Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 2

Gene

DLG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses (By similarity).By similarity

GO - Molecular functioni

  • guanylate kinase activity Source: ProtInc
  • ionotropic glutamate receptor binding Source: GO_Central
  • kinase binding Source: MGI

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-6794361. Interactions of neurexins and neuroligins at synapses.

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
Gene namesi
Name:DLG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:2901. DLG2.

Subcellular locationi

  • Cell membrane By similarity; Lipid-anchor By similarity
  • Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity
  • Cell junctionsynapse By similarity
  • Membrane By similarity
  • Cell projectionaxon By similarity

  • Note: Concentrated in soma and postsynaptic density of a subset of neurons.By similarity

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • juxtaparanode region of axon Source: UniProtKB
  • membrane Source: UniProtKB
  • plasma membrane Source: ProtInc
  • postsynaptic density Source: GO_Central
  • postsynaptic membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi1740.
OpenTargetsiENSG00000150672.
PharmGKBiPA164741388.

Polymorphism and mutation databases

BioMutaiDLG2.
DMDMi215274165.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945531 – 870Disks large homolog 2Add BLAST870

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi5S-palmitoyl cysteineBy similarity1
Lipidationi7S-palmitoyl cysteineBy similarity1
Modified residuei28PhosphoserineBy similarity1
Modified residuei58PhosphotyrosineBy similarity1
Modified residuei65PhosphoserineBy similarity1
Modified residuei307PhosphoserineBy similarity1
Modified residuei328PhosphoserineBy similarity1
Modified residuei360PhosphoserineBy similarity1
Modified residuei365PhosphoserineBy similarity1
Modified residuei406PhosphoserineBy similarity1
Modified residuei414PhosphoserineBy similarity1
Modified residuei505PhosphotyrosineBy similarity1
Modified residuei528PhosphoserineBy similarity1
Modified residuei530PhosphoserineBy similarity1
Modified residuei553PhosphoserineBy similarity1
Modified residuei627PhosphoserineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei750PhosphotyrosineBy similarity1
Modified residuei755PhosphotyrosineBy similarity1

Post-translational modificationi

Palmitoylation of isoform 1 is not required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ15700.
MaxQBiQ15700.
PaxDbiQ15700.
PeptideAtlasiQ15700.
PRIDEiQ15700.

PTM databases

iPTMnetiQ15700.
PhosphoSitePlusiQ15700.

Expressioni

Gene expression databases

BgeeiENSG00000150672.
CleanExiHS_DLG2.
ExpressionAtlasiQ15700. baseline and differential.
GenevisibleiQ15700. HS.

Organism-specific databases

HPAiHPA021307.

Interactioni

Subunit structurei

Interacts through its PDZ domains with NETO1 (By similarity). Interacts with NOS1/nNOS through second PDZ domain (By similarity). Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains (PubMed:15304517). Interacts with KCNJ4 (By similarity), Interacts with FRMPD4 (via C-terminus) (PubMed:19118189). Interacts with LRFN1, LRFN2 and LRFN4 (PubMed:16630835). Interacts with FASLG (PubMed:19807924). Interacts with KCNJ4 (By similarity). Interacts with ADAM22 (By similarity).By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Kcnj2P355616EBI-663057,EBI-703793From a different organism.

GO - Molecular functioni

  • ionotropic glutamate receptor binding Source: GO_Central
  • kinase binding Source: MGI

Protein-protein interaction databases

BioGridi108084. 23 interactors.
IntActiQ15700. 19 interactors.
MINTiMINT-470785.
STRINGi9606.ENSP00000365272.

Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi190 – 197Combined sources8
Beta strandi202 – 209Combined sources8
Beta strandi222 – 227Combined sources6
Helixi232 – 236Combined sources5
Beta strandi244 – 248Combined sources5
Helixi258 – 266Combined sources9
Beta strandi270 – 281Combined sources12
Beta strandi420 – 425Combined sources6
Beta strandi432 – 439Combined sources8
Beta strandi444 – 449Combined sources6
Helixi454 – 458Combined sources5
Beta strandi465 – 470Combined sources6
Helixi480 – 489Combined sources10
Beta strandi492 – 500Combined sources9
Helixi502 – 510Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BYGX-ray1.85A190-283[»]
2HE2X-ray1.50A/B418-513[»]
ProteinModelPortaliQ15700.
SMRiQ15700.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15700.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini98 – 184PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini193 – 279PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini421 – 501PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini536 – 606SH3PROSITE-ProRule annotationAdd BLAST71
Domaini680 – 855Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Domaini

An N-terminally truncated L27 domain is predicted in isoform 2 at positions 1 through 27.

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ15700.
KOiK12075.
OMAiQGLSFRY.
OrthoDBiEOG091G0BB1.
PhylomeDBiQ15700.
TreeFamiTF323171.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 2 hits.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15700-1) [UniParc]FASTAAdd to basket
Also known as: PSD93-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDAPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSE VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVDDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSAPYS HYHLGLLPDS EMTSHSQHST
410 420 430 440 450
ATRQPSMTLQ RAVSLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVMLEGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGSFND KRKKSFIFSR KFPFYKNKEQ
660 670 680 690 700
SEQETSDPER GQEDLILSYE PVTRQEINYT RPVIILGPMK DRINDDLISE
710 720 730 740 750
FPDKFGSCVP HTTRPKRDYE VDGRDYHFVI SREQMEKDIQ EHKFIEAGQY
760 770 780 790 800
NDNLYGTSVQ SVRFVAERGK HCILDVSGNA IKRLQVAQLY PIAIFIKPRS
810 820 830 840 850
LEPLMEMNKR LTEEQAKKTY DRAIKLEQEF GEYFTAIVQG DTLEDIYNQC
860 870
KLVIEEQSGP FIWIPSKEKL
Length:870
Mass (Da):97,552
Last modified:November 25, 2008 - v3
Checksum:iBC51554590060E48
GO
Isoform 2 (identifier: Q15700-2) [UniParc]FASTAAdd to basket
Also known as: PSD93-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MGIFKSSLFQ...PAWMPVHHCT

Show »
Length:975
Mass (Da):109,371
Checksum:iB4677B45F351C12D
GO
Isoform 3 (identifier: Q15700-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     52-86: IENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPY → MQRPSVSRAENYQLLWDTIASLKQCEQAMQHAFIP
     341-392: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Show »
Length:749
Mass (Da):83,405
Checksum:i6E4FC590B5EE8BED
GO
Isoform 4 (identifier: Q15700-4) [UniParc]FASTAAdd to basket
Also known as: PSD93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:909
Mass (Da):100,981
Checksum:i2A857BA09A6587E0
GO
Isoform 5 (identifier: Q15700-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-518: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Note: No experimental confirmation available.Curated
Show »
Length:334
Mass (Da):38,404
Checksum:iDED1A839B4181509
GO

Sequence cautioni

The sequence BAD92489 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti177V → A in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti278K → N in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti704K → E in CAI45970 (PubMed:17974005).Curated1
Sequence conflicti803P → S in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti861F → L in CAH18680 (PubMed:17974005).Curated1
Isoform 5 (identifier: Q15700-5)
Sequence conflicti116D → E in CAI45970 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0456341 – 518Missing in isoform 5. 1 PublicationAdd BLAST518
Alternative sequenceiVSP_0155111 – 68MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA VRSAPTLIRDAHCACGWQRN CQGLGYSSQTMPSSGPGGPA SNRTGGSSFNRTLWDSVRKS PHKTSTKGKGTCGEHCTCPH GWFSPAQ in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_0155121 – 51Missing in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0155131 – 14MFFAC…RTNVK → MGIFKSSLFQALLDIQEFYE VTLLNSQKSCEQKIEEANQV LQKWEKTSLLAPCHDRLQKS SELTDCSGSKENASCIEQNK ENQSFENETDETTTQNQGRC PAQNCSVEAPAWMPVHHCT in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_01551452 – 86IENVH…DTIPY → MQRPSVSRAENYQLLWDTIA SLKQCEQAMQHAFIP in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_015515341 – 392Missing in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_015516627 – 659SFNDK…TSDPE → DIPGLGDDGYGTKTL in isoform 3 and isoform 5. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U32376 mRNA. Translation: AAB04949.1.
AK126776 mRNA. Translation: BAC86685.1.
CR749820 mRNA. Translation: CAH18680.1.
CR933674 mRNA. Translation: CAI45970.1.
AC023118 Genomic DNA. No translation available.
AP000639 Genomic DNA. No translation available.
AP000642 Genomic DNA. No translation available.
AP000773 Genomic DNA. No translation available.
AP000852 Genomic DNA. No translation available.
AP000857 Genomic DNA. No translation available.
AP001791 Genomic DNA. No translation available.
AP001825 Genomic DNA. No translation available.
AP001984 Genomic DNA. No translation available.
AP002370 Genomic DNA. No translation available.
AP002751 Genomic DNA. No translation available.
AP002797 Genomic DNA. No translation available.
AP002803 Genomic DNA. No translation available.
AP002878 Genomic DNA. No translation available.
AP003026 Genomic DNA. No translation available.
AP003035 Genomic DNA. No translation available.
AP003093 Genomic DNA. No translation available.
AP003095 Genomic DNA. No translation available.
AP003305 Genomic DNA. No translation available.
AB209252 mRNA. Translation: BAD92489.1. Different initiation.
CCDSiCCDS41696.1. [Q15700-1]
CCDS44690.1. [Q15700-2]
CCDS44691.1. [Q15700-3]
CCDS44692.1. [Q15700-5]
CCDS55782.1. [Q15700-4]
PIRiG01974.
S60315.
RefSeqiNP_001136171.1. NM_001142699.1. [Q15700-2]
NP_001136172.1. NM_001142700.1. [Q15700-3]
NP_001136174.1. NM_001142702.1. [Q15700-5]
NP_001193698.1. NM_001206769.1. [Q15700-4]
NP_001355.2. NM_001364.3. [Q15700-1]
UniGeneiHs.367656.

Genome annotation databases

EnsembliENST00000280241; ENSP00000280241; ENSG00000150672. [Q15700-4]
ENST00000376104; ENSP00000365272; ENSG00000150672. [Q15700-2]
ENST00000398309; ENSP00000381355; ENSG00000150672. [Q15700-1]
ENST00000418306; ENSP00000402275; ENSG00000150672. [Q15700-3]
ENST00000426717; ENSP00000393049; ENSG00000150672. [Q15700-5]
GeneIDi1740.
KEGGihsa:1740.
UCSCiuc001pai.3. human. [Q15700-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U32376 mRNA. Translation: AAB04949.1.
AK126776 mRNA. Translation: BAC86685.1.
CR749820 mRNA. Translation: CAH18680.1.
CR933674 mRNA. Translation: CAI45970.1.
AC023118 Genomic DNA. No translation available.
AP000639 Genomic DNA. No translation available.
AP000642 Genomic DNA. No translation available.
AP000773 Genomic DNA. No translation available.
AP000852 Genomic DNA. No translation available.
AP000857 Genomic DNA. No translation available.
AP001791 Genomic DNA. No translation available.
AP001825 Genomic DNA. No translation available.
AP001984 Genomic DNA. No translation available.
AP002370 Genomic DNA. No translation available.
AP002751 Genomic DNA. No translation available.
AP002797 Genomic DNA. No translation available.
AP002803 Genomic DNA. No translation available.
AP002878 Genomic DNA. No translation available.
AP003026 Genomic DNA. No translation available.
AP003035 Genomic DNA. No translation available.
AP003093 Genomic DNA. No translation available.
AP003095 Genomic DNA. No translation available.
AP003305 Genomic DNA. No translation available.
AB209252 mRNA. Translation: BAD92489.1. Different initiation.
CCDSiCCDS41696.1. [Q15700-1]
CCDS44690.1. [Q15700-2]
CCDS44691.1. [Q15700-3]
CCDS44692.1. [Q15700-5]
CCDS55782.1. [Q15700-4]
PIRiG01974.
S60315.
RefSeqiNP_001136171.1. NM_001142699.1. [Q15700-2]
NP_001136172.1. NM_001142700.1. [Q15700-3]
NP_001136174.1. NM_001142702.1. [Q15700-5]
NP_001193698.1. NM_001206769.1. [Q15700-4]
NP_001355.2. NM_001364.3. [Q15700-1]
UniGeneiHs.367656.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BYGX-ray1.85A190-283[»]
2HE2X-ray1.50A/B418-513[»]
ProteinModelPortaliQ15700.
SMRiQ15700.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108084. 23 interactors.
IntActiQ15700. 19 interactors.
MINTiMINT-470785.
STRINGi9606.ENSP00000365272.

PTM databases

iPTMnetiQ15700.
PhosphoSitePlusiQ15700.

Polymorphism and mutation databases

BioMutaiDLG2.
DMDMi215274165.

Proteomic databases

EPDiQ15700.
MaxQBiQ15700.
PaxDbiQ15700.
PeptideAtlasiQ15700.
PRIDEiQ15700.

Protocols and materials databases

DNASUi1740.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000280241; ENSP00000280241; ENSG00000150672. [Q15700-4]
ENST00000376104; ENSP00000365272; ENSG00000150672. [Q15700-2]
ENST00000398309; ENSP00000381355; ENSG00000150672. [Q15700-1]
ENST00000418306; ENSP00000402275; ENSG00000150672. [Q15700-3]
ENST00000426717; ENSP00000393049; ENSG00000150672. [Q15700-5]
GeneIDi1740.
KEGGihsa:1740.
UCSCiuc001pai.3. human. [Q15700-1]

Organism-specific databases

CTDi1740.
DisGeNETi1740.
GeneCardsiDLG2.
HGNCiHGNC:2901. DLG2.
HPAiHPA021307.
MIMi603583. gene.
neXtProtiNX_Q15700.
OpenTargetsiENSG00000150672.
PharmGKBiPA164741388.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ15700.
KOiK12075.
OMAiQGLSFRY.
OrthoDBiEOG091G0BB1.
PhylomeDBiQ15700.
TreeFamiTF323171.

Enzyme and pathway databases

ReactomeiR-HSA-6794361. Interactions of neurexins and neuroligins at synapses.

Miscellaneous databases

ChiTaRSiDLG2. human.
EvolutionaryTraceiQ15700.
GeneWikiiDLG2.
GenomeRNAii1740.
PROiQ15700.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000150672.
CleanExiHS_DLG2.
ExpressionAtlasiQ15700. baseline and differential.
GenevisibleiQ15700. HS.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 2 hits.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDLG2_HUMAN
AccessioniPrimary (citable) accession number: Q15700
Secondary accession number(s): B7WNY8
, F8W9V6, Q59G57, Q5H9Q4, Q68CQ8, Q6ZTA8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: November 30, 2016
This is version 171 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.