Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15700

- DLG2_HUMAN

UniProt

Q15700 - DLG2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Disks large homolog 2

Gene

DLG2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses (By similarity).By similarity

GO - Molecular functioni

  1. guanylate kinase activity Source: ProtInc

GO - Biological processi

  1. negative regulation of phosphatase activity Source: UniProtKB
  2. nucleotide phosphorylation Source: GOC
  3. sensory perception of pain Source: Ensembl
  4. synaptic transmission Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
Gene namesi
Name:DLG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:2901. DLG2.

Subcellular locationi

Membrane By similarity; Lipid-anchor By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse By similarity
Note: Concentrated in soma and postsynaptic density of a subset of neurons.By similarity

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. juxtaparanode region of axon Source: Ensembl
  3. plasma membrane Source: ProtInc
  4. postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164741388.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 870870Disks large homolog 2PRO_0000094553Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi5 – 51S-palmitoyl cysteineBy similarity
Lipidationi7 – 71S-palmitoyl cysteineBy similarity
Modified residuei28 – 281PhosphoserineBy similarity
Modified residuei58 – 581PhosphotyrosineBy similarity
Modified residuei65 – 651PhosphoserineBy similarity
Modified residuei414 – 4141PhosphoserineBy similarity
Modified residuei505 – 5051PhosphotyrosineBy similarity
Modified residuei750 – 7501PhosphotyrosineBy similarity
Modified residuei755 – 7551PhosphotyrosineBy similarity

Post-translational modificationi

Palmitoylation of isoform 1 is not required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiQ15700.
PaxDbiQ15700.
PRIDEiQ15700.

PTM databases

PhosphoSiteiQ15700.

Expressioni

Gene expression databases

BgeeiQ15700.
CleanExiHS_DLG2.
ExpressionAtlasiQ15700. baseline and differential.
GenevestigatoriQ15700.

Organism-specific databases

HPAiHPA021307.

Interactioni

Subunit structurei

Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain (By similarity). Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains. Interacts with KCNJ4 (By similarity), Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG. Interacts with KCNJ4 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Kcnj2P355616EBI-663057,EBI-703793From a different organism.

Protein-protein interaction databases

BioGridi108084. 24 interactions.
IntActiQ15700. 8 interactions.
MINTiMINT-470785.
STRINGi9606.ENSP00000365272.

Structurei

Secondary structure

1
870
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi190 – 1978Combined sources
Beta strandi202 – 2098Combined sources
Beta strandi222 – 2276Combined sources
Helixi232 – 2365Combined sources
Beta strandi244 – 2485Combined sources
Helixi258 – 2669Combined sources
Beta strandi270 – 28112Combined sources
Beta strandi420 – 4256Combined sources
Beta strandi432 – 4398Combined sources
Beta strandi444 – 4496Combined sources
Helixi454 – 4585Combined sources
Beta strandi465 – 4706Combined sources
Helixi480 – 48910Combined sources
Beta strandi492 – 5009Combined sources
Helixi502 – 5109Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2BYGX-ray1.85A190-283[»]
2HE2X-ray1.50A/B418-513[»]
ProteinModelPortaliQ15700.
SMRiQ15700. Positions 93-283, 389-870.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15700.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini98 – 18487PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini193 – 27987PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini421 – 50181PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini536 – 60671SH3PROSITE-ProRule annotationAdd
BLAST
Domaini680 – 855176Guanylate kinase-likePROSITE-ProRule annotationAdd
BLAST

Domaini

An N-terminally truncated L27 domain is predicted in isoform 2 at positions 1 through 27.

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiCOG0194.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ15700.
KOiK12075.
OMAiDIFFINI.
OrthoDBiEOG79GT6P.
PhylomeDBiQ15700.
TreeFamiTF323171.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23119. PTHR23119. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q15700-1) [UniParc]FASTAAdd to Basket

Also known as: PSD93-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDAPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSE VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVDDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSAPYS HYHLGLLPDS EMTSHSQHST
410 420 430 440 450
ATRQPSMTLQ RAVSLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVMLEGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGSFND KRKKSFIFSR KFPFYKNKEQ
660 670 680 690 700
SEQETSDPER GQEDLILSYE PVTRQEINYT RPVIILGPMK DRINDDLISE
710 720 730 740 750
FPDKFGSCVP HTTRPKRDYE VDGRDYHFVI SREQMEKDIQ EHKFIEAGQY
760 770 780 790 800
NDNLYGTSVQ SVRFVAERGK HCILDVSGNA IKRLQVAQLY PIAIFIKPRS
810 820 830 840 850
LEPLMEMNKR LTEEQAKKTY DRAIKLEQEF GEYFTAIVQG DTLEDIYNQC
860 870
KLVIEEQSGP FIWIPSKEKL
Length:870
Mass (Da):97,552
Last modified:November 25, 2008 - v3
Checksum:iBC51554590060E48
GO
Isoform 2 (identifier: Q15700-2) [UniParc]FASTAAdd to Basket

Also known as: PSD93-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MGIFKSSLFQ...PAWMPVHHCT

Show »
Length:975
Mass (Da):109,371
Checksum:iB4677B45F351C12D
GO
Isoform 3 (identifier: Q15700-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     52-86: IENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPY → MQRPSVSRAENYQLLWDTIASLKQCEQAMQHAFIP
     341-392: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Show »
Length:749
Mass (Da):83,405
Checksum:i6E4FC590B5EE8BED
GO
Isoform 4 (identifier: Q15700-4) [UniParc]FASTAAdd to Basket

Also known as: PSD93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:909
Mass (Da):100,981
Checksum:i2A857BA09A6587E0
GO
Isoform 5 (identifier: Q15700-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-518: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Note: No experimental confirmation available.Curated

Show »
Length:334
Mass (Da):38,404
Checksum:iDED1A839B4181509
GO

Sequence cautioni

The sequence BAD92489.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti177 – 1771V → A in AAB04949. (PubMed:8755482)Curated
Sequence conflicti278 – 2781K → N in AAB04949. (PubMed:8755482)Curated
Sequence conflicti704 – 7041K → E in CAI45970. (PubMed:17974005)Curated
Sequence conflicti803 – 8031P → S in AAB04949. (PubMed:8755482)Curated
Sequence conflicti861 – 8611F → L in CAH18680. (PubMed:17974005)Curated
Isoform 5 (identifier: Q15700-5)
Sequence conflicti116 – 1161D → E in CAI45970. (PubMed:17974005)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 518518Missing in isoform 5. 1 PublicationVSP_045634Add
BLAST
Alternative sequencei1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA VRSAPTLIRDAHCACGWQRN CQGLGYSSQTMPSSGPGGPA SNRTGGSSFNRTLWDSVRKS PHKTSTKGKGTCGEHCTCPH GWFSPAQ in isoform 4. CuratedVSP_015511Add
BLAST
Alternative sequencei1 – 5151Missing in isoform 3. 1 PublicationVSP_015512Add
BLAST
Alternative sequencei1 – 1414MFFAC…RTNVK → MGIFKSSLFQALLDIQEFYE VTLLNSQKSCEQKIEEANQV LQKWEKTSLLAPCHDRLQKS SELTDCSGSKENASCIEQNK ENQSFENETDETTTQNQGRC PAQNCSVEAPAWMPVHHCT in isoform 2. 1 PublicationVSP_015513Add
BLAST
Alternative sequencei52 – 8635IENVH…DTIPY → MQRPSVSRAENYQLLWDTIA SLKQCEQAMQHAFIP in isoform 3. 1 PublicationVSP_015514Add
BLAST
Alternative sequencei341 – 39252Missing in isoform 3. 1 PublicationVSP_015515Add
BLAST
Alternative sequencei627 – 65933SFNDK…TSDPE → DIPGLGDDGYGTKTL in isoform 3 and isoform 5. 2 PublicationsVSP_015516Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U32376 mRNA. Translation: AAB04949.1.
AK126776 mRNA. Translation: BAC86685.1.
CR749820 mRNA. Translation: CAH18680.1.
CR933674 mRNA. Translation: CAI45970.1.
AC023118 Genomic DNA. No translation available.
AP000639 Genomic DNA. No translation available.
AP000642 Genomic DNA. No translation available.
AP000773 Genomic DNA. No translation available.
AP000852 Genomic DNA. No translation available.
AP000857 Genomic DNA. No translation available.
AP001791 Genomic DNA. No translation available.
AP001825 Genomic DNA. No translation available.
AP001984 Genomic DNA. No translation available.
AP002370 Genomic DNA. No translation available.
AP002751 Genomic DNA. No translation available.
AP002797 Genomic DNA. No translation available.
AP002803 Genomic DNA. No translation available.
AP002878 Genomic DNA. No translation available.
AP003026 Genomic DNA. No translation available.
AP003035 Genomic DNA. No translation available.
AP003093 Genomic DNA. No translation available.
AP003095 Genomic DNA. No translation available.
AP003305 Genomic DNA. No translation available.
AB209252 mRNA. Translation: BAD92489.1. Different initiation.
CCDSiCCDS41696.1. [Q15700-1]
CCDS44690.1. [Q15700-2]
CCDS44691.1. [Q15700-3]
CCDS44692.1. [Q15700-5]
CCDS55782.1. [Q15700-4]
PIRiG01974.
S60315.
RefSeqiNP_001136171.1. NM_001142699.1. [Q15700-2]
NP_001136172.1. NM_001142700.1. [Q15700-3]
NP_001136174.1. NM_001142702.1. [Q15700-5]
NP_001193698.1. NM_001206769.1. [Q15700-4]
NP_001355.2. NM_001364.3. [Q15700-1]
UniGeneiHs.367656.

Genome annotation databases

EnsembliENST00000280241; ENSP00000280241; ENSG00000150672. [Q15700-4]
ENST00000376104; ENSP00000365272; ENSG00000150672. [Q15700-2]
ENST00000398309; ENSP00000381355; ENSG00000150672. [Q15700-1]
ENST00000418306; ENSP00000402275; ENSG00000150672. [Q15700-3]
ENST00000426717; ENSP00000393049; ENSG00000150672. [Q15700-5]
GeneIDi1740.
KEGGihsa:1740.
UCSCiuc001pai.2. human. [Q15700-3]
uc001paj.2. human. [Q15700-1]
uc001pak.2. human. [Q15700-2]
uc010rsw.1. human.
uc021qof.1. human. [Q15700-4]

Polymorphism databases

DMDMi215274165.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U32376 mRNA. Translation: AAB04949.1 .
AK126776 mRNA. Translation: BAC86685.1 .
CR749820 mRNA. Translation: CAH18680.1 .
CR933674 mRNA. Translation: CAI45970.1 .
AC023118 Genomic DNA. No translation available.
AP000639 Genomic DNA. No translation available.
AP000642 Genomic DNA. No translation available.
AP000773 Genomic DNA. No translation available.
AP000852 Genomic DNA. No translation available.
AP000857 Genomic DNA. No translation available.
AP001791 Genomic DNA. No translation available.
AP001825 Genomic DNA. No translation available.
AP001984 Genomic DNA. No translation available.
AP002370 Genomic DNA. No translation available.
AP002751 Genomic DNA. No translation available.
AP002797 Genomic DNA. No translation available.
AP002803 Genomic DNA. No translation available.
AP002878 Genomic DNA. No translation available.
AP003026 Genomic DNA. No translation available.
AP003035 Genomic DNA. No translation available.
AP003093 Genomic DNA. No translation available.
AP003095 Genomic DNA. No translation available.
AP003305 Genomic DNA. No translation available.
AB209252 mRNA. Translation: BAD92489.1 . Different initiation.
CCDSi CCDS41696.1. [Q15700-1 ]
CCDS44690.1. [Q15700-2 ]
CCDS44691.1. [Q15700-3 ]
CCDS44692.1. [Q15700-5 ]
CCDS55782.1. [Q15700-4 ]
PIRi G01974.
S60315.
RefSeqi NP_001136171.1. NM_001142699.1. [Q15700-2 ]
NP_001136172.1. NM_001142700.1. [Q15700-3 ]
NP_001136174.1. NM_001142702.1. [Q15700-5 ]
NP_001193698.1. NM_001206769.1. [Q15700-4 ]
NP_001355.2. NM_001364.3. [Q15700-1 ]
UniGenei Hs.367656.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2BYG X-ray 1.85 A 190-283 [» ]
2HE2 X-ray 1.50 A/B 418-513 [» ]
ProteinModelPortali Q15700.
SMRi Q15700. Positions 93-283, 389-870.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108084. 24 interactions.
IntActi Q15700. 8 interactions.
MINTi MINT-470785.
STRINGi 9606.ENSP00000365272.

PTM databases

PhosphoSitei Q15700.

Polymorphism databases

DMDMi 215274165.

Proteomic databases

MaxQBi Q15700.
PaxDbi Q15700.
PRIDEi Q15700.

Protocols and materials databases

DNASUi 1740.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000280241 ; ENSP00000280241 ; ENSG00000150672 . [Q15700-4 ]
ENST00000376104 ; ENSP00000365272 ; ENSG00000150672 . [Q15700-2 ]
ENST00000398309 ; ENSP00000381355 ; ENSG00000150672 . [Q15700-1 ]
ENST00000418306 ; ENSP00000402275 ; ENSG00000150672 . [Q15700-3 ]
ENST00000426717 ; ENSP00000393049 ; ENSG00000150672 . [Q15700-5 ]
GeneIDi 1740.
KEGGi hsa:1740.
UCSCi uc001pai.2. human. [Q15700-3 ]
uc001paj.2. human. [Q15700-1 ]
uc001pak.2. human. [Q15700-2 ]
uc010rsw.1. human.
uc021qof.1. human. [Q15700-4 ]

Organism-specific databases

CTDi 1740.
GeneCardsi GC11M083166.
HGNCi HGNC:2901. DLG2.
HPAi HPA021307.
MIMi 603583. gene.
neXtProti NX_Q15700.
PharmGKBi PA164741388.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0194.
GeneTreei ENSGT00760000118866.
HOGENOMi HOG000232102.
HOVERGENi HBG107814.
InParanoidi Q15700.
KOi K12075.
OMAi DIFFINI.
OrthoDBi EOG79GT6P.
PhylomeDBi Q15700.
TreeFami TF323171.

Miscellaneous databases

ChiTaRSi DLG2. human.
EvolutionaryTracei Q15700.
GeneWikii DLG2.
GenomeRNAii 1740.
NextBioi 7057.
PROi Q15700.
SOURCEi Search...

Gene expression databases

Bgeei Q15700.
CleanExi HS_DLG2.
ExpressionAtlasi Q15700. baseline and differential.
Genevestigatori Q15700.

Family and domain databases

Gene3Di 2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProi IPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR23119. PTHR23119. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view ]
PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
SMARTi SM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins."
    Kim E., Cho K.-O., Rothschild A., Sheng M.
    Neuron 17:103-113(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Cerebellum.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
    Tissue: Retina.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-542 (ISOFORM 1).
    Tissue: Brain.
  6. "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
    Leyland M.L., Dart C.
    J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH KCNJ2.
  7. "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses."
    Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E.
    Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH LRFN1; LRFN2 AND LRFN4.
  8. "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis."
    Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E.
    J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FRMPD4.
  9. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
    Voss M., Lettau M., Janssen O.
    BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FASLG.
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions."
    Elkins J.M., Papagrigoriou E., Berridge G., Yang X., Phillips C., Gileadi C., Savitsky P., Doyle D.A.
    Protein Sci. 16:683-694(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 190-283, X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 418-513.

Entry informationi

Entry nameiDLG2_HUMAN
AccessioniPrimary (citable) accession number: Q15700
Secondary accession number(s): B7WNY8
, F8W9V6, Q59G57, Q5H9Q4, Q68CQ8, Q6ZTA8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: November 26, 2014
This is version 150 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3