Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q15772

- SPEG_HUMAN

UniProt

Q15772 - SPEG_HUMAN

Protein

Striated muscle preferentially expressed protein kinase

Gene

SPEG

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 4 (16 Dec 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei1630 – 16301ATPPROSITE-ProRule annotation
    Active sitei1719 – 17191Proton acceptorBy similarity
    Binding sitei2995 – 29951ATPPROSITE-ProRule annotation
    Active sitei3085 – 30851Proton acceptorBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi1607 – 16159ATPPROSITE-ProRule annotation
    Nucleotide bindingi2972 – 29809ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. protein serine/threonine kinase activity Source: UniProtKB-KW

    GO - Biological processi

    1. cardiac muscle cell development Source: Ensembl
    2. in utero embryonic development Source: Ensembl
    3. muscle organ development Source: ProtInc
    4. negative regulation of cell proliferation Source: ProtInc
    5. respiratory system development Source: Ensembl

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Biological processi

    Differentiation

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    SignaLinkiQ15772.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Striated muscle preferentially expressed protein kinase (EC:2.7.11.1)
    Alternative name(s):
    Aortic preferentially expressed protein 1
    Short name:
    APEG-1
    Gene namesi
    Name:SPEG
    Synonyms:APEG1, KIAA1297
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:16901. SPEG.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: ProtInc

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672598.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 32673267Striated muscle preferentially expressed protein kinasePRO_0000072666Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi989 ↔ 1041PROSITE-ProRule annotation
    Modified residuei1172 – 11721PhosphoserineBy similarity
    Disulfide bondi2605 ↔ 2657PROSITE-ProRule annotation

    Post-translational modificationi

    May be autophosphorylated.

    Keywords - PTMi

    Disulfide bond, Phosphoprotein

    Proteomic databases

    MaxQBiQ15772.
    PaxDbiQ15772.
    PRIDEiQ15772.

    PTM databases

    PhosphoSiteiQ15772.

    Expressioni

    Tissue specificityi

    Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis.2 Publications

    Inductioni

    Isoform 3 is quickly down-regulated in response to vascular injury, when ASMC cells change from a quiescent to a proliferative phenotype.1 Publication

    Gene expression databases

    ArrayExpressiQ15772.
    BgeeiQ15772.
    CleanExiHS_SPEG.
    GenevestigatoriQ15772.

    Organism-specific databases

    HPAiHPA018904.

    Interactioni

    Subunit structurei

    Isoform 3 is found as a monomer or homodimer.1 Publication

    Protein-protein interaction databases

    BioGridi115579. 3 interactions.
    IntActiQ15772. 1 interaction.

    Structurei

    Secondary structure

    1
    3267
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi867 – 8737
    Beta strandi878 – 8814
    Beta strandi886 – 89611
    Beta strandi899 – 9046
    Beta strandi915 – 9195
    Helixi921 – 9233
    Beta strandi924 – 9318
    Helixi934 – 9363
    Beta strandi938 – 9469
    Beta strandi949 – 96012

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1U2HX-ray0.96A864-960[»]
    ProteinModelPortaliQ15772.
    SMRiQ15772. Positions 866-961.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ15772.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini43 – 12482Ig-like 1Add
    BLAST
    Domaini722 – 81089Ig-like 2Add
    BLAST
    Domaini869 – 95890Ig-like 3Add
    BLAST
    Domaini963 – 105795Ig-like 4Add
    BLAST
    Domaini1064 – 115289Ig-like 5Add
    BLAST
    Domaini1188 – 127891Ig-like 6Add
    BLAST
    Domaini1285 – 138298Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1384 – 148097Ig-like 7Add
    BLAST
    Domaini1485 – 157389Ig-like 8Add
    BLAST
    Domaini1601 – 1854254Protein kinase 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini2583 – 267391Ig-like 9Add
    BLAST
    Domaini2680 – 277495Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini2966 – 3218253Protein kinase 2PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi284 – 34562Pro-richAdd
    BLAST
    Compositional biasi525 – 634110Pro-richAdd
    BLAST
    Compositional biasi1919 – 19246Poly-Ser
    Compositional biasi1925 – 19317Poly-Glu
    Compositional biasi2175 – 2316142Pro-richAdd
    BLAST
    Compositional biasi2339 – 2503165Arg-richAdd
    BLAST
    Compositional biasi2786 – 2965180Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation
    Contains 2 protein kinase domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat

    Phylogenomic databases

    eggNOGiCOG0515.
    HOVERGENiHBG083339.
    KOiK08809.
    OMAiQYRDVHR.
    OrthoDBiEOG7QC7V5.
    PhylomeDBiQ15772.
    TreeFamiTF331962.

    Family and domain databases

    Gene3Di2.60.40.10. 11 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF07679. I-set. 9 hits.
    PF00069. Pkinase. 2 hits.
    [Graphical view]
    SMARTiSM00060. FN3. 2 hits.
    SM00409. IG. 3 hits.
    SM00408. IGc2. 6 hits.
    SM00220. S_TKc. 2 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 2 hits.
    SSF56112. SSF56112. 2 hits.
    PROSITEiPS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 8 hits.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 2 hits.
    PS00108. PROTEIN_KINASE_ST. 2 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Isoform 4 (identifier: Q15772-5) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQKARGTRGE DAGTRAPPSP GVPPKRAKVG AGGGAPVAVA GAPVFLRPLK     50
    NAAVCAGSDV RLRVVVSGTP QPSLRWFRDG QLLPAPAPEP SCLWLRRCGA 100
    QDAGVYSCMA QNERGRASCE AVLTVLEVGD SETAEDDISD VQGTQRLELR 150
    DDGAFSTPTG GSDTLVGTSL DTPPTSVTGT SEEQVSWWGS GQTVLEQEAG 200
    SGGGTRRLPG SPRQAQATGA GPRHLGVEPL VRASRANLVG ASWGSEDSLS 250
    VASDLYGSAF SLYRGRALSI HVSVPQSGLR REEPDLQPQL ASEAPRRPAQ 300
    PPPSKSALLP PPSPRVGKRS PPGPPAQPAA TPTSPHRRTQ EPVLPEDTTT 350
    EEKRGKKSKS SGPSLAGTAE SRPQTPLSEA SGRLSALGRS PRLVRAGSRI 400
    LDKLQFFEER RRSLERSDSP PAPLRPWVPL RKARSLEQPK SERGAPWGTP 450
    GASQEELRAP GSVAERRRLF QQKAASLDER TRQRSPASDL ELRFAQELGR 500
    IRRSTSREEL VRSHESLRAT LQRAPSPREP GEPPLFSRPS TPKTSRAVSP 550
    AAAQPPSPSS AEKPGDEPGR PRSRGPAGRT EPGEGPQQEV RRRDQFPLTR 600
    SRAIQECRSP VPPPAADPPE ARTKAPPGRK REPPAQAVRF LPWATPGLEG 650
    AAVPQTLEKN RAGPEAEKRL RRGPEEDGPW GPWDRRGARS QGKGRRARPT 700
    SPELESSDDS YVSAGEEPLE APVFEIPLQN VVVAPGADVL LKCIITANPP 750
    PQVSWHKDGS ALRSEGRLLL RAEGERHTLL LREARAADAG SYMATATNEL 800
    GQATCAASLT VRPGGSTSPF SSPITSDEEY LSPPEEFPEP GETWPRTPTM 850
    KPSPSQNRRS SDTGSKAPPT FKVSLMDQSV REGQDVIMSI RVQGEPKPVV 900
    SWLRNRQPVR PDQRRFAEEA EGGLCRLRIL AAERGDAGFY TCKAVNEYGA 950
    RQCEARLEVR AHPESRSLAV LAPLQDVDVG AGEMALFECL VAGPTDVEVD 1000
    WLCRGRLLQP ALLKCKMHFD GRKCKLLLTS VHEDDSGVYT CKLSTAKDEL 1050
    TCSARLTVRP SLAPLFTRLL EDVEVLEGRA ARFDCKISGT PPPVVTWTHF 1100
    GCPMEESENL RLRQDGGLHS LHIAHVGSED EGLYAVSAVN THGQAHCSAQ 1150
    LYVEEPRTAA SGPSSKLEKM PSIPEEPEQG ELERLSIPDF LRPLQDLEVG 1200
    LAKEAMLECQ VTGLPYPTIS WFHNGHRIQS SDDRRMTQYR DVHRLVFPAV 1250
    GPQHAGVYKS VIANKLGKAA CYAHLYVTDV VPGPPDGAPQ VVAVTGRMVT 1300
    LTWNPPRSLD MAIDPDSLTY TVQHQVLGSD QWTALVTGLR EPGWAATGLR 1350
    KGVQHIFRVL STTVKSSSKP SPPSEPVQLL EHGPTLEEAP AMLDKPDIVY 1400
    VVEGQPASVT VTFNHVEAQV VWRSCRGALL EARAGVYELS QPDDDQYCLR 1450
    ICRVSRRDMG ALTCTARNRH GTQTCSVTLE LAEAPRFESI MEDVEVGAGE 1500
    TARFAVVVEG KPLPDIMWYK DEVLLTESSH VSFVYEENEC SLVVLSTGAQ 1550
    DGGVYTCTAQ NLAGEVSCKA ELAVHSAQTA MEVEGVGEDE DHRGRRLSDF 1600
    YDIHQEIGRG AFSYLRRIVE RSSGLEFAAK FIPSQAKPKA SARREARLLA 1650
    RLQHDCVLYF HEAFERRRGL VIVTELCTEE LLERIARKPT VCESEIRAYM 1700
    RQVLEGIHYL HQSHVLHLDV KPENLLVWDG AAGEQQVRIC DFGNAQELTP 1750
    GEPQYCQYGT PEFVAPEIVN QSPVSGVTDI WPVGVVAFLC LTGISPFVGE 1800
    NDRTTLMNIR NYNVAFEETT FLSLSREARG FLIKVLVQDR LRPTAEETLE 1850
    HPWFKTQAKG AEVSTDHLKL FLSRRRWQRS QISYKCHLVL RPIPELLRAP 1900
    PERVWVTMPR RPPPSGGLSS SSDSEEEELE ELPSVPRPLQ PEFSGSRVSL 1950
    TDIPTEDEAL GTPETGAATP MDWQEQGRAP SQDQEAPSPE ALPSPGQEPA 2000
    AGASPRRGEL RRGSSAESAL PRAGPRELGR GLHKAASVEL PQRRSPSPGA 2050
    TRLARGGLGE GEYAQRLQAL RQRLLRGGPE DGKVSGLRGP LLESLGGRAR 2100
    DPRMARAASS EAAPHHQPPL ENRGLQKSSS FSQGEAEPRG RHRRAGAPLE 2150
    IPVARLGARR LQESPSLSAL SEAQPSSPAR PSAPKPSTPK SAEPSATTPS 2200
    DAPQPPAPQP AQDKAPEPRP EPVRASKPAP PPQALQTLAL PLTPYAQIIQ 2250
    SLQLSGHAQG PSQGPAAPPS EPKPHAAVFA RVASPPPGAP EKRVPSAGGP 2300
    PVLAEKARVP TVPPRPGSSL SSSIENLESE AVFEAKFKRS RESPLSLGLR 2350
    LLSRSRSEER GPFRGAEEED GIYRPSPAGT PLELVRRPER SRSVQDLRAV 2400
    GEPGLVRRLS LSLSQRLRRT PPAQRHPAWE ARGGDGESSE GGSSARGSPV 2450
    LAMRRRLSFT LERLSSRLQR SGSSEDSGGA SGRSTPLFGR LRRATSEGES 2500
    LRRLGLPHNQ LAAQAGATTP SAESLGSEAS ATSGSSAPGE SRSRLRWGFS 2550
    RPRKDKGLSP PNLSASVQEE LGHQYVRSES DFPPVFHIKL KDQVLLEGEA 2600
    ATLLCLPAAC PAPHISWMKD KKSLRSEPSV IIVSCKDGRQ LLSIPRAGKR 2650
    HAGLYECSAT NVLGSITSSC TVAVARVPGK LAPPEVPQTY QDTALVLWKP 2700
    GDSRAPCTYT LERRVDGESV WHPVSSGIPD CYYNVTHLPV GVTVRFRVAC 2750
    ANRAGQGPFS NSSEKVFVRG TQDSSAVPSA AHQEAPVTSR PARARPPDSP 2800
    TSLAPPLAPA APTPPSVTVS PSSPPTPPSQ ALSSLKAVGP PPQTPPRRHR 2850
    GLQAARPAEP TLPSTHVTPS EPKPFVLDTG TPIPASTPQG VKPVSSSTPV 2900
    YVVTSFVSAP PAPEPPAPEP PPEPTKVTVQ SLSPAKEVVS SPGSSPRSSP 2950
    RPEGTTLRQG PPQKPYTFLE EKARGRFGVV RACRENATGR TFVAKIVPYA 3000
    AEGKRRVLQE YEVLRTLHHE RIMSLHEAYI TPRYLVLIAE SCGNRELLCG 3050
    LSDRFRYSED DVATYMVQLL QGLDYLHGHH VLHLDIKPDN LLLAPDNALK 3100
    IVDFGSAQPY NPQALRPLGH RTGTLEFMAP EMVKGEPIGS ATDIWGAGVL 3150
    TYIMLSGRSP FYEPDPQETE ARIVGGRFDA FQLYPNTSQS ATLFLRKVLS 3200
    VHPWSRPSLQ DCLAHPWLQD AYLMKLRRQT LTFTTNRLKE FLGEQRRRRA 3250
    EAATRHKVLL RSYPGGP 3267

    Note: No experimental confirmation available.

    Length:3,267
    Mass (Da):354,289
    Last modified:December 16, 2008 - v4
    Checksum:iE67BEB5624144233
    GO
    Isoform 2 (identifier: Q15772-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-792: Missing.
         961-962: AH → GE
         963-3267: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:170
    Mass (Da):18,673
    Checksum:i275949922564F798
    GO
    Isoform 3 (identifier: Q15772-4) [UniParc]FASTAAdd to Basket

    Also known as: APEG1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-849: Missing.
         961-962: AH → GE
         963-3267: Missing.

    Note: Produced by alternative promoter usage.

    Show »
    Length:113
    Mass (Da):12,692
    Checksum:i04F367263A1397C5
    GO
    Isoform 1 (identifier: Q15772-1) [UniParc]FASTAAdd to Basket

    Also known as: SPEG

    The sequence of this isoform differs from the canonical sequence as follows:
         3209-3267: LQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKEFLGEQRRRRAEAATRHKVLLRSYPGGP → SCLSVCHKEIKMASS

    Note: Produced by alternative splicing.

    Show »
    Length:3,223
    Mass (Da):348,903
    Checksum:iFBF1188F9F1B883A
    GO

    Sequence cautioni

    The sequence ABD61734.1 differs from that shown. Reason: Frameshift at positions 31 and 35.
    The sequence AAY15052.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti71 – 711Q → H in ABD61734. (PubMed:16545539)Curated
    Sequence conflicti73 – 731S → I in ABD61734. (PubMed:16545539)Curated
    Sequence conflicti2047 – 20471S → G in AAT80901. (PubMed:15185077)Curated
    Sequence conflicti2047 – 20471S → G in BAA92535. (PubMed:10718198)Curated
    Sequence conflicti3005 – 30051R → P in AAT80901. (PubMed:15185077)Curated
    Sequence conflicti3005 – 30051R → P in BAA92535. (PubMed:10718198)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti206 – 2061R → H.1 Publication
    Corresponds to variant rs55821435 [ dbSNP | Ensembl ].
    VAR_041101
    Natural varianti934 – 9341R → C.1 Publication
    Corresponds to variant rs34398769 [ dbSNP | Ensembl ].
    VAR_041102
    Natural varianti966 – 9661R → Q.1 Publication
    Corresponds to variant rs34861443 [ dbSNP | Ensembl ].
    VAR_041103
    Natural varianti1103 – 11031P → L.1 Publication
    Corresponds to variant rs56334571 [ dbSNP | Ensembl ].
    VAR_041104
    Natural varianti1135 – 11351A → V.1 Publication
    Corresponds to variant rs55670811 [ dbSNP | Ensembl ].
    VAR_041105
    Natural varianti1178 – 11781E → D in a gastric adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_041106
    Natural varianti1234 – 12341R → W.1 Publication
    Corresponds to variant rs55916864 [ dbSNP | Ensembl ].
    VAR_041107
    Natural varianti1340 – 13401R → Q.1 Publication
    Corresponds to variant rs34994343 [ dbSNP | Ensembl ].
    VAR_041108
    Natural varianti1621 – 16211R → C.1 Publication
    Corresponds to variant rs55646900 [ dbSNP | Ensembl ].
    VAR_041109
    Natural varianti1903 – 19031R → W in an ovarian mucinous carcinoma sample; somatic mutation. 1 Publication
    VAR_041110
    Natural varianti2189 – 21891P → L.
    Corresponds to variant rs10755037 [ dbSNP | Ensembl ].
    VAR_059769
    Natural varianti2687 – 26871P → T.3 Publications
    Corresponds to variant rs13026308 [ dbSNP | Ensembl ].
    VAR_041111
    Natural varianti2742 – 27421V → M in a gastric adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_041112
    Natural varianti3079 – 30791H → R.1 Publication
    Corresponds to variant rs12464085 [ dbSNP | Ensembl ].
    VAR_041113

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 849849Missing in isoform 3. 3 PublicationsVSP_018258Add
    BLAST
    Alternative sequencei1 – 792792Missing in isoform 2. 1 PublicationVSP_018259Add
    BLAST
    Alternative sequencei961 – 9622AH → GE in isoform 2 and isoform 3. 4 PublicationsVSP_018261
    Alternative sequencei963 – 32672305Missing in isoform 2 and isoform 3. 4 PublicationsVSP_018262Add
    BLAST
    Alternative sequencei3209 – 326759LQDCL…YPGGP → SCLSVCHKEIKMASS in isoform 1. 3 PublicationsVSP_036071Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U57099 mRNA. Translation: AAC50599.1.
    AK126500 mRNA. Translation: BAC86568.1.
    AK289531 mRNA. Translation: BAF82220.1.
    CR542201 mRNA. Translation: CAG46998.1.
    AC053503 Genomic DNA. Translation: AAY15052.1. Sequence problems.
    CH471063 Genomic DNA. Translation: EAW70747.1.
    BC006346 mRNA. Translation: AAH06346.1.
    DQ395348 mRNA. Translation: ABD61734.1. Frameshift.
    AY603755 mRNA. Translation: AAT80901.1.
    AB037718 mRNA. Translation: BAA92535.1.
    CCDSiCCDS42824.1. [Q15772-5]
    CCDS54432.1. [Q15772-4]
    RefSeqiNP_001166947.1. NM_001173476.1. [Q15772-4]
    NP_005867.3. NM_005876.4. [Q15772-5]
    UniGeneiHs.21639.

    Genome annotation databases

    EnsembliENST00000312358; ENSP00000311684; ENSG00000072195. [Q15772-5]
    ENST00000396686; ENSP00000379917; ENSG00000072195. [Q15772-4]
    ENST00000396688; ENSP00000379919; ENSG00000072195. [Q15772-4]
    ENST00000396689; ENSP00000379920; ENSG00000072195. [Q15772-4]
    GeneIDi10290.
    KEGGihsa:10290.
    UCSCiuc002vln.1. human. [Q15772-3]
    uc002vlq.3. human. [Q15772-4]
    uc010fwg.3. human. [Q15772-5]

    Polymorphism databases

    DMDMi218512143.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U57099 mRNA. Translation: AAC50599.1 .
    AK126500 mRNA. Translation: BAC86568.1 .
    AK289531 mRNA. Translation: BAF82220.1 .
    CR542201 mRNA. Translation: CAG46998.1 .
    AC053503 Genomic DNA. Translation: AAY15052.1 . Sequence problems.
    CH471063 Genomic DNA. Translation: EAW70747.1 .
    BC006346 mRNA. Translation: AAH06346.1 .
    DQ395348 mRNA. Translation: ABD61734.1 . Frameshift.
    AY603755 mRNA. Translation: AAT80901.1 .
    AB037718 mRNA. Translation: BAA92535.1 .
    CCDSi CCDS42824.1. [Q15772-5 ]
    CCDS54432.1. [Q15772-4 ]
    RefSeqi NP_001166947.1. NM_001173476.1. [Q15772-4 ]
    NP_005867.3. NM_005876.4. [Q15772-5 ]
    UniGenei Hs.21639.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1U2H X-ray 0.96 A 864-960 [» ]
    ProteinModelPortali Q15772.
    SMRi Q15772. Positions 866-961.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115579. 3 interactions.
    IntActi Q15772. 1 interaction.

    PTM databases

    PhosphoSitei Q15772.

    Polymorphism databases

    DMDMi 218512143.

    Proteomic databases

    MaxQBi Q15772.
    PaxDbi Q15772.
    PRIDEi Q15772.

    Protocols and materials databases

    DNASUi 10290.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000312358 ; ENSP00000311684 ; ENSG00000072195 . [Q15772-5 ]
    ENST00000396686 ; ENSP00000379917 ; ENSG00000072195 . [Q15772-4 ]
    ENST00000396688 ; ENSP00000379919 ; ENSG00000072195 . [Q15772-4 ]
    ENST00000396689 ; ENSP00000379920 ; ENSG00000072195 . [Q15772-4 ]
    GeneIDi 10290.
    KEGGi hsa:10290.
    UCSCi uc002vln.1. human. [Q15772-3 ]
    uc002vlq.3. human. [Q15772-4 ]
    uc010fwg.3. human. [Q15772-5 ]

    Organism-specific databases

    CTDi 10290.
    GeneCardsi GC02P220299.
    H-InvDB HIX0002864.
    HGNCi HGNC:16901. SPEG.
    HPAi HPA018904.
    neXtProti NX_Q15772.
    PharmGKBi PA142672598.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOVERGENi HBG083339.
    KOi K08809.
    OMAi QYRDVHR.
    OrthoDBi EOG7QC7V5.
    PhylomeDBi Q15772.
    TreeFami TF331962.

    Enzyme and pathway databases

    SignaLinki Q15772.

    Miscellaneous databases

    EvolutionaryTracei Q15772.
    GeneWikii SPEG.
    GenomeRNAii 10290.
    NextBioi 38992.
    PROi Q15772.

    Gene expression databases

    ArrayExpressi Q15772.
    Bgeei Q15772.
    CleanExi HS_SPEG.
    Genevestigatori Q15772.

    Family and domain databases

    Gene3Di 2.60.40.10. 11 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF07679. I-set. 9 hits.
    PF00069. Pkinase. 2 hits.
    [Graphical view ]
    SMARTi SM00060. FN3. 2 hits.
    SM00409. IG. 3 hits.
    SM00408. IGc2. 6 hits.
    SM00220. S_TKc. 2 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 2 hits.
    SSF56112. SSF56112. 2 hits.
    PROSITEi PS50853. FN3. 2 hits.
    PS50835. IG_LIKE. 8 hits.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 2 hits.
    PS00108. PROTEIN_KINASE_ST. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "APEG-1, a novel gene preferentially expressed in aortic smooth muscle cells, is down-regulated by vascular injury."
      Hsieh C.-M., Yoshizumi M., Endege W.O., Kho C.-J., Jain M.K., Kashiki S., de Los Santos R., Lee W.-S., Perrella M.A., Lee M.-E.
      J. Biol. Chem. 271:17354-17359(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Cerebellum and Uterus.
    3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    7. "The human desmin locus: gene organization and LCR-mediated transcriptional control."
      Tam J.L.Y., Triantaphyllopoulos K., Todd H., Raguz S., de Wit T., Morgan J.E., Partridge T.A., Makrinou E., Grosveld F., Antoniou M.
      Genomics 87:733-746(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 12-129 (ISOFORM 1), ALTERNATIVE PROMOTER USAGE.
    8. "Orthologous relationship of obscurin and Unc-89: phylogeny of a novel family of tandem myosin light chain kinases."
      Sutter S.B., Raeker M.O., Borisov A.B., Russell M.W.
      Dev. Genes Evol. 214:352-359(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 130-3267 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT THR-2687.
    9. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 982-3267 (ISOFORM 1), VARIANT THR-2687.
      Tissue: Brain.
    10. "X-ray structure of engineered human aortic preferentially expressed protein-1 (APEG-1)."
      Manjasetty B.A., Niesen F.H., Scheich C., Roske Y., Goetz F., Behlke J., Sievert V., Heinemann U., Bussow K.
      BMC Struct. Biol. 5:21-21(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (0.96 ANGSTROMS) OF 864-962, SUBUNIT.
    11. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-206; CYS-934; GLN-966; LEU-1103; VAL-1135; ASP-1178; TRP-1234; GLN-1340; CYS-1621; TRP-1903; THR-2687; MET-2742 AND ARG-3079.

    Entry informationi

    Entry nameiSPEG_HUMAN
    AccessioniPrimary (citable) accession number: Q15772
    Secondary accession number(s): A8K0G6
    , A8MRU0, Q27J74, Q695L1, Q6FGA6, Q6ZQW1, Q6ZTL8, Q9P2P9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: December 16, 2008
    Last modified: October 1, 2014
    This is version 138 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Expression is under the tight control of the locus control region (LCRs).

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3