SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15772

- SPEG_HUMAN

UniProt

Q15772 - SPEG_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Striated muscle preferentially expressed protein kinase
Gene
SPEG, APEG1, KIAA1297
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei1630 – 16301ATP By similarity
Active sitei1719 – 17191Proton acceptor By similarity
Binding sitei2995 – 29951ATP By similarity
Active sitei3085 – 30851Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1607 – 16159ATP By similarity
Nucleotide bindingi2972 – 29809ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. protein serine/threonine kinase activity Source: UniProtKB-KW

GO - Biological processi

  1. cardiac muscle cell development Source: Ensembl
  2. in utero embryonic development Source: Ensembl
  3. muscle organ development Source: ProtInc
  4. negative regulation of cell proliferation Source: ProtInc
  5. respiratory system development Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Differentiation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ15772.

Names & Taxonomyi

Protein namesi
Recommended name:
Striated muscle preferentially expressed protein kinase (EC:2.7.11.1)
Alternative name(s):
Aortic preferentially expressed protein 1
Short name:
APEG-1
Gene namesi
Name:SPEG
Synonyms:APEG1, KIAA1297
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:16901. SPEG.

Subcellular locationi

Isoform 3 : Nucleus 1 Publication

GO - Cellular componenti

  1. nucleus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672598.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 32673267Striated muscle preferentially expressed protein kinase
PRO_0000072666Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi989 ↔ 1041 By similarity
Modified residuei1172 – 11721Phosphoserine By similarity
Disulfide bondi2605 ↔ 2657 By similarity

Post-translational modificationi

May be autophosphorylated.

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

MaxQBiQ15772.
PaxDbiQ15772.
PRIDEiQ15772.

PTM databases

PhosphoSiteiQ15772.

Expressioni

Tissue specificityi

Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis.2 Publications

Inductioni

Isoform 3 is quickly down-regulated in response to vascular injury, when ASMC cells change from a quiescent to a proliferative phenotype.1 Publication

Gene expression databases

ArrayExpressiQ15772.
BgeeiQ15772.
CleanExiHS_SPEG.
GenevestigatoriQ15772.

Organism-specific databases

HPAiHPA018904.

Interactioni

Subunit structurei

Isoform 3 is found as a monomer or homodimer.1 Publication

Protein-protein interaction databases

BioGridi115579. 3 interactions.
IntActiQ15772. 1 interaction.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi867 – 8737
Beta strandi878 – 8814
Beta strandi886 – 89611
Beta strandi899 – 9046
Beta strandi915 – 9195
Helixi921 – 9233
Beta strandi924 – 9318
Helixi934 – 9363
Beta strandi938 – 9469
Beta strandi949 – 96012

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1U2HX-ray0.96A864-960[»]
ProteinModelPortaliQ15772.
SMRiQ15772. Positions 866-961.

Miscellaneous databases

EvolutionaryTraceiQ15772.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini43 – 12482Ig-like 1
Add
BLAST
Domaini722 – 81089Ig-like 2
Add
BLAST
Domaini869 – 95890Ig-like 3
Add
BLAST
Domaini963 – 105795Ig-like 4
Add
BLAST
Domaini1064 – 115289Ig-like 5
Add
BLAST
Domaini1188 – 127891Ig-like 6
Add
BLAST
Domaini1285 – 138298Fibronectin type-III 1
Add
BLAST
Domaini1384 – 148097Ig-like 7
Add
BLAST
Domaini1485 – 157389Ig-like 8
Add
BLAST
Domaini1601 – 1854254Protein kinase 1
Add
BLAST
Domaini2583 – 267391Ig-like 9
Add
BLAST
Domaini2680 – 277495Fibronectin type-III 2
Add
BLAST
Domaini2966 – 3218253Protein kinase 2
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi284 – 34562Pro-rich
Add
BLAST
Compositional biasi525 – 634110Pro-rich
Add
BLAST
Compositional biasi1919 – 19246Poly-Ser
Compositional biasi1925 – 19317Poly-Glu
Compositional biasi2175 – 2316142Pro-rich
Add
BLAST
Compositional biasi2339 – 2503165Arg-rich
Add
BLAST
Compositional biasi2786 – 2965180Pro-rich
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG083339.
KOiK08809.
OMAiQYRDVHR.
OrthoDBiEOG7QC7V5.
PhylomeDBiQ15772.
TreeFamiTF331962.

Family and domain databases

Gene3Di2.60.40.10. 11 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF07679. I-set. 9 hits.
PF00069. Pkinase. 2 hits.
[Graphical view]
SMARTiSM00060. FN3. 2 hits.
SM00409. IG. 3 hits.
SM00408. IGc2. 6 hits.
SM00220. S_TKc. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
SSF56112. SSF56112. 2 hits.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 8 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 2 hits.
PS00108. PROTEIN_KINASE_ST. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

Isoform 4 (identifier: Q15772-5) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQKARGTRGE DAGTRAPPSP GVPPKRAKVG AGGGAPVAVA GAPVFLRPLK     50
NAAVCAGSDV RLRVVVSGTP QPSLRWFRDG QLLPAPAPEP SCLWLRRCGA 100
QDAGVYSCMA QNERGRASCE AVLTVLEVGD SETAEDDISD VQGTQRLELR 150
DDGAFSTPTG GSDTLVGTSL DTPPTSVTGT SEEQVSWWGS GQTVLEQEAG 200
SGGGTRRLPG SPRQAQATGA GPRHLGVEPL VRASRANLVG ASWGSEDSLS 250
VASDLYGSAF SLYRGRALSI HVSVPQSGLR REEPDLQPQL ASEAPRRPAQ 300
PPPSKSALLP PPSPRVGKRS PPGPPAQPAA TPTSPHRRTQ EPVLPEDTTT 350
EEKRGKKSKS SGPSLAGTAE SRPQTPLSEA SGRLSALGRS PRLVRAGSRI 400
LDKLQFFEER RRSLERSDSP PAPLRPWVPL RKARSLEQPK SERGAPWGTP 450
GASQEELRAP GSVAERRRLF QQKAASLDER TRQRSPASDL ELRFAQELGR 500
IRRSTSREEL VRSHESLRAT LQRAPSPREP GEPPLFSRPS TPKTSRAVSP 550
AAAQPPSPSS AEKPGDEPGR PRSRGPAGRT EPGEGPQQEV RRRDQFPLTR 600
SRAIQECRSP VPPPAADPPE ARTKAPPGRK REPPAQAVRF LPWATPGLEG 650
AAVPQTLEKN RAGPEAEKRL RRGPEEDGPW GPWDRRGARS QGKGRRARPT 700
SPELESSDDS YVSAGEEPLE APVFEIPLQN VVVAPGADVL LKCIITANPP 750
PQVSWHKDGS ALRSEGRLLL RAEGERHTLL LREARAADAG SYMATATNEL 800
GQATCAASLT VRPGGSTSPF SSPITSDEEY LSPPEEFPEP GETWPRTPTM 850
KPSPSQNRRS SDTGSKAPPT FKVSLMDQSV REGQDVIMSI RVQGEPKPVV 900
SWLRNRQPVR PDQRRFAEEA EGGLCRLRIL AAERGDAGFY TCKAVNEYGA 950
RQCEARLEVR AHPESRSLAV LAPLQDVDVG AGEMALFECL VAGPTDVEVD 1000
WLCRGRLLQP ALLKCKMHFD GRKCKLLLTS VHEDDSGVYT CKLSTAKDEL 1050
TCSARLTVRP SLAPLFTRLL EDVEVLEGRA ARFDCKISGT PPPVVTWTHF 1100
GCPMEESENL RLRQDGGLHS LHIAHVGSED EGLYAVSAVN THGQAHCSAQ 1150
LYVEEPRTAA SGPSSKLEKM PSIPEEPEQG ELERLSIPDF LRPLQDLEVG 1200
LAKEAMLECQ VTGLPYPTIS WFHNGHRIQS SDDRRMTQYR DVHRLVFPAV 1250
GPQHAGVYKS VIANKLGKAA CYAHLYVTDV VPGPPDGAPQ VVAVTGRMVT 1300
LTWNPPRSLD MAIDPDSLTY TVQHQVLGSD QWTALVTGLR EPGWAATGLR 1350
KGVQHIFRVL STTVKSSSKP SPPSEPVQLL EHGPTLEEAP AMLDKPDIVY 1400
VVEGQPASVT VTFNHVEAQV VWRSCRGALL EARAGVYELS QPDDDQYCLR 1450
ICRVSRRDMG ALTCTARNRH GTQTCSVTLE LAEAPRFESI MEDVEVGAGE 1500
TARFAVVVEG KPLPDIMWYK DEVLLTESSH VSFVYEENEC SLVVLSTGAQ 1550
DGGVYTCTAQ NLAGEVSCKA ELAVHSAQTA MEVEGVGEDE DHRGRRLSDF 1600
YDIHQEIGRG AFSYLRRIVE RSSGLEFAAK FIPSQAKPKA SARREARLLA 1650
RLQHDCVLYF HEAFERRRGL VIVTELCTEE LLERIARKPT VCESEIRAYM 1700
RQVLEGIHYL HQSHVLHLDV KPENLLVWDG AAGEQQVRIC DFGNAQELTP 1750
GEPQYCQYGT PEFVAPEIVN QSPVSGVTDI WPVGVVAFLC LTGISPFVGE 1800
NDRTTLMNIR NYNVAFEETT FLSLSREARG FLIKVLVQDR LRPTAEETLE 1850
HPWFKTQAKG AEVSTDHLKL FLSRRRWQRS QISYKCHLVL RPIPELLRAP 1900
PERVWVTMPR RPPPSGGLSS SSDSEEEELE ELPSVPRPLQ PEFSGSRVSL 1950
TDIPTEDEAL GTPETGAATP MDWQEQGRAP SQDQEAPSPE ALPSPGQEPA 2000
AGASPRRGEL RRGSSAESAL PRAGPRELGR GLHKAASVEL PQRRSPSPGA 2050
TRLARGGLGE GEYAQRLQAL RQRLLRGGPE DGKVSGLRGP LLESLGGRAR 2100
DPRMARAASS EAAPHHQPPL ENRGLQKSSS FSQGEAEPRG RHRRAGAPLE 2150
IPVARLGARR LQESPSLSAL SEAQPSSPAR PSAPKPSTPK SAEPSATTPS 2200
DAPQPPAPQP AQDKAPEPRP EPVRASKPAP PPQALQTLAL PLTPYAQIIQ 2250
SLQLSGHAQG PSQGPAAPPS EPKPHAAVFA RVASPPPGAP EKRVPSAGGP 2300
PVLAEKARVP TVPPRPGSSL SSSIENLESE AVFEAKFKRS RESPLSLGLR 2350
LLSRSRSEER GPFRGAEEED GIYRPSPAGT PLELVRRPER SRSVQDLRAV 2400
GEPGLVRRLS LSLSQRLRRT PPAQRHPAWE ARGGDGESSE GGSSARGSPV 2450
LAMRRRLSFT LERLSSRLQR SGSSEDSGGA SGRSTPLFGR LRRATSEGES 2500
LRRLGLPHNQ LAAQAGATTP SAESLGSEAS ATSGSSAPGE SRSRLRWGFS 2550
RPRKDKGLSP PNLSASVQEE LGHQYVRSES DFPPVFHIKL KDQVLLEGEA 2600
ATLLCLPAAC PAPHISWMKD KKSLRSEPSV IIVSCKDGRQ LLSIPRAGKR 2650
HAGLYECSAT NVLGSITSSC TVAVARVPGK LAPPEVPQTY QDTALVLWKP 2700
GDSRAPCTYT LERRVDGESV WHPVSSGIPD CYYNVTHLPV GVTVRFRVAC 2750
ANRAGQGPFS NSSEKVFVRG TQDSSAVPSA AHQEAPVTSR PARARPPDSP 2800
TSLAPPLAPA APTPPSVTVS PSSPPTPPSQ ALSSLKAVGP PPQTPPRRHR 2850
GLQAARPAEP TLPSTHVTPS EPKPFVLDTG TPIPASTPQG VKPVSSSTPV 2900
YVVTSFVSAP PAPEPPAPEP PPEPTKVTVQ SLSPAKEVVS SPGSSPRSSP 2950
RPEGTTLRQG PPQKPYTFLE EKARGRFGVV RACRENATGR TFVAKIVPYA 3000
AEGKRRVLQE YEVLRTLHHE RIMSLHEAYI TPRYLVLIAE SCGNRELLCG 3050
LSDRFRYSED DVATYMVQLL QGLDYLHGHH VLHLDIKPDN LLLAPDNALK 3100
IVDFGSAQPY NPQALRPLGH RTGTLEFMAP EMVKGEPIGS ATDIWGAGVL 3150
TYIMLSGRSP FYEPDPQETE ARIVGGRFDA FQLYPNTSQS ATLFLRKVLS 3200
VHPWSRPSLQ DCLAHPWLQD AYLMKLRRQT LTFTTNRLKE FLGEQRRRRA 3250
EAATRHKVLL RSYPGGP 3267

Note: No experimental confirmation available.

Length:3,267
Mass (Da):354,289
Last modified:December 16, 2008 - v4
Checksum:iE67BEB5624144233
GO
Isoform 2 (identifier: Q15772-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-792: Missing.
     961-962: AH → GE
     963-3267: Missing.

Note: No experimental confirmation available.

Show »
Length:170
Mass (Da):18,673
Checksum:i275949922564F798
GO
Isoform 3 (identifier: Q15772-4) [UniParc]FASTAAdd to Basket

Also known as: APEG1

The sequence of this isoform differs from the canonical sequence as follows:
     1-849: Missing.
     961-962: AH → GE
     963-3267: Missing.

Note: Produced by alternative promoter usage.

Show »
Length:113
Mass (Da):12,692
Checksum:i04F367263A1397C5
GO
Isoform 1 (identifier: Q15772-1) [UniParc]FASTAAdd to Basket

Also known as: SPEG

The sequence of this isoform differs from the canonical sequence as follows:
     3209-3267: LQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKEFLGEQRRRRAEAATRHKVLLRSYPGGP → SCLSVCHKEIKMASS

Note: Produced by alternative splicing.

Show »
Length:3,223
Mass (Da):348,903
Checksum:iFBF1188F9F1B883A
GO

Sequence cautioni

The sequence ABD61734.1 differs from that shown. Reason: Frameshift at positions 31 and 35.
The sequence AAY15052.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti206 – 2061R → H.1 Publication
Corresponds to variant rs55821435 [ dbSNP | Ensembl ].
VAR_041101
Natural varianti934 – 9341R → C.1 Publication
Corresponds to variant rs34398769 [ dbSNP | Ensembl ].
VAR_041102
Natural varianti966 – 9661R → Q.1 Publication
Corresponds to variant rs34861443 [ dbSNP | Ensembl ].
VAR_041103
Natural varianti1103 – 11031P → L.1 Publication
Corresponds to variant rs56334571 [ dbSNP | Ensembl ].
VAR_041104
Natural varianti1135 – 11351A → V.1 Publication
Corresponds to variant rs55670811 [ dbSNP | Ensembl ].
VAR_041105
Natural varianti1178 – 11781E → D in a gastric adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041106
Natural varianti1234 – 12341R → W.1 Publication
Corresponds to variant rs55916864 [ dbSNP | Ensembl ].
VAR_041107
Natural varianti1340 – 13401R → Q.1 Publication
Corresponds to variant rs34994343 [ dbSNP | Ensembl ].
VAR_041108
Natural varianti1621 – 16211R → C.1 Publication
Corresponds to variant rs55646900 [ dbSNP | Ensembl ].
VAR_041109
Natural varianti1903 – 19031R → W in an ovarian mucinous carcinoma sample; somatic mutation. 1 Publication
VAR_041110
Natural varianti2189 – 21891P → L.
Corresponds to variant rs10755037 [ dbSNP | Ensembl ].
VAR_059769
Natural varianti2687 – 26871P → T.3 Publications
Corresponds to variant rs13026308 [ dbSNP | Ensembl ].
VAR_041111
Natural varianti2742 – 27421V → M in a gastric adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041112
Natural varianti3079 – 30791H → R.1 Publication
Corresponds to variant rs12464085 [ dbSNP | Ensembl ].
VAR_041113

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 849849Missing in isoform 3.
VSP_018258Add
BLAST
Alternative sequencei1 – 792792Missing in isoform 2.
VSP_018259Add
BLAST
Alternative sequencei961 – 9622AH → GE in isoform 2 and isoform 3.
VSP_018261
Alternative sequencei963 – 32672305Missing in isoform 2 and isoform 3.
VSP_018262Add
BLAST
Alternative sequencei3209 – 326759LQDCL…YPGGP → SCLSVCHKEIKMASS in isoform 1.
VSP_036071Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti71 – 711Q → H in ABD61734. 1 Publication
Sequence conflicti73 – 731S → I in ABD61734. 1 Publication
Sequence conflicti2047 – 20471S → G in AAT80901. 1 Publication
Sequence conflicti2047 – 20471S → G in BAA92535. 1 Publication
Sequence conflicti3005 – 30051R → P in AAT80901. 1 Publication
Sequence conflicti3005 – 30051R → P in BAA92535. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U57099 mRNA. Translation: AAC50599.1.
AK126500 mRNA. Translation: BAC86568.1.
AK289531 mRNA. Translation: BAF82220.1.
CR542201 mRNA. Translation: CAG46998.1.
AC053503 Genomic DNA. Translation: AAY15052.1. Sequence problems.
CH471063 Genomic DNA. Translation: EAW70747.1.
BC006346 mRNA. Translation: AAH06346.1.
DQ395348 mRNA. Translation: ABD61734.1. Frameshift.
AY603755 mRNA. Translation: AAT80901.1.
AB037718 mRNA. Translation: BAA92535.1.
CCDSiCCDS42824.1. [Q15772-5]
CCDS54432.1. [Q15772-4]
RefSeqiNP_001166947.1. NM_001173476.1. [Q15772-4]
NP_005867.3. NM_005876.4. [Q15772-5]
UniGeneiHs.21639.

Genome annotation databases

EnsembliENST00000312358; ENSP00000311684; ENSG00000072195. [Q15772-5]
ENST00000396686; ENSP00000379917; ENSG00000072195. [Q15772-4]
ENST00000396688; ENSP00000379919; ENSG00000072195. [Q15772-4]
ENST00000396689; ENSP00000379920; ENSG00000072195. [Q15772-4]
ENST00000396695; ENSP00000379923; ENSG00000072195. [Q15772-3]
GeneIDi10290.
KEGGihsa:10290.
UCSCiuc002vln.1. human. [Q15772-3]
uc002vlq.3. human. [Q15772-4]
uc010fwg.3. human. [Q15772-5]

Polymorphism databases

DMDMi218512143.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U57099 mRNA. Translation: AAC50599.1 .
AK126500 mRNA. Translation: BAC86568.1 .
AK289531 mRNA. Translation: BAF82220.1 .
CR542201 mRNA. Translation: CAG46998.1 .
AC053503 Genomic DNA. Translation: AAY15052.1 . Sequence problems.
CH471063 Genomic DNA. Translation: EAW70747.1 .
BC006346 mRNA. Translation: AAH06346.1 .
DQ395348 mRNA. Translation: ABD61734.1 . Frameshift.
AY603755 mRNA. Translation: AAT80901.1 .
AB037718 mRNA. Translation: BAA92535.1 .
CCDSi CCDS42824.1. [Q15772-5 ]
CCDS54432.1. [Q15772-4 ]
RefSeqi NP_001166947.1. NM_001173476.1. [Q15772-4 ]
NP_005867.3. NM_005876.4. [Q15772-5 ]
UniGenei Hs.21639.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1U2H X-ray 0.96 A 864-960 [» ]
ProteinModelPortali Q15772.
SMRi Q15772. Positions 866-961.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115579. 3 interactions.
IntActi Q15772. 1 interaction.

PTM databases

PhosphoSitei Q15772.

Polymorphism databases

DMDMi 218512143.

Proteomic databases

MaxQBi Q15772.
PaxDbi Q15772.
PRIDEi Q15772.

Protocols and materials databases

DNASUi 10290.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000312358 ; ENSP00000311684 ; ENSG00000072195 . [Q15772-5 ]
ENST00000396686 ; ENSP00000379917 ; ENSG00000072195 . [Q15772-4 ]
ENST00000396688 ; ENSP00000379919 ; ENSG00000072195 . [Q15772-4 ]
ENST00000396689 ; ENSP00000379920 ; ENSG00000072195 . [Q15772-4 ]
ENST00000396695 ; ENSP00000379923 ; ENSG00000072195 . [Q15772-3 ]
GeneIDi 10290.
KEGGi hsa:10290.
UCSCi uc002vln.1. human. [Q15772-3 ]
uc002vlq.3. human. [Q15772-4 ]
uc010fwg.3. human. [Q15772-5 ]

Organism-specific databases

CTDi 10290.
GeneCardsi GC02P220299.
H-InvDB HIX0002864.
HGNCi HGNC:16901. SPEG.
HPAi HPA018904.
neXtProti NX_Q15772.
PharmGKBi PA142672598.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG083339.
KOi K08809.
OMAi QYRDVHR.
OrthoDBi EOG7QC7V5.
PhylomeDBi Q15772.
TreeFami TF331962.

Enzyme and pathway databases

SignaLinki Q15772.

Miscellaneous databases

EvolutionaryTracei Q15772.
GeneWikii SPEG.
GenomeRNAii 10290.
NextBioi 38992.
PROi Q15772.

Gene expression databases

ArrayExpressi Q15772.
Bgeei Q15772.
CleanExi HS_SPEG.
Genevestigatori Q15772.

Family and domain databases

Gene3Di 2.60.40.10. 11 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF07679. I-set. 9 hits.
PF00069. Pkinase. 2 hits.
[Graphical view ]
SMARTi SM00060. FN3. 2 hits.
SM00409. IG. 3 hits.
SM00408. IGc2. 6 hits.
SM00220. S_TKc. 2 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
SSF56112. SSF56112. 2 hits.
PROSITEi PS50853. FN3. 2 hits.
PS50835. IG_LIKE. 8 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 2 hits.
PS00108. PROTEIN_KINASE_ST. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "APEG-1, a novel gene preferentially expressed in aortic smooth muscle cells, is down-regulated by vascular injury."
    Hsieh C.-M., Yoshizumi M., Endege W.O., Kho C.-J., Jain M.K., Kashiki S., de Los Santos R., Lee W.-S., Perrella M.A., Lee M.-E.
    J. Biol. Chem. 271:17354-17359(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Cerebellum and Uterus.
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  7. "The human desmin locus: gene organization and LCR-mediated transcriptional control."
    Tam J.L.Y., Triantaphyllopoulos K., Todd H., Raguz S., de Wit T., Morgan J.E., Partridge T.A., Makrinou E., Grosveld F., Antoniou M.
    Genomics 87:733-746(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 12-129 (ISOFORM 1), ALTERNATIVE PROMOTER USAGE.
  8. "Orthologous relationship of obscurin and Unc-89: phylogeny of a novel family of tandem myosin light chain kinases."
    Sutter S.B., Raeker M.O., Borisov A.B., Russell M.W.
    Dev. Genes Evol. 214:352-359(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 130-3267 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT THR-2687.
  9. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 982-3267 (ISOFORM 1), VARIANT THR-2687.
    Tissue: Brain.
  10. "X-ray structure of engineered human aortic preferentially expressed protein-1 (APEG-1)."
    Manjasetty B.A., Niesen F.H., Scheich C., Roske Y., Goetz F., Behlke J., Sievert V., Heinemann U., Bussow K.
    BMC Struct. Biol. 5:21-21(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (0.96 ANGSTROMS) OF 864-962, SUBUNIT.
  11. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-206; CYS-934; GLN-966; LEU-1103; VAL-1135; ASP-1178; TRP-1234; GLN-1340; CYS-1621; TRP-1903; THR-2687; MET-2742 AND ARG-3079.

Entry informationi

Entry nameiSPEG_HUMAN
AccessioniPrimary (citable) accession number: Q15772
Secondary accession number(s): A8K0G6
, A8MRU0, Q27J74, Q695L1, Q6FGA6, Q6ZQW1, Q6ZTL8, Q9P2P9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 16, 2008
Last modified: July 9, 2014
This is version 137 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Expression is under the tight control of the locus control region (LCRs).

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi