Q15746 (MYLK_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 146.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myosin light chain kinase, smooth muscle Short name=MLCK Short name=smMLCK EC=2.7.11.18 Alternative name(s): Kinase-related protein Short name=KRP Telokin Cleaved into the following chain: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1914 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Calcium/calmodulin-dependent myosin light chain kinase implicated in smooth muscle contraction via phosphorylation of myosin light chains (MLC). Also regulates actin-myosin interaction through a non-kinase activity. Phosphorylates PTK2B/PYK2 and myosin light-chains. Involved in the inflammatory response (e.g. apoptosis, vascular permeability, leukocyte diapedesis), cell motility and morphology, airway hyperreactivity and other activities relevant to asthma. Required for tonic airway smooth muscle contraction that is necessary for physiological and asthmatic airway resistance. Necessary for gastrointestinal motility. Implicated in the regulation of endothelial as well as vascular permeability, probably via the regulation of cytoskeletal rearrangements. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. Critical participant in signaling sequences that result in fibroblast apoptosis. Plays a role in the regulation of epithelial cell survival. Required for epithelial wound healing, especially during actomyosin ring contraction during purse-string wound closure. Mediates RhoA-dependent membrane blebbing. Triggers TRPC5 channel activity in a calcium-dependent signaling, by inducing its subcellular localization at the plasma membrane. Promotes cell migration (including tumor cells) and tumor metastasis. PTK2B/PYK2 activation by phosphorylation mediates ITGB2 activation and is thus essential to trigger neutrophil transmigration during acute lung injury (ALI). May regulate optic nerve head astrocyte migration. Probably involved in mitotic cytoskeletal regulation. Regulates tight junction probably by modulating ZO-1 exchange in the perijunctional actomyosin ring. Mediates burn-induced microvascular barrier injury; triggers endothelial contraction in the development of microvascular hyperpermeability by phosphorylating MLC. Essential for intestinal barrier dysfunction. Mediates Giardia spp.-mediated reduced epithelial barrier function during giardiasis intestinal infection via reorganization of cytoskeletal F-actin and tight junctional ZO-1. Necessary for hypotonicity-induced Ca2+ entry and subsequent activation of volume-sensitive organic osmolyte/anion channels (VSOAC) in cervical cancer cells. Responsible for high proliferative ability of breast cancer cells through anti-apoptosis. Ref.4 Ref.7 Ref.15 Ref.17 Ref.19 Ref.20 Ref.21 Ref.23 Ref.26 Ref.27 Ref.28 Ref.31 Ref.32 |
| Catalytic activity | ATP + [myosin light-chain] = ADP + [myosin light-chain] phosphate. |
| Cofactor | Magnesium. Calcium. |
| Enzyme regulation | Isoform 1 is activated by phosphorylation on Tyr-464 and Tyr-471. Isoforms which lack these tyrosine residues are not regulated in this way. All catalytically active isoforms require binding to calcium and calmodulin for activation. Repressed by organometallic pyridylnaphthalimide complexes, wortmannin, ML-7 (a synthetic naphthalenesulphonyl derivative that inhibits the binding of ATP to MLCK) and ML-9. Ref.4 Ref.15 Ref.16 Ref.19 Ref.20 Ref.33 |
| Subunit structure | All isoforms including Telokin bind calmodulin. Interacts with SVIL By similarity. Interacts with CTTN; this interaction is reduced during thrombin-induced endothelial cell (EC) contraction but is promoted by the barrier-protective agonist sphingosine 1-phosphate (S1P) within lamellipodia. A complex made of ABL1, CTTN and MYLK regulates cortical actin-based cytoskeletal rearrangement critical to sphingosine 1-phosphate (S1P)-mediated endothelial cell (EC) barrier enhancement. Binds to NAA10/ARD1 and PTK2B/PYK2. Ref.14 Ref.23 Ref.26 Ref.29 Ref.30 |
| Subcellular location | Cytoplasm. Cell projection › lamellipodium. Cleavage furrow. Cytoplasm › cytoskeleton. Note: Localized to stress fibers during interphase and to the cleavage furrow during mitosis. Ref.7 Ref.29 |
| Tissue specificity | Smooth muscle and non-muscle isozymes are expressed in a wide variety of adult and fetal tissues and in cultured endothelium with qualitative expression appearing to be neither tissue- nor development-specific. Non-muscle isoform 2 is the dominant splice variant expressed in various tissues. Telokin has been found in a wide variety of adult and fetal tissues. Accumulates in well differentiated enterocytes of the intestinal epithelium in response to tumor necrosis factor (TNF). Ref.1 Ref.5 Ref.18 Ref.29 |
| Induction | Accumulates in individuals with asthma (at protein levels). Induced by tumor necrosis factor (TNF). Repressed by androgens (e.g. R1881). Ref.4 Ref.15 Ref.16 Ref.18 Ref.19 Ref.20 Ref.25 Ref.33 Ref.34 |
| Post-translational modification | Can probably be down-regulated by phosphorylation. Tyrosine phosphorylation by ABL1 increases kinase activity, reverses MLCK-mediated inhibition of Arp2/3-mediated actin polymerization, and enhances CTTN-binding. Phosphorylation by SRC at Tyr-464 and Tyr-471 promotes CTTN binding. The C-terminus is deglutamylated by AGTPBP1/ CCP1, AGBL1/CCP4 and AGBL4/CCP6, leading to the formation of Myosin light chain kinase, smooth muscle, deglutamylated form. The consequences of C-terminal deglutamylation are unknown By similarity. Acetylated at Lys-608 by NAA10/ARD1 via a calcium-dependent signaling; this acetylation represses kinase activity and reduces tumor cell migration. |
| Involvement in disease | Familial aortic aneurysm thoracic 7 (AAT7) [MIM:613780]: A disease characterized by permanent dilation of the thoracic aorta usually due to degenerative changes in the aortic wall. It is primarily associated with a characteristic histologic appearance known as 'medial necrosis' or 'Erdheim cystic medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance. |
| Miscellaneous | In asthmatic patients, overexpression promotes actin filament propulsion, thus contributing to airway hyperresponsiveness. Some MYLK variants may contribute to acute lung injury (ALI) susceptibility. Potential therapeutic target in the treatment of burn edema. |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Contains 1 fibronectin type-III domain. Contains 9 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain. |
| Biophysicochemical properties | Kinetic parameters: KM=6.5 µM for MLC (isoform 1 at 22 degrees Celsius) Ref.4 KM=7.2 µM for MLC (isoform 2 at 22 degrees Celsius) Vmax=11.9 µmol/min/mg enzyme (isoform 1 at 22 degrees Celsius) Vmax=10.9 µmol/min/mg enzyme (isoform 1 at 22 degrees Celsius) |
| Sequence caution | The sequence AAD15922.1 differs from that shown. Reason: Frameshift at position 1433. The sequence AAD15923.1 differs from that shown. Reason: Frameshift at position 1433. The sequence AAD15924.1 differs from that shown. Reason: Frameshift at position 1433. Isoform 3A: The sequence AAD15922.1 differs from that shown. Reason: Frameshift at positions 1433 and 1439. Isoform 3B: The sequence AAD15923.1 differs from that shown. Reason: Frameshift at positions 1433 and 1439. Isoform 4: The sequence AAD15924.1 differs from that shown. Reason: Frameshift at positions 1433 and 1439. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NCK1 | P16333 | 2 | EBI-968482,EBI-389883 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q15746-1) Also known as: Non-muscle isozyme; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15746-2) The sequence of this isoform differs from the canonical sequence as follows: 437-506: VSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVER → G | ||||||
| Isoform 3A (identifier: Q15746-3) The sequence of this isoform differs from the canonical sequence as follows: 1655-1705: Missing. | ||||||
| Isoform 3B (identifier: Q15746-4) The sequence of this isoform differs from the canonical sequence as follows: 437-506: VSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVER → G 1655-1705: Missing. | ||||||
| Isoform 4 (identifier: Q15746-5) The sequence of this isoform differs from the canonical sequence as follows: 1473-1545: Missing. | ||||||
| Isoform Del-1790 (identifier: Q15746-6) The sequence of this isoform differs from the canonical sequence as follows: 1790-1790: Missing. | ||||||
| Isoform 5 (identifier: Q15746-7) Also known as: Smooth-muscle isozyme; The sequence of this isoform differs from the canonical sequence as follows: 1-922: Missing. | ||||||
| Note: Produced by alternative initiation at Met-923 of isoform 1. | ||||||
| Isoform 6 (identifier: Q15746-8) Also known as: Telokin; The sequence of this isoform differs from the canonical sequence as follows: 1-1760: Missing. | ||||||
| Note: Produced by alternative initiation at Met-1761 of isoform 1. Has no catalytic activity. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1914 | 1914 | Myosin light chain kinase, smooth muscle | PRO_0000024354 | |||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 1 – 1910 | 1910 | Myosin light chain kinase, smooth muscle, deglutamylated form By similarity | PRO_0000403731 | |||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 33 – 122 | 90 | Ig-like C2-type 1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 161 – 249 | 89 | Ig-like C2-type 2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 414 – 503 | 90 | Ig-like C2-type 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 514 – 599 | 86 | Ig-like C2-type 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 620 – 711 | 92 | Ig-like C2-type 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 721 – 821 | 101 | Ig-like C2-type 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 868 – 895 | 28 | 1-1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 896 – 923 | 28 | 1-2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 924 – 951 | 28 | 1-3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 952 – 979 | 28 | 1-4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 980 – 998 | 19 | 1-5; truncated | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 999 – 1003 | 5 | 2-1; truncated | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 1004 – 1015 | 12 | 2-2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 1016 – 1027 | 12 | 2-3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 1028 – 1039 | 12 | 2-4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 1040 – 1051 | 12 | 2-5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 1052 – 1063 | 12 | 2-6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1098 – 1186 | 89 | Ig-like C2-type 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1238 – 1326 | 89 | Ig-like C2-type 8 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1331 – 1422 | 92 | Fibronectin type-III | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1464 – 1719 | 256 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1809 – 1898 | 90 | Ig-like C2-type 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 1470 – 1478 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 868 – 998 | 131 | 5 X 28 AA approximate tandem repeats | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 923 – 963 | 41 | Actin-binding (calcium/calmodulin-sensitive) By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 948 – 963 | 16 | Calmodulin-binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 999 – 1063 | 65 | 6 X 12 AA approximate tandem repeats | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1061 – 1460 | 400 | Actin-binding (calcium/calmodulin-insensitive) By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1711 – 1774 | 64 | Calmodulin-binding | ||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1906 – 1914 | 9 | Poly-Glu | ||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 1585 | 1 | Proton acceptor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 1493 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 231 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 343 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 464 | 1 | Phosphotyrosine; by ABL1 and SRC Ref.4 Ref.14 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 471 | 1 | Phosphotyrosine; by SRC Ref.4 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 556 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 608 | 1 | N6-acetyllysine Ref.26 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 611 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 792 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 814 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 846 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1438 | 1 | Phosphoserine Ref.22 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1449 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1575 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1635 | 1 | Phosphotyrosine; by ABL1 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1759 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1776 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 182 ↔ 233 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 435 ↔ 487 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 535 ↔ 583 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 742 ↔ 805 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1119 ↔ 1170 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1830 ↔ 1882 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 1760 | 1760 | Missing in isoform 6. | VSP_018846 | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 922 | 922 | Missing in isoform 5. | VSP_018845 | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 437 – 506 | 70 | VSGIP…LQVER → G in isoform 2 and isoform 3B. | VSP_004791 | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1473 – 1545 | 73 | Missing in isoform 4. | VSP_004793 | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1655 – 1705 | 51 | Missing in isoform 3A and isoform 3B. | VSP_004794 | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1790 | 1 | Missing in isoform Del-1790. | VSP_004795 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 21 | 1 | P → H. Corresponds to variant rs28497577 [ dbSNP | Ensembl ]. | VAR_057106 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 128 | 1 | A → V. Ref.38 | VAR_065570 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 133 | 1 | Q → H. Ref.38 | VAR_065571 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 160 | 1 | P → R. Ref.38 | VAR_065572 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 261 | 1 | V → A. Ref.37 Corresponds to variant rs3796164 [ dbSNP | Ensembl ]. | VAR_040847 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 276 | 1 | T → A. Ref.37 | VAR_040848 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 336 | 1 | P → L. Corresponds to variant rs35912339 [ dbSNP | Ensembl ]. | VAR_057107 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 378 | 1 | R → H. Ref.37 | VAR_040849 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 405 | 1 | M → V. Ref.37 Corresponds to variant rs35436690 [ dbSNP | Ensembl ]. | VAR_040850 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 443 | 1 | P → S. Ref.37 | VAR_040851 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 607 | 1 | R → G. Ref.37 | VAR_040852 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 652 | 1 | P → A. Ref.37 | VAR_040853 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 656 | 1 | W → C. Ref.37 Ref.38 | VAR_040854 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 692 | 1 | T → M. Ref.37 | VAR_040855 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 701 | 1 | A → T. Ref.37 | VAR_040856 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 709 | 1 | V → M. Ref.37 | VAR_040857 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 845 | 1 | R → C. Corresponds to variant rs3732485 [ dbSNP | Ensembl ]. | VAR_057108 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 861 | 1 | L → P. Corresponds to variant rs3732486 [ dbSNP | Ensembl ]. | VAR_019986 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 877 | 1 | V → M. Corresponds to variant rs34542174 [ dbSNP | Ensembl ]. | VAR_057109 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 914 | 1 | D → E. Corresponds to variant rs3732487 [ dbSNP | Ensembl ]. | VAR_019987 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1085 | 1 | T → A. Ref.38 | VAR_065573 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1213 | 1 | V → M Found in a patient with familial aortic dissections. Ref.38 | VAR_065574 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1399 | 1 | E → K Found in a patient with familial aortic dissections. Ref.38 | VAR_065575 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1527 | 1 | A → V. Ref.37 | VAR_040858 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1588 | 1 | P → L in an ovarian mucinous carcinoma sample; somatic mutation. Ref.37 | VAR_040859 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1754 | 1 | A → T Found in a patient with familial aortic dissections; binding to calmodulin is reduced; significant reduction in kinase activity compared to wild-type protein. Ref.38 | VAR_065576 | |||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1759 | 1 | S → P in AAT7; shows minimal cells endogenous expression; binding to calmodulin is abolished; 6-fold reduction in kinase activity compared to wild-type protein. Ref.38 | VAR_065577 | |||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 608 | 1 | K → A: Loss of acetylation and no kinase activity repression by NAA10/ARD1. Ref.26 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 147 | 1 | P → S in AAC18423. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 147 | 1 | P → S in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 147 | 1 | P → S in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 147 | 1 | P → S in AAR29062. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 147 | 1 | P → S in AAQ02673. Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 466 | 1 | D → N in AAR29062. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 496 | 1 | L → V in AAC18423. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 496 | 1 | L → V in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 496 | 1 | L → V in AAR29062. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 496 | 1 | L → V in AAQ02673. Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 681 | 1 | C → W in AAC18423. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 681 | 1 | C → W in AAD15921. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 681 | 1 | C → W in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 681 | 1 | C → W in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 933 | 1 | V → M in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 963 | 1 | S → P in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1022 | 1 | P → A in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1048 – 1050 | 3 | KPM → EAH Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1048 – 1050 | 3 | KPM → EAH Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1162 | 1 | P → L in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1162 | 1 | P → L in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1210 | 1 | L → P in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1280 | 1 | E → D in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1280 | 1 | E → D in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1284 | 1 | M → I in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1284 | 1 | M → I in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1284 | 1 | M → I in AAD15924. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1300 | 1 | A → G in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1316 | 1 | L → S in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1326 | 1 | T → S in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1478 | 1 | V → C in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1511 | 1 | S → T in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1511 | 1 | S → T in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1518 | 1 | H → P in AAR29061. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1518 | 1 | H → P in AAR29062. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1563 | 1 | I → T in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1609 | 1 | A → P in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1634 | 1 | N → I in AAR29061. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1634 | 1 | N → I in AAR29062. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1639 – 1640 | 2 | GY → D in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1639 – 1640 | 2 | GY → D in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1639 – 1640 | 2 | GY → D in AAD15924. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1639 | 1 | G → R in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1648 | 1 | G → R in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1658 – 1659 | 2 | LS → PF in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1676 | 1 | A → P in AAR29061. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1676 | 1 | A → P in AAR29062. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1710 – 1711 | 2 | CT → LA in CAA59685. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1897 | 1 | L → H in AAD15922. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1897 | 1 | L → H in AAD15923. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1897 | 1 | L → H in AAD15924. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 512 – 518 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 523 – 526 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 531 – 534 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 536 – 541 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 546 – 553 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 560 – 562 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 565 – 570 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 581 – 586 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 591 – 595 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 598 – 601 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1239 – 1241 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1246 – 1250 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1255 – 1266 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1268 – 1277 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1281 – 1288 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1290 – 1297 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1302 – 1304 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1306 – 1313 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1318 – 1320 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1323 – 1328 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1743 – 1759 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The human myosin light chain kinase (MLCK) from hippocampus: cloning, sequencing, expression, and localization to 3qcen-q21." Potier M.-C., Chelot E., Pekarsky Y., Gardiner K., Rossier J., Turnell W.G. Genomics 29:562-570(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY. Tissue: Hippocampus. |
| [2] | "Myosin light chain kinase in endothelium: molecular cloning and regulation." Garcia J.G.N., Lazar V.L., Gilbert-Mcclain L.I., Gallagher P.J., Verin A.D. Am. J. Respir. Cell Mol. Biol. 16:489-494(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Umbilical vein endothelial cell. |
| [3] | "A single human myosin light chain kinase gene (MLCK; MYLK)." Lazar V.L., Garcia J.G.N. Genomics 57:256-267(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3A; 3B AND 4). Tissue: Umbilical vein. |
| [4] | "Differential regulation of alternatively spliced endothelial cell myosin light chain kinase isoforms by p60(Src)." Birukov K.G., Csortos C., Marzilli L., Dudek S., Ma S.-F., Bresnick A.R., Verin A.D., Cotter R.J., Garcia J.G.N. J. Biol. Chem. 276:8567-8573(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION (ISOFORMS 1 AND 2), PROTEIN SEQUENCE OF 457-476 AND 968-985, FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, PHOSPHORYLATION AT TYR-464 AND TYR-471, CALMODULIN-BINDING, ENZYME REGULATION. |
| [5] | "Analysis of the kinase-related protein gene found at human chromosome 3q21 in a multi-gene cluster: organization, expression, alternative splicing and polymorphic marker." Watterson D.M., Schavocky J.P., Guo L., Weiss C., Chlenski A., Shrinsky V.P., Van Eldik L.J., Haiech J. J. Cell. Biochem. 75:481-491(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 1614-1914 (ISOFORM 5), TISSUE SPECIFICITY. Tissue: Lung and Placenta. |
| [6] | "A differentiation-dependent splice variant of myosin light chain kinase, MLCK1, regulates epithelial tight junction permeability." Clayburgh D.R., Rosen S., Witkowski E.D., Wang F., Blair S., Dudek S., Garcia J.G., Alverdy J.C., Turner J.R. J. Biol. Chem. 279:55506-55513(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Intestinal epithelium. |
| [7] | "The N-terminus of the long MLCK induces a disruption in normal spindle morphology and metaphase arrest." Dulyaninova N.G., Patskovsky Y.V., Bresnick A.R. J. Cell Sci. 117:1481-1493(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION IN CELL CYCLE, SUBCELLULAR LOCATION. Tissue: Cervix carcinoma. |
| [8] | "HeLa myosin light chain kinase." Kikuchi A., Murata-Hori M., Hosoya H. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Cervix carcinoma. |
| [9] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Testis. |
| [10] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). |
| [13] | Watterson D.M. Submitted (NOV-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1456-1914. Tissue: Placenta. |
| [14] | "Novel interaction of cortactin with endothelial cell myosin light chain kinase." Dudek S.M., Birukov K.G., Zhan X., Garcia J.G.N. Biochem. Biophys. Res. Commun. 298:511-519(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTTN, PHOSPHORYLATION AT TYR-464 AND TYR-471 BY SRC. |
| [15] | "Myosin light chain kinase modulates hypotonicity-induced Ca2+ entry and Cl- channel activity in human cervical cancer cells." Shen M.-R., Furla P., Chou C.-Y., Ellory J.C. Pflugers Arch. 444:276-285(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN HYPOTONICITY RESPONSE, ENZYME REGULATION. |
| [16] | "Quantitative measurements of Ca(2+)/calmodulin binding and activation of myosin light chain kinase in cells." Geguchadze R., Zhi G., Lau K.S., Isotani E., Persechini A., Kamm K.E., Stull J.T. FEBS Lett. 557:121-124(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION BY CALCIUM. |
| [17] | "Distinct temporal-spatial roles for rho kinase and myosin light chain kinase in epithelial purse-string wound closure." Russo J.M., Florian P., Shen L., Graham W.V., Tretiakova M.S., Gitter A.H., Mrsny R.J., Turner J.R. Gastroenterology 128:987-1001(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN WOUND HEALING. |
| [18] | "Tumor necrosis factor-induced long myosin light chain kinase transcription is regulated by differentiation-dependent signaling events. Characterization of the human long myosin light chain kinase promoter." Graham W.V., Wang F., Clayburgh D.R., Cheng J.X., Yoon B., Wang Y., Lin A., Turner J.R. J. Biol. Chem. 281:26205-26215(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION BY TNF, TISSUE SPECIFICITY. |
| [19] | "Myosin light chain kinase plays a role in the regulation of epithelial cell survival." Connell L.E., Helfman D.M. J. Cell Sci. 119:2269-2281(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN EPITHELIAL CELL SURVIVAL, ENZYME REGULATION. |
| [20] | "Ca2+-calmodulin-dependent myosin light chain kinase is essential for activation of TRPC5 channels expressed in HEK293 cells." Shimizu S., Yoshida T., Wakamori M., Ishii M., Okada T., Takahashi M., Seto M., Sakurada K., Kiuchi Y., Mori Y. J. Physiol. (Lond.) 570:219-235(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TRPC5 REGULATION, ENZYME REGULATION. |
| [21] | "Myosin light-chain kinase contributes to the proliferation and migration of breast cancer cells through cross-talk with activated ERK1/2." Zhou X., Liu Y., You J., Zhang H., Zhang X., Ye L. Cancer Lett. 270:312-327(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN CELL MIGRATION. |
| [22] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1438, MASS SPECTROMETRY. Tissue: Platelet. |
| [23] | "Nonmuscle myosin light-chain kinase mediates neutrophil transmigration in sepsis-induced lung inflammation by activating beta2 integrins." Xu J., Gao X.-P., Ramchandran R., Zhao Y.-Y., Vogel S.M., Malik A.B. Nat. Immunol. 9:880-886(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS PTK2B/PYK2 KINASE, INTERACTION WITH PTK2B/PYK2. |
| [24] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1438, MASS SPECTROMETRY. Tissue: Liver. |
| [25] | "Androgens down-regulate myosin light chain kinase in human prostate cancer cells." Leveille N., Fournier A., Labrie C. J. Steroid Biochem. Mol. Biol. 114:174-179(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION BY ANDROGENS. |
| [26] | "Arrest defective-1 controls tumor cell behavior by acetylating myosin light chain kinase." Shin D.H., Chun Y.-S., Lee K.-H., Shin H.-W., Park J.-W. PLoS ONE 4:E7451-E7451(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TUMOR CELL MIGRATION, ACETYLATION AT LYS-608 BY NAA10/ARD1, INTERACTION WITH NAA10/ARD1, MUTAGENESIS OF LYS-608. |
| [27] | "Myosin light chain kinase is responsible for high proliferative ability of breast cancer cells via anti-apoptosis involving p38 pathway." Cui W.-J., Liu Y., Zhou X.-L., Wang F.-Z., Zhang X.-D., Ye L.-H. Acta Pharmacol. Sin. 31:725-732(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN BREAST CANCER. |
| [28] | "Modulation of factors affecting optic nerve head astrocyte migration." Miao H., Crabb A.W., Hernandez M.R., Lukas T.J. Invest. Ophthalmol. Vis. Sci. 51:4096-4103(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN OPTIC NERVE HEAD ASTROCYTE MIGRATION. |
| [29] | "Quantitative distribution and colocalization of non-muscle myosin light chain kinase isoforms and cortactin in human lung endothelium." Brown M., Adyshev D., Bindokas V., Moitra J., Garcia J.G.N., Dudek S.M. Microvasc. Res. 80:75-88(2010) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INTERACTION WITH CTTN, SUBCELLULAR LOCATION. |
| [30] | "Abl tyrosine kinase phosphorylates nonmuscle Myosin light chain kinase to regulate endothelial barrier function." Dudek S.M., Chiang E.T., Camp S.M., Guo Y., Zhao J., Brown M.E., Singleton P.A., Wang L., Desai A., Arce F.T., Lal R., Van Eyk J.E., Imam S.Z., Garcia J.G.N. Mol. Biol. Cell 21:4042-4056(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-231; TYR-464; TYR-556; TYR-611; TYR-792; TYR-846; TYR-1449; TYR-1575 AND TYR-1635 BY ABL1, INTERACTION WITH CTTN AND ABL1. |
| [31] | "The angiotensin II type 1 receptor induces membrane blebbing by coupling to Rho A, Rho kinase, and myosin light chain kinase." Godin C.M., Ferguson S.S.G. Mol. Pharmacol. 77:903-911(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN MEMBRANE BLEBBING. |
| [32] | "Non-muscle myosin light chain kinase isoform is a viable molecular target in acute inflammatory lung injury." Mirzapoiazova T., Moitra J., Moreno-Vinasco L., Sammani S., Turner J.R., Chiang E.T., Evenoski C., Wang T., Singleton P.A., Huang Y., Lussier Y.A., Watterson D.M., Dudek S.M., Garcia J.G.N. Am. J. Respir. Cell Mol. Biol. 44:40-52(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN INFLAMMATORY RESPONSE. |
| [33] | "Organometallic pyridylnaphthalimide complexes as protein kinase inhibitors." Blanck S., Cruchter T., Vultur A., Riedel R., Harms K., Herlyn M., Meggers E. Organometallics 30:4598-4606(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION. |
| [34] | "Myosin, transgelin, and myosin light chain kinase: expression and function in asthma." Leguillette R., Laviolette M., Bergeron C., Zitouni N., Kogut P., Solway J., Kachmar L., Hamid Q., Lauzon A.-M. Am. J. Respir. Crit. Care Med. 179:194-204(2009) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON ASTHMA, INDUCTION BY ASTHMA. |
| [35] | "Solution structure of the eighth Ig-like domain of human myosin light chain kinase." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1238-1338. |
| [36] | "A coupled equilibrium shift mechanism in calmodulin-mediated signal transduction." Gsponer J., Christodoulou J., Cavalli A., Bui J.M., Richter B., Dobson C.M., Vendruscolo M. Structure 16:736-746(2008) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1742-1760 IN COMPLEX WITH CALMODULIN. |
| [37] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ALA-261; ALA-276; HIS-378; VAL-405; SER-443; GLY-607; ALA-652; CYS-656; MET-692; THR-701; MET-709; VAL-1527 AND LEU-1588. |
| [38] | "Mutations in myosin light chain kinase cause familial aortic dissections." Wang L., Guo D.C., Cao J., Gong L., Kamm K.E., Regalado E., Li L., Shete S., He W.Q., Zhu M.S., Offermanns S., Gilchrist D., Elefteriades J., Stull J.T., Milewicz D.M. Am. J. Hum. Genet. 87:701-707(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AAT7 PRO-1759, VARIANTS VAL-128; HIS-133; ARG-160; CYS-656; ALA-1085; MET-1213; LYS-1399 AND THR-1754, CHARACTERIZATION OF VARIANT AAT7 PRO-1759, CHARACTERIZATION OF VARIANT THR-1754. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Myosin light-chain kinase entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X85337 mRNA. Translation: CAA59685.1. U48959 mRNA. Translation: AAC18423.2. AF069601 mRNA. Translation: AAD15921.2. AF069602 mRNA. Translation: AAD15922.1. Frameshift. AF069603 mRNA. Translation: AAD15923.1. Frameshift. AF069604 mRNA. Translation: AAD15924.1. Frameshift. AF096771 AF096770 Genomic DNA. Translation: AAD51380.1.AF096771, AF096769, AF096770 Genomic DNA. Translation: AAD51381.1. AF096773 mRNA. Translation: AAD54017.1. AF096774 mRNA. Translation: AAD54018.1. AF096775 mRNA. Translation: AAD54019.1. AY424269 mRNA. Translation: AAR29061.1. AY424270 mRNA. Translation: AAR29062.1. AY339601 mRNA. Translation: AAQ02673.1. AB037663 mRNA. Translation: BAB21504.1. AK314443 mRNA. Translation: BAG37052.1. AC020634 Genomic DNA. No translation available. AC023165 Genomic DNA. No translation available. CH471052 Genomic DNA. Translation: EAW79439.1. BC100761 mRNA. Translation: AAI00762.2. BC100762 mRNA. Translation: AAI00763.2. X90870 mRNA. Translation: CAA62378.1. | ||||||||||||||||||||||||
| IPI | IPI00221255. IPI00221259. IPI00336081. IPI00736561. IPI00791032. IPI00791924. IPI00855853. IPI00955810. | ||||||||||||||||||||||||
| RefSeq | NP_444253.3. NM_053025.3. NP_444254.3. NM_053026.3. NP_444255.3. NM_053027.3. NP_444256.3. NM_053028.3. NP_444259.1. NM_053031.2. NP_444260.1. NM_053032.2. | ||||||||||||||||||||||||
| UniGene | Hs.477375. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q15746. | ||||||||||||||||||||||||
| SMR | Q15746. Positions 510-601, 1238-1338, 1801-1902. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q15746. 9 interactions. | ||||||||||||||||||||||||
| MINT | MINT-2807402. | ||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||
| MEROPS | I43.001. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q15746. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 300669714. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q15746. | ||||||||||||||||||||||||
| PRIDE | Q15746. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 4638. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000346322; ENSP00000320622; ENSG00000065534. ENST00000359169; ENSP00000352088; ENSG00000065534. ENST00000360304; ENSP00000353452; ENSG00000065534. ENST00000360772; ENSP00000354004; ENSG00000065534. ENST00000418370; ENSP00000428967; ENSG00000065534. ENST00000475616; ENSP00000418335; ENSG00000065534. ENST00000583087; ENSP00000462118; ENSG00000065534. | ||||||||||||||||||||||||
| GeneID | 4638. | ||||||||||||||||||||||||
| KEGG | hsa:4638. | ||||||||||||||||||||||||
| UCSC | uc003ego.3. human. uc003egp.3. human. uc003egq.3. human. uc003egr.3. human. uc011bjw.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 4638. | ||||||||||||||||||||||||
| GeneCards | GC03M123281. | ||||||||||||||||||||||||
| HGNC | HGNC:7590. MYLK. | ||||||||||||||||||||||||
| HPA | CAB009628. CAB020789. HPA031677. | ||||||||||||||||||||||||
| MIM | 600922. gene. 613780. phenotype. | ||||||||||||||||||||||||
| neXtProt | NX_Q15746. | ||||||||||||||||||||||||
| Orphanet | 91387. Familial thoracic aortic aneurysm. | ||||||||||||||||||||||||
| PharmGKB | PA31388. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||||||||
| HOVERGEN | HBG052551. | ||||||||||||||||||||||||
| InParanoid | Q15746. | ||||||||||||||||||||||||
| KO | K00907. | ||||||||||||||||||||||||
| OMA | KFIILSQ. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| BRENDA | 2.7.11.18. 2681. | ||||||||||||||||||||||||
| Pathway_Interaction_DB | aurora_b_pathway. Aurora B signaling. | ||||||||||||||||||||||||
| Reactome | REACT_17044. Muscle contraction. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q15746. | ||||||||||||||||||||||||
| Bgee | Q15746. | ||||||||||||||||||||||||
| Genevestigator | Q15746. | ||||||||||||||||||||||||
| GermOnline | ENSG00000065534. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 2.60.40.10. 10 hits. | ||||||||||||||||||||||||
| InterPro | IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR011009. Kinase-like_dom. IPR020675. Myosin_light_ch_kinase-rel. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR22964. PTHR22964. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF00041. fn3. 1 hit. PF07679. I-set. 9 hits. PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00060. FN3. 1 hit. SM00409. IG. 1 hit. SM00408. IGc2. 8 hits. SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF49265. FN_III-like. 1 hit. SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50853. FN3. 1 hit. PS50835. IG_LIKE. 9 hits. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | Q15746. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL2428. | ||||||||||||||||||||||||
| ChiTaRS | MYLK. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q15746. | ||||||||||||||||||||||||
| GenomeRNAi | 4638. | ||||||||||||||||||||||||
| NextBio | 17860. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | MYLK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15746 Secondary accession number(s): O95796 Q9UIT9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Recent format changes Overview of recent format changes |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
