Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 2

Gene

DLG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses (By similarity).By similarity

GO - Molecular functioni

  • guanylate kinase activity Source: ProtInc
  • ionotropic glutamate receptor binding Source: GO_Central
  • kinase binding Source: MGI

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-6794361 Neurexins and neuroligins

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
Gene namesi
Name:DLG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000150672.16
HGNCiHGNC:2901 DLG2
MIMi603583 gene
neXtProtiNX_Q15700

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi1740
OpenTargetsiENSG00000150672
PharmGKBiPA164741388

Polymorphism and mutation databases

BioMutaiDLG2
DMDMi215274165

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945531 – 870Disks large homolog 2Add BLAST870

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi5S-palmitoyl cysteineBy similarity1
Lipidationi7S-palmitoyl cysteineBy similarity1
Modified residuei28PhosphoserineBy similarity1
Modified residuei58PhosphotyrosineBy similarity1
Modified residuei65PhosphoserineBy similarity1
Modified residuei307PhosphoserineBy similarity1
Modified residuei328PhosphoserineBy similarity1
Modified residuei360PhosphoserineBy similarity1
Modified residuei365PhosphoserineBy similarity1
Modified residuei406PhosphoserineBy similarity1
Modified residuei414PhosphoserineBy similarity1
Modified residuei505PhosphotyrosineBy similarity1
Modified residuei528PhosphoserineBy similarity1
Modified residuei530PhosphoserineBy similarity1
Modified residuei553PhosphoserineBy similarity1
Modified residuei627PhosphoserineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei750PhosphotyrosineBy similarity1
Modified residuei755PhosphotyrosineBy similarity1

Post-translational modificationi

Palmitoylation of isoform 1 is not required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiQ15700
PaxDbiQ15700
PeptideAtlasiQ15700
PRIDEiQ15700

PTM databases

iPTMnetiQ15700
PhosphoSitePlusiQ15700

Expressioni

Gene expression databases

BgeeiENSG00000150672
CleanExiHS_DLG2
ExpressionAtlasiQ15700 baseline and differential
GenevisibleiQ15700 HS

Organism-specific databases

HPAiCAB072341
HPA021307
HPA023896

Interactioni

Subunit structurei

Interacts through its PDZ domains with NETO1 (By similarity). Interacts with NOS1/nNOS through second PDZ domain (By similarity). Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains (PubMed:15304517). Interacts with KCNJ4 (By similarity), Interacts with FRMPD4 (via C-terminus) (PubMed:19118189). Interacts with LRFN1, LRFN2 and LRFN4 (PubMed:16630835). Interacts with FASLG (PubMed:19807924). Interacts with KCNJ4 (By similarity). Interacts with ADAM22 (By similarity).By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Kcnj2P355616EBI-663057,EBI-703793From Mus musculus.

GO - Molecular functioni

  • ionotropic glutamate receptor binding Source: GO_Central
  • kinase binding Source: MGI

Protein-protein interaction databases

BioGridi108084, 24 interactors
ELMiQ15700
IntActiQ15700, 20 interactors
MINTiQ15700
STRINGi9606.ENSP00000365272

Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi190 – 197Combined sources8
Beta strandi202 – 209Combined sources8
Beta strandi222 – 227Combined sources6
Helixi232 – 236Combined sources5
Beta strandi244 – 248Combined sources5
Helixi258 – 266Combined sources9
Beta strandi270 – 281Combined sources12
Beta strandi420 – 425Combined sources6
Beta strandi432 – 439Combined sources8
Beta strandi444 – 449Combined sources6
Helixi454 – 458Combined sources5
Beta strandi465 – 470Combined sources6
Helixi480 – 489Combined sources10
Beta strandi492 – 500Combined sources9
Helixi502 – 510Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BYGX-ray1.85A190-283[»]
2HE2X-ray1.50A/B418-513[»]
ProteinModelPortaliQ15700
SMRiQ15700
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15700

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini98 – 184PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini193 – 279PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini421 – 501PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini536 – 606SH3PROSITE-ProRule annotationAdd BLAST71
Domaini680 – 855Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Domaini

An N-terminally truncated L27 domain is predicted in isoform 2 at positions 1 through 27.

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000232102
HOVERGENiHBG107814
InParanoidiQ15700
KOiK12075
OMAiERGQEDF
OrthoDBiEOG091G0BB1
PhylomeDBiQ15700
TreeFamiTF323171

Family and domain databases

CDDicd12032 SH3_DLG2, 1 hit
InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR035759 DLG2_SH3
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF10608 MAGUK_N_PEST, 2 hits
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF07653 SH3_2, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 2 hits
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15700-1) [UniParc]FASTAAdd to basket
Also known as: PSD93-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDAPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSE VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVDDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSAPYS HYHLGLLPDS EMTSHSQHST
410 420 430 440 450
ATRQPSMTLQ RAVSLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVMLEGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGSFND KRKKSFIFSR KFPFYKNKEQ
660 670 680 690 700
SEQETSDPER GQEDLILSYE PVTRQEINYT RPVIILGPMK DRINDDLISE
710 720 730 740 750
FPDKFGSCVP HTTRPKRDYE VDGRDYHFVI SREQMEKDIQ EHKFIEAGQY
760 770 780 790 800
NDNLYGTSVQ SVRFVAERGK HCILDVSGNA IKRLQVAQLY PIAIFIKPRS
810 820 830 840 850
LEPLMEMNKR LTEEQAKKTY DRAIKLEQEF GEYFTAIVQG DTLEDIYNQC
860 870
KLVIEEQSGP FIWIPSKEKL
Length:870
Mass (Da):97,552
Last modified:November 25, 2008 - v3
Checksum:iBC51554590060E48
GO
Isoform 2 (identifier: Q15700-2) [UniParc]FASTAAdd to basket
Also known as: PSD93-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MGIFKSSLFQ...PAWMPVHHCT

Show »
Length:975
Mass (Da):109,371
Checksum:iB4677B45F351C12D
GO
Isoform 3 (identifier: Q15700-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     52-86: IENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPY → MQRPSVSRAENYQLLWDTIASLKQCEQAMQHAFIP
     341-392: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Show »
Length:749
Mass (Da):83,405
Checksum:i6E4FC590B5EE8BED
GO
Isoform 4 (identifier: Q15700-4) [UniParc]FASTAAdd to basket
Also known as: PSD93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:909
Mass (Da):100,981
Checksum:i2A857BA09A6587E0
GO
Isoform 5 (identifier: Q15700-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-518: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Note: No experimental confirmation available.Curated
Show »
Length:334
Mass (Da):38,404
Checksum:iDED1A839B4181509
GO

Sequence cautioni

The sequence BAD92489 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti177V → A in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti278K → N in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti704K → E in CAI45970 (PubMed:17974005).Curated1
Sequence conflicti803P → S in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti861F → L in CAH18680 (PubMed:17974005).Curated1
Isoform 5 (identifier: Q15700-5)
Sequence conflicti116D → E in CAI45970 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0456341 – 518Missing in isoform 5. 1 PublicationAdd BLAST518
Alternative sequenceiVSP_0155111 – 68MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA VRSAPTLIRDAHCACGWQRN CQGLGYSSQTMPSSGPGGPA SNRTGGSSFNRTLWDSVRKS PHKTSTKGKGTCGEHCTCPH GWFSPAQ in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_0155121 – 51Missing in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0155131 – 14MFFAC…RTNVK → MGIFKSSLFQALLDIQEFYE VTLLNSQKSCEQKIEEANQV LQKWEKTSLLAPCHDRLQKS SELTDCSGSKENASCIEQNK ENQSFENETDETTTQNQGRC PAQNCSVEAPAWMPVHHCT in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_01551452 – 86IENVH…DTIPY → MQRPSVSRAENYQLLWDTIA SLKQCEQAMQHAFIP in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_015515341 – 392Missing in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_015516627 – 659SFNDK…TSDPE → DIPGLGDDGYGTKTL in isoform 3 and isoform 5. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U32376 mRNA Translation: AAB04949.1
AK126776 mRNA Translation: BAC86685.1
CR749820 mRNA Translation: CAH18680.1
CR933674 mRNA Translation: CAI45970.1
AC023118 Genomic DNA No translation available.
AP000639 Genomic DNA No translation available.
AP000642 Genomic DNA No translation available.
AP000773 Genomic DNA No translation available.
AP000852 Genomic DNA No translation available.
AP000857 Genomic DNA No translation available.
AP001791 Genomic DNA No translation available.
AP001825 Genomic DNA No translation available.
AP001984 Genomic DNA No translation available.
AP002370 Genomic DNA No translation available.
AP002751 Genomic DNA No translation available.
AP002797 Genomic DNA No translation available.
AP002803 Genomic DNA No translation available.
AP002878 Genomic DNA No translation available.
AP003026 Genomic DNA No translation available.
AP003035 Genomic DNA No translation available.
AP003093 Genomic DNA No translation available.
AP003095 Genomic DNA No translation available.
AP003305 Genomic DNA No translation available.
AB209252 mRNA Translation: BAD92489.1 Different initiation.
CCDSiCCDS41696.1 [Q15700-1]
CCDS44690.1 [Q15700-2]
CCDS44691.1 [Q15700-3]
CCDS44692.1 [Q15700-5]
CCDS55782.1 [Q15700-4]
PIRiG01974
S60315
RefSeqiNP_001136171.1, NM_001142699.1 [Q15700-2]
NP_001136172.1, NM_001142700.1 [Q15700-3]
NP_001136174.1, NM_001142702.1 [Q15700-5]
NP_001193698.1, NM_001206769.1 [Q15700-4]
NP_001355.2, NM_001364.3 [Q15700-1]
UniGeneiHs.367656

Genome annotation databases

EnsembliENST00000280241; ENSP00000280241; ENSG00000150672 [Q15700-4]
ENST00000376104; ENSP00000365272; ENSG00000150672 [Q15700-2]
ENST00000398309; ENSP00000381355; ENSG00000150672 [Q15700-1]
ENST00000418306; ENSP00000402275; ENSG00000150672 [Q15700-3]
ENST00000426717; ENSP00000393049; ENSG00000150672 [Q15700-5]
GeneIDi1740
KEGGihsa:1740
UCSCiuc001pai.3 human [Q15700-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDLG2_HUMAN
AccessioniPrimary (citable) accession number: Q15700
Secondary accession number(s): B7WNY8
, F8W9V6, Q59G57, Q5H9Q4, Q68CQ8, Q6ZTA8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: May 23, 2018
This is version 183 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health