Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15700 (DLG2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 147. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name=Chapsyn-110
Postsynaptic density protein PSD-93
Gene names
Name:DLG2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length870 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses By similarity.

Subunit structure

Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain By similarity. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains. Interacts with KCNJ4 By similarity, Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG. Interacts with KCNJ4 By similarity. Ref.6 Ref.7 Ref.8 Ref.9

Subcellular location

Membrane; Lipid-anchor By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse By similarity. Note: Concentrated in soma and postsynaptic density of a subset of neurons By similarity.

Domain

An N-terminally truncated L27 domain is predicted in isoform 2 at positions 1 through 27.

Post-translational modification

Palmitoylation of isoform 1 is not required for targeting to postsynaptic density By similarity.

Sequence similarities

Belongs to the MAGUK family.

Contains 1 guanylate kinase-like domain.

Contains 3 PDZ (DHR) domains.

Contains 1 SH3 domain.

Sequence caution

The sequence BAD92489.1 differs from that shown. Reason: Erroneous initiation.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

Kcnj2P355616EBI-663057,EBI-703793From a different organism.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q15700-1)

Also known as: PSD93-alpha;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q15700-2)

Also known as: PSD93-beta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MGIFKSSLFQ...PAWMPVHHCT
Isoform 3 (identifier: Q15700-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     52-86: IENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPY → MQRPSVSRAENYQLLWDTIASLKQCEQAMQHAFIP
     341-392: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL
Isoform 4 (identifier: Q15700-4)

Also known as: PSD93-delta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ
Isoform 5 (identifier: Q15700-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-518: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 870870Disks large homolog 2
PRO_0000094553

Regions

Domain98 – 18487PDZ 1
Domain193 – 27987PDZ 2
Domain421 – 50181PDZ 3
Domain536 – 60671SH3
Domain680 – 855176Guanylate kinase-like

Amino acid modifications

Modified residue281Phosphoserine By similarity
Modified residue581Phosphotyrosine By similarity
Modified residue651Phosphoserine By similarity
Modified residue4141Phosphoserine By similarity
Modified residue5051Phosphotyrosine By similarity
Modified residue7501Phosphotyrosine By similarity
Modified residue7551Phosphotyrosine By similarity
Lipidation51S-palmitoyl cysteine By similarity
Lipidation71S-palmitoyl cysteine By similarity

Natural variations

Alternative sequence1 – 518518Missing in isoform 5.
VSP_045634
Alternative sequence1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA VRSAPTLIRDAHCACGWQRN CQGLGYSSQTMPSSGPGGPA SNRTGGSSFNRTLWDSVRKS PHKTSTKGKGTCGEHCTCPH GWFSPAQ in isoform 4.
VSP_015511
Alternative sequence1 – 5151Missing in isoform 3.
VSP_015512
Alternative sequence1 – 1414MFFAC…RTNVK → MGIFKSSLFQALLDIQEFYE VTLLNSQKSCEQKIEEANQV LQKWEKTSLLAPCHDRLQKS SELTDCSGSKENASCIEQNK ENQSFENETDETTTQNQGRC PAQNCSVEAPAWMPVHHCT in isoform 2.
VSP_015513
Alternative sequence52 – 8635IENVH…DTIPY → MQRPSVSRAENYQLLWDTIA SLKQCEQAMQHAFIP in isoform 3.
VSP_015514
Alternative sequence341 – 39252Missing in isoform 3.
VSP_015515
Alternative sequence627 – 65933SFNDK…TSDPE → DIPGLGDDGYGTKTL in isoform 3 and isoform 5.
VSP_015516

Experimental info

Sequence conflict1771V → A in AAB04949. Ref.1
Sequence conflict2781K → N in AAB04949. Ref.1
Sequence conflict7041K → E in CAI45970. Ref.3
Sequence conflict8031P → S in AAB04949. Ref.1
Sequence conflict8611F → L in CAH18680. Ref.3
Isoform 5:
Sequence conflict1161D → E in CAI45970. Ref.3

Secondary structure

............................... 870
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (PSD93-alpha) [UniParc].

Last modified November 25, 2008. Version 3.
Checksum: BC51554590060E48

FASTA87097,552
        10         20         30         40         50         60 
MFFACYCALR TNVKKYRYQD EDAPHDHSLP RLTHEVRGPE LVHVSEKNLS QIENVHGYVL 

        70         80         90        100        110        120 
QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT LERGNSGLGF SIAGGTDNPH 

       130        140        150        160        170        180 
IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY 

       190        200        210        220        230        240 
VRRRRPILET VVEIKLFKGP KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ 

       250        260        270        280        290        300 
VGDRLLMVNN YSLEEVTHEE AVAILKNTSE VVYLKVGKPT TIYMTDPYGP PDITHSYSPP 

       310        320        330        340        350        360 
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVDDDY TRPPEPVYST VNKLCDKPAS 

       370        380        390        400        410        420 
PRHYSPVECD KSFLLSAPYS HYHLGLLPDS EMTSHSQHST ATRQPSMTLQ RAVSLEGEPR 

       430        440        450        460        470        480 
KVVLHKGSTG LGFNIVGGED GEGIFVSFIL AGGPADLSGE LQRGDQILSV NGIDLRGASH 

       490        500        510        520        530        540 
EQAAAALKGA GQTVTIIAQY QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY 

       550        560        570        580        590        600 
VRAMFDYDKS KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVMLEGDS EEMGVIPSKR 

       610        620        630        640        650        660 
RVERKERARL KTVKFNAKPG VIDSKGSFND KRKKSFIFSR KFPFYKNKEQ SEQETSDPER 

       670        680        690        700        710        720 
GQEDLILSYE PVTRQEINYT RPVIILGPMK DRINDDLISE FPDKFGSCVP HTTRPKRDYE 

       730        740        750        760        770        780 
VDGRDYHFVI SREQMEKDIQ EHKFIEAGQY NDNLYGTSVQ SVRFVAERGK HCILDVSGNA 

       790        800        810        820        830        840 
IKRLQVAQLY PIAIFIKPRS LEPLMEMNKR LTEEQAKKTY DRAIKLEQEF GEYFTAIVQG 

       850        860        870 
DTLEDIYNQC KLVIEEQSGP FIWIPSKEKL 

« Hide

Isoform 2 (PSD93-beta) [UniParc].

Checksum: B4677B45F351C12D
Show »

FASTA975109,371
Isoform 3 [UniParc].

Checksum: 6E4FC590B5EE8BED
Show »

FASTA74983,405
Isoform 4 (PSD93-delta) [UniParc].

Checksum: 2A857BA09A6587E0
Show »

FASTA909100,981
Isoform 5 [UniParc].

Checksum: DED1A839B4181509
Show »

FASTA33438,404

References

« Hide 'large scale' references
[1]"Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins."
Kim E., Cho K.-O., Rothschild A., Sheng M.
Neuron 17:103-113(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Cerebellum.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
Tissue: Retina.
[4]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-542 (ISOFORM 1).
Tissue: Brain.
[6]"An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
Leyland M.L., Dart C.
J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH KCNJ2.
[7]"SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses."
Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E.
Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH LRFN1; LRFN2 AND LRFN4.
[8]"Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis."
Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E.
J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH FRMPD4.
[9]"Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
Voss M., Lettau M., Janssen O.
BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH FASLG.
[10]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions."
Elkins J.M., Papagrigoriou E., Berridge G., Yang X., Phillips C., Gileadi C., Savitsky P., Doyle D.A.
Protein Sci. 16:683-694(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 190-283, X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 418-513.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U32376 mRNA. Translation: AAB04949.1.
AK126776 mRNA. Translation: BAC86685.1.
CR749820 mRNA. Translation: CAH18680.1.
CR933674 mRNA. Translation: CAI45970.1.
AC023118 Genomic DNA. No translation available.
AP000639 Genomic DNA. No translation available.
AP000642 Genomic DNA. No translation available.
AP000773 Genomic DNA. No translation available.
AP000852 Genomic DNA. No translation available.
AP000857 Genomic DNA. No translation available.
AP001791 Genomic DNA. No translation available.
AP001825 Genomic DNA. No translation available.
AP001984 Genomic DNA. No translation available.
AP002370 Genomic DNA. No translation available.
AP002751 Genomic DNA. No translation available.
AP002797 Genomic DNA. No translation available.
AP002803 Genomic DNA. No translation available.
AP002878 Genomic DNA. No translation available.
AP003026 Genomic DNA. No translation available.
AP003035 Genomic DNA. No translation available.
AP003093 Genomic DNA. No translation available.
AP003095 Genomic DNA. No translation available.
AP003305 Genomic DNA. No translation available.
AB209252 mRNA. Translation: BAD92489.1. Different initiation.
CCDSCCDS41696.1. [Q15700-1]
CCDS44690.1. [Q15700-2]
CCDS44691.1. [Q15700-3]
CCDS44692.1. [Q15700-5]
CCDS55782.1. [Q15700-4]
PIRG01974.
S60315.
RefSeqNP_001136171.1. NM_001142699.1. [Q15700-2]
NP_001136172.1. NM_001142700.1. [Q15700-3]
NP_001136174.1. NM_001142702.1. [Q15700-5]
NP_001193698.1. NM_001206769.1. [Q15700-4]
NP_001355.2. NM_001364.3. [Q15700-1]
UniGeneHs.367656.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2BYGX-ray1.85A190-283[»]
2HE2X-ray1.50A/B418-513[»]
ProteinModelPortalQ15700.
SMRQ15700. Positions 93-283, 389-870.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid108084. 23 interactions.
IntActQ15700. 8 interactions.
MINTMINT-470785.
STRING9606.ENSP00000365272.

PTM databases

PhosphoSiteQ15700.

Polymorphism databases

DMDM215274165.

Proteomic databases

MaxQBQ15700.
PaxDbQ15700.
PRIDEQ15700.

Protocols and materials databases

DNASU1740.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000280241; ENSP00000280241; ENSG00000150672. [Q15700-4]
ENST00000376104; ENSP00000365272; ENSG00000150672. [Q15700-2]
ENST00000376106; ENSP00000365274; ENSG00000150672. [Q15700-5]
ENST00000398309; ENSP00000381355; ENSG00000150672. [Q15700-1]
ENST00000418306; ENSP00000402275; ENSG00000150672. [Q15700-3]
ENST00000426717; ENSP00000393049; ENSG00000150672. [Q15700-5]
ENST00000543673; ENSP00000441994; ENSG00000150672. [Q15700-2]
GeneID1740.
KEGGhsa:1740.
UCSCuc001pai.2. human. [Q15700-3]
uc001paj.2. human. [Q15700-1]
uc001pak.2. human. [Q15700-2]
uc010rsw.1. human.
uc021qof.1. human. [Q15700-4]

Organism-specific databases

CTD1740.
GeneCardsGC11M083166.
HGNCHGNC:2901. DLG2.
HPAHPA021307.
MIM603583. gene.
neXtProtNX_Q15700.
PharmGKBPA164741388.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0194.
HOGENOMHOG000232102.
HOVERGENHBG107814.
KOK12075.
OMADIFFINI.
OrthoDBEOG79GT6P.
PhylomeDBQ15700.
TreeFamTF323171.

Gene expression databases

ArrayExpressQ15700.
BgeeQ15700.
CleanExHS_DLG2.
GenevestigatorQ15700.

Family and domain databases

Gene3D2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProIPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERPTHR23119. PTHR23119. 1 hit.
PfamPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTSM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ15700.
GeneWikiDLG2.
GenomeRNAi1740.
NextBio7057.
PROQ15700.
SOURCESearch...

Entry information

Entry nameDLG2_HUMAN
AccessionPrimary (citable) accession number: Q15700
Secondary accession number(s): B7WNY8 expand/collapse secondary AC list , F8W9V6, Q59G57, Q5H9Q4, Q68CQ8, Q6ZTA8
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: July 9, 2014
This is version 147 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM