Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q15700

- DLG2_HUMAN

UniProt

Q15700 - DLG2_HUMAN

Protein

Disks large homolog 2

Gene

DLG2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 148 (01 Oct 2014)
      Sequence version 3 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses By similarity.By similarity

    GO - Molecular functioni

    1. guanylate kinase activity Source: ProtInc
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. negative regulation of phosphatase activity Source: UniProtKB
    2. nucleotide phosphorylation Source: GOC
    3. sensory perception of pain Source: Ensembl
    4. synaptic transmission Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disks large homolog 2
    Alternative name(s):
    Channel-associated protein of synapse-110
    Short name:
    Chapsyn-110
    Postsynaptic density protein PSD-93
    Gene namesi
    Name:DLG2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:2901. DLG2.

    Subcellular locationi

    Membrane By similarity; Lipid-anchor By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse By similarity
    Note: Concentrated in soma and postsynaptic density of a subset of neurons.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. juxtaparanode region of axon Source: Ensembl
    3. plasma membrane Source: ProtInc
    4. postsynaptic density Source: UniProtKB-SubCell
    5. postsynaptic membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164741388.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 870870Disks large homolog 2PRO_0000094553Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi5 – 51S-palmitoyl cysteineBy similarity
    Lipidationi7 – 71S-palmitoyl cysteineBy similarity
    Modified residuei28 – 281PhosphoserineBy similarity
    Modified residuei58 – 581PhosphotyrosineBy similarity
    Modified residuei65 – 651PhosphoserineBy similarity
    Modified residuei414 – 4141PhosphoserineBy similarity
    Modified residuei505 – 5051PhosphotyrosineBy similarity
    Modified residuei750 – 7501PhosphotyrosineBy similarity
    Modified residuei755 – 7551PhosphotyrosineBy similarity

    Post-translational modificationi

    Palmitoylation of isoform 1 is not required for targeting to postsynaptic density.By similarity

    Keywords - PTMi

    Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    MaxQBiQ15700.
    PaxDbiQ15700.
    PRIDEiQ15700.

    PTM databases

    PhosphoSiteiQ15700.

    Expressioni

    Gene expression databases

    ArrayExpressiQ15700.
    BgeeiQ15700.
    CleanExiHS_DLG2.
    GenevestigatoriQ15700.

    Organism-specific databases

    HPAiHPA021307.

    Interactioni

    Subunit structurei

    Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain By similarity. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains. Interacts with KCNJ4 By similarity, Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG. Interacts with KCNJ4 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Kcnj2P355616EBI-663057,EBI-703793From a different organism.

    Protein-protein interaction databases

    BioGridi108084. 24 interactions.
    IntActiQ15700. 8 interactions.
    MINTiMINT-470785.
    STRINGi9606.ENSP00000365272.

    Structurei

    Secondary structure

    1
    870
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi190 – 1978
    Beta strandi202 – 2098
    Beta strandi222 – 2276
    Helixi232 – 2365
    Beta strandi244 – 2485
    Helixi258 – 2669
    Beta strandi270 – 28112
    Beta strandi420 – 4256
    Beta strandi432 – 4398
    Beta strandi444 – 4496
    Helixi454 – 4585
    Beta strandi465 – 4706
    Helixi480 – 48910
    Beta strandi492 – 5009
    Helixi502 – 5109

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2BYGX-ray1.85A190-283[»]
    2HE2X-ray1.50A/B418-513[»]
    ProteinModelPortaliQ15700.
    SMRiQ15700. Positions 93-283, 389-870.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ15700.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini98 – 18487PDZ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini193 – 27987PDZ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini421 – 50181PDZ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini536 – 60671SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini680 – 855176Guanylate kinase-likePROSITE-ProRule annotationAdd
    BLAST

    Domaini

    An N-terminally truncated L27 domain is predicted in isoform 2 at positions 1 through 27.

    Sequence similaritiesi

    Belongs to the MAGUK family.Curated
    Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
    Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiCOG0194.
    HOGENOMiHOG000232102.
    HOVERGENiHBG107814.
    KOiK12075.
    OMAiDIFFINI.
    OrthoDBiEOG79GT6P.
    PhylomeDBiQ15700.
    TreeFamiTF323171.

    Family and domain databases

    Gene3Di2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProiIPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view]
    PANTHERiPTHR23119. PTHR23119. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 1 hit.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view]
    PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTiSM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q15700-1) [UniParc]FASTAAdd to Basket

    Also known as: PSD93-alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFFACYCALR TNVKKYRYQD EDAPHDHSLP RLTHEVRGPE LVHVSEKNLS    50
    QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT 100
    LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI 150
    LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP 200
    KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN 250
    YSLEEVTHEE AVAILKNTSE VVYLKVGKPT TIYMTDPYGP PDITHSYSPP 300
    MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVDDDY TRPPEPVYST 350
    VNKLCDKPAS PRHYSPVECD KSFLLSAPYS HYHLGLLPDS EMTSHSQHST 400
    ATRQPSMTLQ RAVSLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL 450
    AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY 500
    QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS 550
    KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVMLEGDS EEMGVIPSKR 600
    RVERKERARL KTVKFNAKPG VIDSKGSFND KRKKSFIFSR KFPFYKNKEQ 650
    SEQETSDPER GQEDLILSYE PVTRQEINYT RPVIILGPMK DRINDDLISE 700
    FPDKFGSCVP HTTRPKRDYE VDGRDYHFVI SREQMEKDIQ EHKFIEAGQY 750
    NDNLYGTSVQ SVRFVAERGK HCILDVSGNA IKRLQVAQLY PIAIFIKPRS 800
    LEPLMEMNKR LTEEQAKKTY DRAIKLEQEF GEYFTAIVQG DTLEDIYNQC 850
    KLVIEEQSGP FIWIPSKEKL 870
    Length:870
    Mass (Da):97,552
    Last modified:November 25, 2008 - v3
    Checksum:iBC51554590060E48
    GO
    Isoform 2 (identifier: Q15700-2) [UniParc]FASTAAdd to Basket

    Also known as: PSD93-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-14: MFFACYCALRTNVK → MGIFKSSLFQ...PAWMPVHHCT

    Show »
    Length:975
    Mass (Da):109,371
    Checksum:iB4677B45F351C12D
    GO
    Isoform 3 (identifier: Q15700-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: Missing.
         52-86: IENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPY → MQRPSVSRAENYQLLWDTIASLKQCEQAMQHAFIP
         341-392: Missing.
         627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

    Show »
    Length:749
    Mass (Da):83,405
    Checksum:i6E4FC590B5EE8BED
    GO
    Isoform 4 (identifier: Q15700-4) [UniParc]FASTAAdd to Basket

    Also known as: PSD93-delta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

    Show »
    Length:909
    Mass (Da):100,981
    Checksum:i2A857BA09A6587E0
    GO
    Isoform 5 (identifier: Q15700-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-518: Missing.
         627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

    Note: No experimental confirmation available.Curated

    Show »
    Length:334
    Mass (Da):38,404
    Checksum:iDED1A839B4181509
    GO

    Sequence cautioni

    The sequence BAD92489.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti177 – 1771V → A in AAB04949. (PubMed:8755482)Curated
    Sequence conflicti278 – 2781K → N in AAB04949. (PubMed:8755482)Curated
    Sequence conflicti704 – 7041K → E in CAI45970. (PubMed:17974005)Curated
    Sequence conflicti803 – 8031P → S in AAB04949. (PubMed:8755482)Curated
    Sequence conflicti861 – 8611F → L in CAH18680. (PubMed:17974005)Curated
    Isoform 5 (identifier: Q15700-5)
    Sequence conflicti116 – 1161D → E in CAI45970. (PubMed:17974005)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 518518Missing in isoform 5. 1 PublicationVSP_045634Add
    BLAST
    Alternative sequencei1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA VRSAPTLIRDAHCACGWQRN CQGLGYSSQTMPSSGPGGPA SNRTGGSSFNRTLWDSVRKS PHKTSTKGKGTCGEHCTCPH GWFSPAQ in isoform 4. CuratedVSP_015511Add
    BLAST
    Alternative sequencei1 – 5151Missing in isoform 3. 1 PublicationVSP_015512Add
    BLAST
    Alternative sequencei1 – 1414MFFAC…RTNVK → MGIFKSSLFQALLDIQEFYE VTLLNSQKSCEQKIEEANQV LQKWEKTSLLAPCHDRLQKS SELTDCSGSKENASCIEQNK ENQSFENETDETTTQNQGRC PAQNCSVEAPAWMPVHHCT in isoform 2. 1 PublicationVSP_015513Add
    BLAST
    Alternative sequencei52 – 8635IENVH…DTIPY → MQRPSVSRAENYQLLWDTIA SLKQCEQAMQHAFIP in isoform 3. 1 PublicationVSP_015514Add
    BLAST
    Alternative sequencei341 – 39252Missing in isoform 3. 1 PublicationVSP_015515Add
    BLAST
    Alternative sequencei627 – 65933SFNDK…TSDPE → DIPGLGDDGYGTKTL in isoform 3 and isoform 5. 2 PublicationsVSP_015516Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U32376 mRNA. Translation: AAB04949.1.
    AK126776 mRNA. Translation: BAC86685.1.
    CR749820 mRNA. Translation: CAH18680.1.
    CR933674 mRNA. Translation: CAI45970.1.
    AC023118 Genomic DNA. No translation available.
    AP000639 Genomic DNA. No translation available.
    AP000642 Genomic DNA. No translation available.
    AP000773 Genomic DNA. No translation available.
    AP000852 Genomic DNA. No translation available.
    AP000857 Genomic DNA. No translation available.
    AP001791 Genomic DNA. No translation available.
    AP001825 Genomic DNA. No translation available.
    AP001984 Genomic DNA. No translation available.
    AP002370 Genomic DNA. No translation available.
    AP002751 Genomic DNA. No translation available.
    AP002797 Genomic DNA. No translation available.
    AP002803 Genomic DNA. No translation available.
    AP002878 Genomic DNA. No translation available.
    AP003026 Genomic DNA. No translation available.
    AP003035 Genomic DNA. No translation available.
    AP003093 Genomic DNA. No translation available.
    AP003095 Genomic DNA. No translation available.
    AP003305 Genomic DNA. No translation available.
    AB209252 mRNA. Translation: BAD92489.1. Different initiation.
    CCDSiCCDS41696.1. [Q15700-1]
    CCDS44690.1. [Q15700-2]
    CCDS44691.1. [Q15700-3]
    CCDS44692.1. [Q15700-5]
    CCDS55782.1. [Q15700-4]
    PIRiG01974.
    S60315.
    RefSeqiNP_001136171.1. NM_001142699.1. [Q15700-2]
    NP_001136172.1. NM_001142700.1. [Q15700-3]
    NP_001136174.1. NM_001142702.1. [Q15700-5]
    NP_001193698.1. NM_001206769.1. [Q15700-4]
    NP_001355.2. NM_001364.3. [Q15700-1]
    UniGeneiHs.367656.

    Genome annotation databases

    EnsembliENST00000280241; ENSP00000280241; ENSG00000150672. [Q15700-4]
    ENST00000376104; ENSP00000365272; ENSG00000150672. [Q15700-2]
    ENST00000398309; ENSP00000381355; ENSG00000150672. [Q15700-1]
    ENST00000418306; ENSP00000402275; ENSG00000150672. [Q15700-3]
    ENST00000426717; ENSP00000393049; ENSG00000150672. [Q15700-5]
    GeneIDi1740.
    KEGGihsa:1740.
    UCSCiuc001pai.2. human. [Q15700-3]
    uc001paj.2. human. [Q15700-1]
    uc001pak.2. human. [Q15700-2]
    uc010rsw.1. human.
    uc021qof.1. human. [Q15700-4]

    Polymorphism databases

    DMDMi215274165.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U32376 mRNA. Translation: AAB04949.1 .
    AK126776 mRNA. Translation: BAC86685.1 .
    CR749820 mRNA. Translation: CAH18680.1 .
    CR933674 mRNA. Translation: CAI45970.1 .
    AC023118 Genomic DNA. No translation available.
    AP000639 Genomic DNA. No translation available.
    AP000642 Genomic DNA. No translation available.
    AP000773 Genomic DNA. No translation available.
    AP000852 Genomic DNA. No translation available.
    AP000857 Genomic DNA. No translation available.
    AP001791 Genomic DNA. No translation available.
    AP001825 Genomic DNA. No translation available.
    AP001984 Genomic DNA. No translation available.
    AP002370 Genomic DNA. No translation available.
    AP002751 Genomic DNA. No translation available.
    AP002797 Genomic DNA. No translation available.
    AP002803 Genomic DNA. No translation available.
    AP002878 Genomic DNA. No translation available.
    AP003026 Genomic DNA. No translation available.
    AP003035 Genomic DNA. No translation available.
    AP003093 Genomic DNA. No translation available.
    AP003095 Genomic DNA. No translation available.
    AP003305 Genomic DNA. No translation available.
    AB209252 mRNA. Translation: BAD92489.1 . Different initiation.
    CCDSi CCDS41696.1. [Q15700-1 ]
    CCDS44690.1. [Q15700-2 ]
    CCDS44691.1. [Q15700-3 ]
    CCDS44692.1. [Q15700-5 ]
    CCDS55782.1. [Q15700-4 ]
    PIRi G01974.
    S60315.
    RefSeqi NP_001136171.1. NM_001142699.1. [Q15700-2 ]
    NP_001136172.1. NM_001142700.1. [Q15700-3 ]
    NP_001136174.1. NM_001142702.1. [Q15700-5 ]
    NP_001193698.1. NM_001206769.1. [Q15700-4 ]
    NP_001355.2. NM_001364.3. [Q15700-1 ]
    UniGenei Hs.367656.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2BYG X-ray 1.85 A 190-283 [» ]
    2HE2 X-ray 1.50 A/B 418-513 [» ]
    ProteinModelPortali Q15700.
    SMRi Q15700. Positions 93-283, 389-870.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108084. 24 interactions.
    IntActi Q15700. 8 interactions.
    MINTi MINT-470785.
    STRINGi 9606.ENSP00000365272.

    PTM databases

    PhosphoSitei Q15700.

    Polymorphism databases

    DMDMi 215274165.

    Proteomic databases

    MaxQBi Q15700.
    PaxDbi Q15700.
    PRIDEi Q15700.

    Protocols and materials databases

    DNASUi 1740.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000280241 ; ENSP00000280241 ; ENSG00000150672 . [Q15700-4 ]
    ENST00000376104 ; ENSP00000365272 ; ENSG00000150672 . [Q15700-2 ]
    ENST00000398309 ; ENSP00000381355 ; ENSG00000150672 . [Q15700-1 ]
    ENST00000418306 ; ENSP00000402275 ; ENSG00000150672 . [Q15700-3 ]
    ENST00000426717 ; ENSP00000393049 ; ENSG00000150672 . [Q15700-5 ]
    GeneIDi 1740.
    KEGGi hsa:1740.
    UCSCi uc001pai.2. human. [Q15700-3 ]
    uc001paj.2. human. [Q15700-1 ]
    uc001pak.2. human. [Q15700-2 ]
    uc010rsw.1. human.
    uc021qof.1. human. [Q15700-4 ]

    Organism-specific databases

    CTDi 1740.
    GeneCardsi GC11M083166.
    HGNCi HGNC:2901. DLG2.
    HPAi HPA021307.
    MIMi 603583. gene.
    neXtProti NX_Q15700.
    PharmGKBi PA164741388.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0194.
    HOGENOMi HOG000232102.
    HOVERGENi HBG107814.
    KOi K12075.
    OMAi DIFFINI.
    OrthoDBi EOG79GT6P.
    PhylomeDBi Q15700.
    TreeFami TF323171.

    Miscellaneous databases

    EvolutionaryTracei Q15700.
    GeneWikii DLG2.
    GenomeRNAii 1740.
    NextBioi 7057.
    PROi Q15700.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q15700.
    Bgeei Q15700.
    CleanExi HS_DLG2.
    Genevestigatori Q15700.

    Family and domain databases

    Gene3Di 2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProi IPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view ]
    PANTHERi PTHR23119. PTHR23119. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 1 hit.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTi SM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins."
      Kim E., Cho K.-O., Rothschild A., Sheng M.
      Neuron 17:103-113(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Cerebellum.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
      Tissue: Retina.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-542 (ISOFORM 1).
      Tissue: Brain.
    6. "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
      Leyland M.L., Dart C.
      J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH KCNJ2.
    7. "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses."
      Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E.
      Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LRFN1; LRFN2 AND LRFN4.
    8. "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis."
      Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E.
      J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FRMPD4.
    9. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
      Voss M., Lettau M., Janssen O.
      BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FASLG.
    10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions."
      Elkins J.M., Papagrigoriou E., Berridge G., Yang X., Phillips C., Gileadi C., Savitsky P., Doyle D.A.
      Protein Sci. 16:683-694(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 190-283, X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 418-513.

    Entry informationi

    Entry nameiDLG2_HUMAN
    AccessioniPrimary (citable) accession number: Q15700
    Secondary accession number(s): B7WNY8
    , F8W9V6, Q59G57, Q5H9Q4, Q68CQ8, Q6ZTA8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 148 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3