in an ovarian mucinous carcinoma sample; somatic mutation. Ref.11 | VAR_041110 | ||||||||||||||||||||||||
| Natural variant | 2189 | 1 | P → L. Corresponds to variant rs10755037 [ dbSNP | Ensembl ]. | VAR_059769 | ||||||||||||||||||||||||
| Natural variant | 2687 | 1 | P → T. Ref.8 Ref.9 Ref.11 Corresponds to variant rs13026308 [ dbSNP | Ensembl ]. | VAR_041111 | ||||||||||||||||||||||||
| Natural variant | 2742 | 1 | V → M in a gastric adenocarcinoma sample; somatic mutation. Ref.11 | VAR_041112 | ||||||||||||||||||||||||
| Natural variant | 3079 | 1 | H → R. Ref.11 Corresponds to variant rs12464085 [ dbSNP | Ensembl ]. | VAR_041113 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Sequence conflict | 71 | 1 | Q → H in ABD61734. Ref.7 | |||||||||||||||||||||||||
| Sequence conflict | 73 | 1 | S → I in ABD61734. Ref.7 | |||||||||||||||||||||||||
| Sequence conflict | 2047 | 1 | S → G in AAT80901. Ref.8 | |||||||||||||||||||||||||
| Sequence conflict | 2047 | 1 | S → G in BAA92535. Ref.9 | |||||||||||||||||||||||||
| Sequence conflict | 3005 | 1 | R → P in AAT80901. Ref.8 | |||||||||||||||||||||||||
| Sequence conflict | 3005 | 1 | R → P in BAA92535. Ref.9 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Beta strand | 867 – 873 | 7 | ||||||||||||||||||||||||||
| Beta strand | 878 – 881 | 4 | ||||||||||||||||||||||||||
| Beta strand | 886 – 896 | 11 | ||||||||||||||||||||||||||
| Beta strand | 899 – 904 | 6 | ||||||||||||||||||||||||||
| Beta strand | 915 – 919 | 5 | ||||||||||||||||||||||||||
| Helix | 921 – 923 | 3 | ||||||||||||||||||||||||||
| Beta strand | 924 – 931 | 8 | ||||||||||||||||||||||||||
| Helix | 934 – 936 | 3 | ||||||||||||||||||||||||||
| Beta strand | 938 – 946 | 9 | ||||||||||||||||||||||||||
| Beta strand | 949 – 960 | 12 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "APEG-1, a novel gene preferentially expressed in aortic smooth muscle cells, is down-regulated by vascular injury." Hsieh C.-M., Yoshizumi M., Endege W.O., Kho C.-J., Jain M.K., Kashiki S., de Los Santos R., Lee W.-S., Perrella M.A., Lee M.-E. J. Biol. Chem. 271:17354-17359(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Cerebellum and Uterus. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [7] | "The human desmin locus: gene organization and LCR-mediated transcriptional control." Tam J.L.Y., Triantaphyllopoulos K., Todd H., Raguz S., de Wit T., Morgan J.E., Partridge T.A., Makrinou E., Grosveld F., Antoniou M. Genomics 87:733-746(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 12-129 (ISOFORM 1), ALTERNATIVE PROMOTER USAGE. |
| [8] | "Orthologous relationship of obscurin and Unc-89: phylogeny of a novel family of tandem myosin light chain kinases." Sutter S.B., Raeker M.O., Borisov A.B., Russell M.W. Dev. Genes Evol. 214:352-359(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 130-3267 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT THR-2687. |
| [9] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 982-3267 (ISOFORM 1), VARIANT THR-2687. Tissue: Brain. |
| [10] | "X-ray structure of engineered human aortic preferentially expressed protein-1 (APEG-1)." Manjasetty B.A., Niesen F.H., Scheich C., Roske Y., Goetz F., Behlke J., Sievert V., Heinemann U., Bussow K. BMC Struct. Biol. 5:21-21(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (0.96 ANGSTROMS) OF 864-962, SUBUNIT. |
| [11] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-206; CYS-934; GLN-966; LEU-1103; VAL-1135; ASP-1178; TRP-1234; GLN-1340; CYS-1621; TRP-1903; THR-2687; MET-2742 AND ARG-3079. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U57099 mRNA. Translation: AAC50599.1. AK126500 mRNA. Translation: BAC86568.1. AK289531 mRNA. Translation: BAF82220.1. CR542201 mRNA. Translation: CAG46998.1. AC053503 Genomic DNA. Translation: AAY15052.1. Sequence problems. CH471063 Genomic DNA. Translation: EAW70747.1. BC006346 mRNA. Translation: AAH06346.1. DQ395348 mRNA. Translation: ABD61734.1. Frameshift. AY603755 mRNA. Translation: AAT80901.1. AB037718 mRNA. Translation: BAA92535.1. | ||||||||||||
| IPI | IPI00178729. IPI00658151. IPI00869082. IPI00915314. | ||||||||||||
| RefSeq | NP_001166947.1. NM_001173476.1. NP_005867.3. NM_005876.4. | ||||||||||||
| UniGene | Hs.21639. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q15772. | ||||||||||||
| SMR | Q15772. Positions 866-961. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q15772. 1 interaction. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q15772. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 218512143. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q15772. | ||||||||||||
| PRIDE | Q15772. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 10290. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000312358; ENSP00000311684; ENSG00000072195. ENST00000396686; ENSP00000379917; ENSG00000072195. ENST00000396688; ENSP00000379919; ENSG00000072195. ENST00000396689; ENSP00000379920; ENSG00000072195. ENST00000396695; ENSP00000379923; ENSG00000072195. | ||||||||||||
| GeneID | 10290. | ||||||||||||
| KEGG | hsa:10290. | ||||||||||||
| UCSC | uc002vln.1. human. uc002vlq.3. human. uc010fwg.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10290. | ||||||||||||
| GeneCards | GC02P220299. | ||||||||||||
| H-InvDB | HIX0002864. | ||||||||||||
| HGNC | HGNC:16901. SPEG. | ||||||||||||
| HPA | HPA018904. | ||||||||||||
| neXtProt | NX_Q15772. | ||||||||||||
| PharmGKB | PA142672598. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| HOVERGEN | HBG083339. | ||||||||||||
| KO | K08809. | ||||||||||||
| OMA | SAQLYVE. | ||||||||||||
| OrthoDB | EOG4J6RPZ. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q15772. | ||||||||||||
| Bgee | Q15772. | ||||||||||||
| CleanEx | HS_SPEG. | ||||||||||||
| Genevestigator | Q15772. | ||||||||||||
| GermOnline | ENSG00000072195. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.60.40.10. 11 hits. | ||||||||||||
| InterPro | IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR011009. Kinase-like_dom. IPR020675. Myosin_light_ch_kinase-rel. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR015726. Ser/Thr_kin_striated_muscle-sp. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||
| PANTHER | PTHR22964. PTHR22964. 1 hit. PTHR22964:SF9. PTHR22964:SF9. 1 hit. | ||||||||||||
| Pfam | PF07679. I-set. 9 hits. PF00069. Pkinase. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00060. FN3. 2 hits. SM00409. IG. 3 hits. SM00408. IGc2. 6 hits. SM00220. S_TKc. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF49265. FN_III-like. 2 hits. SSF56112. Kinase_like. 2 hits. | ||||||||||||
| PROSITE | PS50853. FN3. 2 hits. PS50835. IG_LIKE. 8 hits. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 2 hits. PS00108. PROTEIN_KINASE_ST. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q15772. | ||||||||||||
| GenomeRNAi | 10290. | ||||||||||||
| NextBio | 38992. | ||||||||||||
Entry information
| Entry name | SPEG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15772 Secondary accession number(s): A8K0G6 Q9P2P9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
