Q15700 (DLG2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large homolog 2 Alternative name(s): Channel-associated protein of synapse-110 Short name=Chapsyn-110 Postsynaptic density protein PSD-93 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 870 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses By similarity. |
| Subunit structure | Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain By similarity. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains. Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG. Ref.6 Ref.7 Ref.8 Ref.9 |
| Subcellular location | Membrane; Lipid-anchor By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Cell junction › synapse By similarity. Note: Concentrated in soma and postsynaptic density of a subset of neurons By similarity. |
| Domain | An N-terminally truncated L27 domain is predicted in isoform 2 at positions 1 through 27. |
| Post-translational modification | Palmitoylation of isoform 1 is not required for targeting to postsynaptic density By similarity. |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
| Sequence caution | The sequence BAD92489.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Kcnj2 | P35561 | 6 | EBI-663057,EBI-703793 | From a different organism. |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15700-1) Also known as: PSD93-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15700-2) Also known as: PSD93-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-14: MFFACYCALRTNVK → MGIFKSSLFQ...PAWMPVHHCT | ||||||
| Isoform 3 (identifier: Q15700-3) The sequence of this isoform differs from the canonical sequence as follows: 1-51: Missing. 52-86: IENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPY → MQRPSVSRAENYQLLWDTIASLKQCEQAMQHAFIP 341-392: Missing. 627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL | ||||||
| Isoform 4 (identifier: Q15700-4) Also known as: PSD93-delta; The sequence of this isoform differs from the canonical sequence as follows: 1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ | ||||||
| Isoform 5 (identifier: Q15700-5) The sequence of this isoform differs from the canonical sequence as follows: 1-518: Missing. 627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 870 | 870 | Disks large homolog 2 | PRO_0000094553 | |||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| Domain | 98 – 184 | 87 | PDZ 1 | ||||||||||||||||||||||||||||||||||||
| Domain | 193 – 279 | 87 | PDZ 2 | ||||||||||||||||||||||||||||||||||||
| Domain | 421 – 501 | 81 | PDZ 3 | ||||||||||||||||||||||||||||||||||||
| Domain | 536 – 606 | 71 | SH3 | ||||||||||||||||||||||||||||||||||||
| Domain | 680 – 855 | 176 | Guanylate kinase-like | ||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 28 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 58 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 62 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 175 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 340 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 348 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 365 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 406 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 414 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 500 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 505 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 750 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 755 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||
| Lipidation | 5 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||||||||||||||||||
| Lipidation | 7 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 518 | 518 | Missing in isoform 5. | VSP_045634 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 68 | 68 | MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA VRSAPTLIRDAHCACGWQRN CQGLGYSSQTMPSSGPGGPA SNRTGGSSFNRTLWDSVRKS PHKTSTKGKGTCGEHCTCPH GWFSPAQ in isoform 4. | VSP_015511 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 51 | 51 | Missing in isoform 3. | VSP_015512 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | MFFAC…RTNVK → MGIFKSSLFQALLDIQEFYE VTLLNSQKSCEQKIEEANQV LQKWEKTSLLAPCHDRLQKS SELTDCSGSKENASCIEQNK ENQSFENETDETTTQNQGRC PAQNCSVEAPAWMPVHHCT in isoform 2. | VSP_015513 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 52 – 86 | 35 | IENVH…DTIPY → MQRPSVSRAENYQLLWDTIA SLKQCEQAMQHAFIP in isoform 3. | VSP_015514 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 341 – 392 | 52 | Missing in isoform 3. | VSP_015515 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 627 – 659 | 33 | SFNDK…TSDPE → DIPGLGDDGYGTKTL in isoform 3 and isoform 5. | VSP_015516 | |||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 177 | 1 | V → A in AAB04949. Ref.1 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 278 | 1 | K → N in AAB04949. Ref.1 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 704 | 1 | K → E in CAI45970. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 803 | 1 | P → S in AAB04949. Ref.1 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 861 | 1 | F → L in CAH18680. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Isoform 5: | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | D → E in CAI45970. Ref.3 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 190 – 197 | 8 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 202 – 209 | 8 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 222 – 227 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 232 – 236 | 5 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 244 – 248 | 5 | |||||||||||||||||||||||||||||||||||||
| Helix | 258 – 266 | 9 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 270 – 281 | 12 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 420 – 425 | 6 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 432 – 439 | 8 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 444 – 449 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 454 – 458 | 5 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 465 – 470 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 480 – 489 | 10 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 500 | 9 | |||||||||||||||||||||||||||||||||||||
| Helix | 502 – 510 | 9 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins." Kim E., Cho K.-O., Rothschild A., Sheng M. Neuron 17:103-113(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Cerebellum. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5). Tissue: Retina. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-542 (ISOFORM 1). Tissue: Brain. |
| [6] | "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1." Leyland M.L., Dart C. J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH KCNJ2. |
| [7] | "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses." Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E. Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LRFN1; LRFN2 AND LRFN4. |
| [8] | "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis." Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E. J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FRMPD4. |
| [9] | "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening." Voss M., Lettau M., Janssen O. BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FASLG. |
| [10] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions." Elkins J.M., Papagrigoriou E., Berridge G., Yang X., Phillips C., Gileadi C., Savitsky P., Doyle D.A. Protein Sci. 16:683-694(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 190-283, X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 418-513. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U32376 mRNA. Translation: AAB04949.1. AK126776 mRNA. Translation: BAC86685.1. CR749820 mRNA. Translation: CAH18680.1. CR933674 mRNA. Translation: CAI45970.1. AC023118 Genomic DNA. No translation available. AP000639 Genomic DNA. No translation available. AP000642 Genomic DNA. No translation available. AP000773 Genomic DNA. No translation available. AP000852 Genomic DNA. No translation available. AP000857 Genomic DNA. No translation available. AP001791 Genomic DNA. No translation available. AP001825 Genomic DNA. No translation available. AP001984 Genomic DNA. No translation available. AP002370 Genomic DNA. No translation available. AP002751 Genomic DNA. No translation available. AP002797 Genomic DNA. No translation available. AP002803 Genomic DNA. No translation available. AP002878 Genomic DNA. No translation available. AP003026 Genomic DNA. No translation available. AP003035 Genomic DNA. No translation available. AP003093 Genomic DNA. No translation available. AP003095 Genomic DNA. No translation available. AP003305 Genomic DNA. No translation available. AB209252 mRNA. Translation: BAD92489.1. Different initiation. | ||||||||||||||||||
| IPI | IPI00444727. IPI00444938. IPI00646771. IPI00647950. IPI00973875. | ||||||||||||||||||
| PIR | G01974. S60315. | ||||||||||||||||||
| RefSeq | NP_001136171.1. NM_001142699.1. NP_001136172.1. NM_001142700.1. NP_001136174.1. NM_001142702.1. NP_001193698.1. NM_001206769.1. NP_001355.2. NM_001364.3. | ||||||||||||||||||
| UniGene | Hs.367656. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q15700. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q15700. 8 interactions. | ||||||||||||||||||
| MINT | MINT-470785. | ||||||||||||||||||
| STRING | 9606.ENSP00000365272. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q15700. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 215274165. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q15700. | ||||||||||||||||||
| PRIDE | Q15700. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 1740. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000280241; ENSP00000280241; ENSG00000150672. ENST00000376104; ENSP00000365272; ENSG00000150672. ENST00000376106; ENSP00000365274; ENSG00000150672. ENST00000398309; ENSP00000381355; ENSG00000150672. ENST00000418306; ENSP00000402275; ENSG00000150672. ENST00000426717; ENSP00000393049; ENSG00000150672. ENST00000543673; ENSP00000441994; ENSG00000150672. | ||||||||||||||||||
| GeneID | 1740. | ||||||||||||||||||
| KEGG | hsa:1740. | ||||||||||||||||||
| UCSC | uc001pai.2. human. uc001paj.2. human. uc001pak.2. human. uc021qof.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 1740. | ||||||||||||||||||
| GeneCards | GC11M083166. | ||||||||||||||||||
| HGNC | HGNC:2901. DLG2. | ||||||||||||||||||
| HPA | HPA021307. | ||||||||||||||||||
| MIM | 603583. gene. | ||||||||||||||||||
| neXtProt | NX_Q15700. | ||||||||||||||||||
| PharmGKB | PA164741388. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0194. | ||||||||||||||||||
| HOGENOM | HOG000232102. | ||||||||||||||||||
| HOVERGEN | HBG107814. | ||||||||||||||||||
| KO | K12075. | ||||||||||||||||||
| OrthoDB | EOG447FSN. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q15700. | ||||||||||||||||||
| Bgee | Q15700. | ||||||||||||||||||
| CleanEx | HS_DLG2. | ||||||||||||||||||
| Genevestigator | Q15700. | ||||||||||||||||||
| GermOnline | ENSG00000150672. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR016313. M-assoc_guanylate_kinase. IPR019590. MAGUK_PEST_N. IPR001478. PDZ. IPR019583. PDZ_assoc. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF10608. MAGUK_N_PEST. 1 hit. PF00595. PDZ. 3 hits. PF10600. PDZ_assoc. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF001741. MAGUK_DLGH. 1 hit. | ||||||||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50156. PDZ. 3 hits. SSF50044. SH3. 1 hit. | ||||||||||||||||||
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q15700. | ||||||||||||||||||
| GenomeRNAi | 1740. | ||||||||||||||||||
| NextBio | 7057. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | DLG2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15700 Secondary accession number(s): B7WNY8 Q6ZTA8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
