Q15646 (OASL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 59 kDa 2'-5'-oligoadenylate synthase-like protein Alternative name(s): Thyroid receptor-interacting protein 14 Short name=TR-interacting protein 14 Short name=TRIP-14 p59 OASL Short name=p59OASL | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 514 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Does not have 2'-5'-OAS activity, but binds double-stranded RNA and DNA. |
| Subunit structure | Specifically interacts with the ligand binding domain of the thyroid receptor (TR). TRIP14 does not require the presence of thyroid hormone for its interaction. Binds MBD1. Ref.6 |
| Tissue specificity | Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis. |
| Induction | By interferons. |
| Sequence similarities | Belongs to the 2-5A synthase family. Contains 2 ubiquitin-like domains. |
| Caution | This may not be the true ortholog of mouse OASL. |
| Sequence caution | The sequence AAC41733.1 differs from that shown. Reason: Frameshift at position 386. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Ligand | RNA-binding |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | interferon-gamma-mediated signaling pathway Traceable author statement. Source: Reactome type I interferon-mediated signaling pathwayTraceable author statement. Source: Reactome |
| Cellular component | cytosol Traceable author statement. Source: Reactome nucleolusTraceable author statement Ref.2. Source: UniProtKB |
| Molecular function | ATP binding Inferred from electronic annotation. Source: InterPro DNA bindingTraceable author statement Ref.2. Source: UniProtKB double-stranded RNA bindingTraceable author statement Ref.2. Source: UniProtKB thyroid hormone receptor bindingTraceable author statement Ref.5. Source: UniProtKB transferase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform p56 (identifier: Q15646-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform p30 (identifier: Q15646-2) The sequence of this isoform differs from the canonical sequence as follows: 220-255: YVKARSPRANLPPLYALELLTIYAWEMGTEEDENFM → AHHPGSGRPHPQRGRRVQMGHRCSEGLPVPETGLLL 256-514: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 514 | 514 | 59 kDa 2'-5'-oligoadenylate synthase-like protein | PRO_0000160266 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 354 – 433 | 80 | Ubiquitin-like 1 | |||||||||||||||||||||
| Domain | 434 – 509 | 76 | Ubiquitin-like 2 | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 220 – 255 | 36 | YVKAR…DENFM → AHHPGSGRPHPQRGRRVQMG HRCSEGLPVPETGLLL in isoform p30. | VSP_003743 | ||||||||||||||||||||
| Alternative sequence | 256 – 514 | 259 | Missing in isoform p30. | VSP_003744 | ||||||||||||||||||||
| Natural variant | 341 | 1 | N → I. Corresponds to variant rs35249920 [ dbSNP | Ensembl ]. | VAR_053544 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Sequence conflict | 26 – 38 | 13 | HREWK…LDAVR → TGVEGRGARRCA Ref.2 | |||||||||||||||||||||
| Sequence conflict | 89 | 1 | S → T in AAD28542. Ref.2 | |||||||||||||||||||||
| Sequence conflict | 95 – 113 | 19 | QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28541. Ref.2 | |||||||||||||||||||||
| Sequence conflict | 95 – 113 | 19 | QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28542. Ref.2 | |||||||||||||||||||||
| Sequence conflict | 223 | 1 | A → S in AAD28541. Ref.2 | |||||||||||||||||||||
| Sequence conflict | 317 | 1 | Y → I in AAD28541. Ref.2 | |||||||||||||||||||||
| Sequence conflict | 321 | 1 | I → T in AAD28541. Ref.2 | |||||||||||||||||||||
| Sequence conflict | 324 | 1 | Q → L in AAD28541. Ref.2 | |||||||||||||||||||||
| Sequence conflict | 341 – 342 | 2 | NP → KG in AAC41733. Ref.5 | |||||||||||||||||||||
| Sequence conflict | 445 | 1 | S → T in AAD28541. Ref.2 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 432 – 440 | 9 | ||||||||||||||||||||||
| Turn | 441 – 443 | 3 | ||||||||||||||||||||||
| Beta strand | 444 – 450 | 7 | ||||||||||||||||||||||
| Beta strand | 452 – 455 | 4 | ||||||||||||||||||||||
| Helix | 456 – 466 | 11 | ||||||||||||||||||||||
| Turn | 471 – 473 | 3 | ||||||||||||||||||||||
| Beta strand | 474 – 478 | 5 | ||||||||||||||||||||||
| Beta strand | 485 – 488 | 4 | ||||||||||||||||||||||
| Helix | 489 – 492 | 4 | ||||||||||||||||||||||
| Beta strand | 498 – 504 | 7 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "p59OASL, a 2'-5' oligoadenylate synthetase like protein: a novel human gene related to the 2'-5' oligoadenylate synthetase family." Hartmann R., Olsen H.S., Widder S., Joergensen R., Justesen J. Nucleic Acids Res. 26:4121-4127(1998) [PubMed: 9722630] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P56). |
| [2] | "Molecular cloning and characterization of two related and interferon-induced 56-kDa and 30-kDa proteins highly similar to 2'-5' oligoadenylate synthetase." Rebouillat D., Marie I., Hovanessian A.G. Eur. J. Biochem. 257:319-330(1998) [PubMed: 9826176] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS P56 AND P30). Tissue: Monocyte. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P56). Tissue: Brain. |
| [5] | "Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor." Lee J.W., Choi H.-S., Gyuris J., Brent R., Moore D.D. Mol. Endocrinol. 9:243-254(1995) [PubMed: 7776974] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 260-416 (ISOFORM P56). |
| [6] | "Interaction between the 2'-5' oligoadenylate synthetase-like protein p59 OASL and the transcriptional repressor methyl CpG-binding protein 1." Andersen J.B., Strandbygaard D.J., Hartmann R., Justesen J. Eur. J. Biochem. 271:628-636(2004) [PubMed: 14728690] [Abstract] Cited for: INTERACTION WITH MBD1. Tissue: Leukocyte. |
| [7] | "Solution structure of C-terminal ubiquitin-like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 OASL)." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 432-507. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ225089 mRNA. Translation: CAA12396.1. AF063611 mRNA. Translation: AAD28541.1. AF063612 mRNA. Translation: AAD28542.1. AC079602 Genomic DNA. No translation available. Z93097 Genomic DNA. No translation available. BC117408 mRNA. Translation: AAI17409.1. BC117410 mRNA. Translation: AAI17411.1. L40387 Genomic DNA. Translation: AAC41733.1. Frameshift. | ||||||||||||
| IPI | IPI00018810. IPI00218116. | ||||||||||||
| RefSeq | NP_003724.1. NM_003733.2. NP_937856.1. NM_198213.1. | ||||||||||||
| UniGene | Hs.118633. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q15646. | ||||||||||||
| SMR | Q15646. Positions 5-350, 353-514. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q15646. 1 interaction. | ||||||||||||
| STRING | Q15646. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q15646. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 6226835. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q15646. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000257570; ENSP00000257570; ENSG00000135114. | ||||||||||||
| GeneID | 8638. | ||||||||||||
| KEGG | hsa:8638. | ||||||||||||
| UCSC | uc001tzj.1. human. uc001tzk.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 8638. | ||||||||||||
| GeneCards | GC12M121459. | ||||||||||||
| H-InvDB | HIX0201831. | ||||||||||||
| HGNC | HGNC:8090. OASL. | ||||||||||||
| HPA | HPA001474. | ||||||||||||
| MIM | 603281. gene. | ||||||||||||
| neXtProt | NX_Q15646. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG15143. | ||||||||||||
| GeneTree | ENSGT00510000046406. | ||||||||||||
| HOGENOM | HBG505403. | ||||||||||||
| HOVERGEN | HBG000994. | ||||||||||||
| InParanoid | Q15646. | ||||||||||||
| OMA | IQVFVKN. | ||||||||||||
| OrthoDB | EOG4M0F1G. | ||||||||||||
| PhylomeDB | Q15646. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q15646. | ||||||||||||
| Bgee | Q15646. | ||||||||||||
| CleanEx | HS_OASL. | ||||||||||||
| Genevestigator | Q15646. | ||||||||||||
| GermOnline | ENSG00000135114. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR006117. 2-5-oligoadenylate_synth_CS. IPR006116. 2-5-oligoadenylate_synth_N. IPR018952. 2-5-oligoAdlate_synth_1_dom2/C. IPR000626. Ubiquitin. IPR019955. Ubiquitin_supergroup. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.10.1410.20. 2-5-oligoAdlate_synth_1_dom2/C. 1 hit. | ||||||||||||
| KO | K14608. | ||||||||||||
| Pfam | PF10421. OAS1_C. 1 hit. PF00240. ubiquitin. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00213. UBQ. 2 hits. [Graphical view] | ||||||||||||
| PROSITE | PS00832. 25A_SYNTH_1. 1 hit. PS00833. 25A_SYNTH_2. 1 hit. PS50152. 25A_SYNTH_3. 1 hit. PS50053. UBIQUITIN_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 32383. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | OASL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15646 Secondary accession number(s): O75686 Q9Y6K7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with