Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

2'-5'-oligoadenylate synthase-like protein

Gene

OASL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. Displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.3 Publications

GO - Molecular functioni

  • ATP binding Source: InterPro
  • DNA binding Source: UniProtKB
  • double-stranded RNA binding Source: UniProtKB
  • poly(A) RNA binding Source: UniProtKB
  • thyroid hormone receptor binding Source: UniProtKB
  • transferase activity Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Antiviral defense, Immunity, Innate immunity

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000135114-MONOMER.
ZFISH:ENSG00000157873-MONOMER.
ReactomeiR-HSA-877300. Interferon gamma signaling.
R-HSA-909733. Interferon alpha/beta signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
2'-5'-oligoadenylate synthase-like protein
Alternative name(s):
2'-5'-OAS-related protein
Short name:
2'-5'-OAS-RP
59 kDa 2'-5'-oligoadenylate synthase-like protein
Thyroid receptor-interacting protein 14
Short name:
TR-interacting protein 14
Short name:
TRIP-14
p59 OASL
Short name:
p59OASL
Gene namesi
Name:OASL
Synonyms:TRIP14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:8090. OASL.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • membrane Source: UniProtKB
  • nucleolus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8638.
OpenTargetsiENSG00000135114.
PharmGKBiPA31879.

Polymorphism and mutation databases

BioMutaiOASL.
DMDMi6226835.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001602662 – 5142'-5'-oligoadenylate synthase-like proteinAdd BLAST513

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ15646.
PaxDbiQ15646.
PeptideAtlasiQ15646.
PRIDEiQ15646.

PTM databases

iPTMnetiQ15646.
PhosphoSitePlusiQ15646.

Expressioni

Tissue specificityi

Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.

Inductioni

By type I interferon (IFN) and viruses.2 Publications

Gene expression databases

BgeeiENSG00000135114.
CleanExiHS_OASL.
ExpressionAtlasiQ15646. baseline and differential.
GenevisibleiQ15646. HS.

Organism-specific databases

HPAiHPA001474.

Interactioni

Subunit structurei

Specifically interacts with the ligand binding domain of the thyroid receptor (TR). TRIP14 does not require the presence of thyroid hormone for its interaction. Binds MBD1.1 Publication

GO - Molecular functioni

  • thyroid hormone receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi114191. 9 interactors.
IntActiQ15646. 8 interactors.
MINTiMINT-4993190.
STRINGi9606.ENSP00000257570.

Structurei

Secondary structure

1514
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi7 – 9Combined sources3
Helixi12 – 14Combined sources3
Helixi15 – 22Combined sources8
Helixi27 – 46Combined sources20
Beta strandi61 – 67Combined sources7
Helixi68 – 72Combined sources5
Beta strandi81 – 88Combined sources8
Helixi94 – 112Combined sources19
Helixi116 – 119Combined sources4
Turni120 – 122Combined sources3
Beta strandi124 – 129Combined sources6
Beta strandi131 – 133Combined sources3
Beta strandi135 – 141Combined sources7
Turni143 – 145Combined sources3
Beta strandi148 – 156Combined sources9
Helixi171 – 180Combined sources10
Helixi189 – 191Combined sources3
Helixi192 – 200Combined sources9
Helixi204 – 220Combined sources17
Helixi222 – 224Combined sources3
Helixi233 – 248Combined sources16
Helixi256 – 268Combined sources13
Helixi269 – 272Combined sources4
Helixi286 – 296Combined sources11
Beta strandi298 – 300Combined sources3
Beta strandi302 – 304Combined sources3
Turni313 – 316Combined sources4
Helixi319 – 329Combined sources11
Helixi333 – 335Combined sources3
Beta strandi434 – 440Combined sources7
Turni441 – 443Combined sources3
Beta strandi444 – 450Combined sources7
Beta strandi452 – 455Combined sources4
Helixi456 – 466Combined sources11
Turni471 – 473Combined sources3
Beta strandi474 – 478Combined sources5
Beta strandi485 – 488Combined sources4
Helixi489 – 492Combined sources4
Beta strandi498 – 504Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WH3NMR-A434-507[»]
4XQ7X-ray1.60A1-350[»]
ProteinModelPortaliQ15646.
SMRiQ15646.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15646.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini354 – 433Ubiquitin-like 1PROSITE-ProRule annotationAdd BLAST80
Domaini434 – 509Ubiquitin-like 2PROSITE-ProRule annotationAdd BLAST76

Domaini

The ubiquitin-like domains are essential for its antiviral activity.

Sequence similaritiesi

Belongs to the 2-5A synthase family.Curated
Contains 2 ubiquitin-like domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0001. Eukaryota.
COG5272. LUCA.
GeneTreeiENSGT00510000046406.
HOGENOMiHOG000022614.
HOVERGENiHBG000994.
KOiK14608.
OMAiCFHSFQE.
OrthoDBiEOG091G0160.
PhylomeDBiQ15646.
TreeFamiTF329749.

Family and domain databases

Gene3Di1.10.1410.20. 1 hit.
InterProiIPR006117. 2-5-oligoadenylate_synth_CS.
IPR006116. 2-5-oligoadenylate_synth_N.
IPR018952. 2-5-oligoAdlate_synth_1_dom2/C.
IPR026774. 2-5A_synthase.
IPR029071. Ubiquitin-rel_dom.
IPR000626. Ubiquitin_dom.
[Graphical view]
PANTHERiPTHR11258. PTHR11258. 1 hit.
PfamiPF10421. OAS1_C. 1 hit.
PF00240. ubiquitin. 1 hit.
[Graphical view]
SMARTiSM00213. UBQ. 2 hits.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 2 hits.
PROSITEiPS00832. 25A_SYNTH_1. 1 hit.
PS00833. 25A_SYNTH_2. 1 hit.
PS50152. 25A_SYNTH_3. 1 hit.
PS50053. UBIQUITIN_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform p56 (identifier: Q15646-1) [UniParc]FASTAAdd to basket
Also known as: OASL a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALMQELYST PASRLDSFVA QWLQPHREWK EEVLDAVRTV EEFLRQEHFQ
60 70 80 90 100
GKRGLDQDVR VLKVVKVGSF GNGTVLRSTR EVELVAFLSC FHSFQEAAKH
110 120 130 140 150
HKDVLRLIWK TMWQSQDLLD LGLEDLRMEQ RVPDALVFTI QTRGTAEPIT
160 170 180 190 200
VTIVPAYRAL GPSLPNSQPP PEVYVSLIKA CGGPGNFCPS FSELQRNFVK
210 220 230 240 250
HRPTKLKSLL RLVKHWYQQY VKARSPRANL PPLYALELLT IYAWEMGTEE
260 270 280 290 300
DENFMLDEGF TTVMDLLLEY EVICIYWTKY YTLHNAIIED CVRKQLKKER
310 320 330 340 350
PIILDPADPT LNVAEGYRWD IVAQRASQCL KQDCCYDNRE NPISSWNVKR
360 370 380 390 400
ARDIHLTVEQ RGYPDFNLIV NPYEPIRKVK EKIRRTRGYS GLQRLSFQVP
410 420 430 440 450
GSERQLLSSR CSLAKYGIFS HTHIYLLETI PSEIQVFVKN PDGGSYAYAI
460 470 480 490 500
NPNSFILGLK QQIEDQQGLP KKQQQLEFQG QVLQDWLGLG IYGIQDSDTL
510
ILSKKKGEAL FPAS
Length:514
Mass (Da):59,226
Last modified:May 30, 2000 - v2
Checksum:i4D8BB655D9EA003E
GO
Isoform p30 (identifier: Q15646-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-255: YVKARSPRANLPPLYALELLTIYAWEMGTEEDENFM → AHHPGSGRPHPQRGRRVQMGHRCSEGLPVPETGLLL
     256-514: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):29,084
Checksum:iAB54142EF4549492
GO
Isoform 3 (identifier: Q15646-3) [UniParc]FASTAAdd to basket
Also known as: OASL d

The sequence of this isoform differs from the canonical sequence as follows:
     220-349: Missing.

Note: Has antiviral activity against RNA viruses.
Show »
Length:384
Mass (Da):43,942
Checksum:i7993256048CEFC6D
GO

Sequence cautioni

The sequence AAC41733 differs from that shown. Reason: Frameshift at position 386.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26 – 38HREWK…LDAVR → TGVEGRGARRCA in AAD28541 (PubMed:9826176).CuratedAdd BLAST13
Sequence conflicti26 – 38HREWK…LDAVR → TGVEGRGARRCA in AAD28542 (PubMed:9826176).CuratedAdd BLAST13
Sequence conflicti89S → T in AAD28542 (PubMed:9826176).Curated1
Sequence conflicti95 – 113QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28541 (PubMed:9826176).CuratedAdd BLAST19
Sequence conflicti95 – 113QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28542 (PubMed:9826176).CuratedAdd BLAST19
Sequence conflicti223A → S in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti317Y → I in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti321I → T in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti324Q → L in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti341 – 342NP → KG in AAC41733 (PubMed:7776974).Curated2
Sequence conflicti407L → F in BAG37039 (PubMed:14702039).Curated1
Sequence conflicti445S → T in AAD28541 (PubMed:9826176).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053544341N → I.Corresponds to variant rs35249920dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_046572220 – 349Missing in isoform 3. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_003743220 – 255YVKAR…DENFM → AHHPGSGRPHPQRGRRVQMG HRCSEGLPVPETGLLL in isoform p30. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_003744256 – 514Missing in isoform p30. 1 PublicationAdd BLAST259

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ225089 mRNA. Translation: CAA12396.1.
AF063611 mRNA. Translation: AAD28541.1.
AF063612 mRNA. Translation: AAD28542.1.
JQ792168 mRNA. Translation: AFJ00074.1.
AK314419 mRNA. Translation: BAG37039.1.
AC079602 Genomic DNA. No translation available.
Z93097 Genomic DNA. No translation available.
BC117408 mRNA. Translation: AAI17409.1.
BC117410 mRNA. Translation: AAI17411.1.
L40387 Genomic DNA. Translation: AAC41733.1. Frameshift.
CCDSiCCDS73536.1. [Q15646-3]
CCDS9211.1. [Q15646-1]
CCDS9212.1. [Q15646-2]
RefSeqiNP_001248754.1. NM_001261825.1. [Q15646-3]
NP_003724.1. NM_003733.3. [Q15646-1]
NP_937856.1. NM_198213.2. [Q15646-2]
XP_016875630.1. XM_017020141.1. [Q15646-2]
UniGeneiHs.118633.

Genome annotation databases

EnsembliENST00000257570; ENSP00000257570; ENSG00000135114. [Q15646-1]
ENST00000339275; ENSP00000341125; ENSG00000135114. [Q15646-2]
ENST00000620239; ENSP00000479512; ENSG00000135114. [Q15646-3]
GeneIDi8638.
KEGGihsa:8638.
UCSCiuc001tzj.3. human. [Q15646-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ225089 mRNA. Translation: CAA12396.1.
AF063611 mRNA. Translation: AAD28541.1.
AF063612 mRNA. Translation: AAD28542.1.
JQ792168 mRNA. Translation: AFJ00074.1.
AK314419 mRNA. Translation: BAG37039.1.
AC079602 Genomic DNA. No translation available.
Z93097 Genomic DNA. No translation available.
BC117408 mRNA. Translation: AAI17409.1.
BC117410 mRNA. Translation: AAI17411.1.
L40387 Genomic DNA. Translation: AAC41733.1. Frameshift.
CCDSiCCDS73536.1. [Q15646-3]
CCDS9211.1. [Q15646-1]
CCDS9212.1. [Q15646-2]
RefSeqiNP_001248754.1. NM_001261825.1. [Q15646-3]
NP_003724.1. NM_003733.3. [Q15646-1]
NP_937856.1. NM_198213.2. [Q15646-2]
XP_016875630.1. XM_017020141.1. [Q15646-2]
UniGeneiHs.118633.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WH3NMR-A434-507[»]
4XQ7X-ray1.60A1-350[»]
ProteinModelPortaliQ15646.
SMRiQ15646.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114191. 9 interactors.
IntActiQ15646. 8 interactors.
MINTiMINT-4993190.
STRINGi9606.ENSP00000257570.

PTM databases

iPTMnetiQ15646.
PhosphoSitePlusiQ15646.

Polymorphism and mutation databases

BioMutaiOASL.
DMDMi6226835.

Proteomic databases

MaxQBiQ15646.
PaxDbiQ15646.
PeptideAtlasiQ15646.
PRIDEiQ15646.

Protocols and materials databases

DNASUi8638.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257570; ENSP00000257570; ENSG00000135114. [Q15646-1]
ENST00000339275; ENSP00000341125; ENSG00000135114. [Q15646-2]
ENST00000620239; ENSP00000479512; ENSG00000135114. [Q15646-3]
GeneIDi8638.
KEGGihsa:8638.
UCSCiuc001tzj.3. human. [Q15646-1]

Organism-specific databases

CTDi8638.
DisGeNETi8638.
GeneCardsiOASL.
H-InvDBHIX0201831.
HGNCiHGNC:8090. OASL.
HPAiHPA001474.
MIMi603281. gene.
neXtProtiNX_Q15646.
OpenTargetsiENSG00000135114.
PharmGKBiPA31879.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0001. Eukaryota.
COG5272. LUCA.
GeneTreeiENSGT00510000046406.
HOGENOMiHOG000022614.
HOVERGENiHBG000994.
KOiK14608.
OMAiCFHSFQE.
OrthoDBiEOG091G0160.
PhylomeDBiQ15646.
TreeFamiTF329749.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000135114-MONOMER.
ZFISH:ENSG00000157873-MONOMER.
ReactomeiR-HSA-877300. Interferon gamma signaling.
R-HSA-909733. Interferon alpha/beta signaling.

Miscellaneous databases

ChiTaRSiOASL. human.
EvolutionaryTraceiQ15646.
GeneWikiiOASL.
GenomeRNAii8638.
PROiQ15646.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135114.
CleanExiHS_OASL.
ExpressionAtlasiQ15646. baseline and differential.
GenevisibleiQ15646. HS.

Family and domain databases

Gene3Di1.10.1410.20. 1 hit.
InterProiIPR006117. 2-5-oligoadenylate_synth_CS.
IPR006116. 2-5-oligoadenylate_synth_N.
IPR018952. 2-5-oligoAdlate_synth_1_dom2/C.
IPR026774. 2-5A_synthase.
IPR029071. Ubiquitin-rel_dom.
IPR000626. Ubiquitin_dom.
[Graphical view]
PANTHERiPTHR11258. PTHR11258. 1 hit.
PfamiPF10421. OAS1_C. 1 hit.
PF00240. ubiquitin. 1 hit.
[Graphical view]
SMARTiSM00213. UBQ. 2 hits.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 2 hits.
PROSITEiPS00832. 25A_SYNTH_1. 1 hit.
PS00833. 25A_SYNTH_2. 1 hit.
PS50152. 25A_SYNTH_3. 1 hit.
PS50053. UBIQUITIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiOASL_HUMAN
AccessioniPrimary (citable) accession number: Q15646
Secondary accession number(s): B2RAZ2
, I1YDD2, O75686, Q17R95, Q9Y6K6, Q9Y6K7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 30, 2000
Last modified: November 2, 2016
This is version 152 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

This is the ortholog of mouse OASL1.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.