Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15646 (OASL_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 129. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
2'-5'-oligoadenylate synthase-like protein
Alternative name(s):
2'-5'-OAS-related protein
Short name=2'-5'-OAS-RP
59 kDa 2'-5'-oligoadenylate synthase-like protein
Thyroid receptor-interacting protein 14
Short name=TR-interacting protein 14
Short name=TRIP-14
p59 OASL
Short name=p59OASL
Gene names
Name:OASL
Synonyms:TRIP14
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length514 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. Displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L. Ref.2 Ref.10 Ref.13

Subunit structure

Specifically interacts with the ligand binding domain of the thyroid receptor (TR). TRIP14 does not require the presence of thyroid hormone for its interaction. Binds MBD1. Ref.8

Subcellular location

Isoform p56: Nucleusnucleolus. Cytoplasm Ref.2.

Isoform p30: Cytoplasm Ref.2.

Tissue specificity

Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.

Induction

By type I interferon (IFN) and viruses. Ref.11 Ref.13

Domain

The ubiquitin-like domains are essential for its antiviral activity.

Sequence similarities

Belongs to the 2-5A synthase family.

Contains 2 ubiquitin-like domains.

Caution

This is the ortholog of mouse OASL1.

Sequence caution

The sequence AAC41733.1 differs from that shown. Reason: Frameshift at position 386.

Ontologies

Keywords
   Biological processAntiviral defense
Immunity
Innate immunity
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
   LigandRNA-binding
   PTMAcetylation
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcytokine-mediated signaling pathway

Traceable author statement. Source: Reactome

defense response to virus

Inferred from electronic annotation. Source: UniProtKB-KW

interferon-gamma-mediated signaling pathway

Traceable author statement. Source: Reactome

negative regulation of viral genome replication

Inferred from direct assay Ref.10Ref.13. Source: UniProtKB

response to virus

Inferred from direct assay Ref.10Ref.13. Source: UniProtKB

type I interferon signaling pathway

Traceable author statement. Source: Reactome

   Cellular_componentcytoplasm

Inferred from direct assay Ref.2. Source: UniProtKB

cytosol

Traceable author statement. Source: Reactome

nucleolus

Inferred from direct assay Ref.2. Source: UniProtKB

   Molecular_functionATP binding

Inferred from electronic annotation. Source: InterPro

DNA binding

Inferred from direct assay Ref.2. Source: UniProtKB

double-stranded RNA binding

Inferred from direct assay Ref.2. Source: UniProtKB

poly(A) RNA binding

Inferred from direct assay PubMed 22658674. Source: UniProtKB

thyroid hormone receptor binding

Traceable author statement Ref.7. Source: UniProtKB

transferase activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform p56 (identifier: Q15646-1)

Also known as: OASL a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform p30 (identifier: Q15646-2)

The sequence of this isoform differs from the canonical sequence as follows:
     220-255: YVKARSPRANLPPLYALELLTIYAWEMGTEEDENFM → AHHPGSGRPHPQRGRRVQMGHRCSEGLPVPETGLLL
     256-514: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q15646-3)

Also known as: OASL d;

The sequence of this isoform differs from the canonical sequence as follows:
     220-349: Missing.
Note: Has antiviral activity against RNA viruses.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.15
Chain2 – 5145132'-5'-oligoadenylate synthase-like protein
PRO_0000160266

Regions

Domain354 – 43380Ubiquitin-like 1
Domain434 – 50976Ubiquitin-like 2

Amino acid modifications

Modified residue21N-acetylalanine Ref.15

Natural variations

Alternative sequence220 – 349130Missing in isoform 3.
VSP_046572
Alternative sequence220 – 25536YVKAR…DENFM → AHHPGSGRPHPQRGRRVQMG HRCSEGLPVPETGLLL in isoform p30.
VSP_003743
Alternative sequence256 – 514259Missing in isoform p30.
VSP_003744
Natural variant3411N → I.
Corresponds to variant rs35249920 [ dbSNP | Ensembl ].
VAR_053544

Experimental info

Sequence conflict26 – 3813HREWK…LDAVR → TGVEGRGARRCA in AAD28541. Ref.2
Sequence conflict26 – 3813HREWK…LDAVR → TGVEGRGARRCA in AAD28542. Ref.2
Sequence conflict891S → T in AAD28542. Ref.2
Sequence conflict95 – 11319QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28541. Ref.2
Sequence conflict95 – 11319QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28542. Ref.2
Sequence conflict2231A → S in AAD28541. Ref.2
Sequence conflict3171Y → I in AAD28541. Ref.2
Sequence conflict3211I → T in AAD28541. Ref.2
Sequence conflict3241Q → L in AAD28541. Ref.2
Sequence conflict341 – 3422NP → KG in AAC41733. Ref.7
Sequence conflict4071L → F in BAG37039. Ref.4
Sequence conflict4451S → T in AAD28541. Ref.2

Secondary structure

................ 514
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform p56 (OASL a) [UniParc].

Last modified May 30, 2000. Version 2.
Checksum: 4D8BB655D9EA003E

FASTA51459,226
        10         20         30         40         50         60 
MALMQELYST PASRLDSFVA QWLQPHREWK EEVLDAVRTV EEFLRQEHFQ GKRGLDQDVR 

        70         80         90        100        110        120 
VLKVVKVGSF GNGTVLRSTR EVELVAFLSC FHSFQEAAKH HKDVLRLIWK TMWQSQDLLD 

       130        140        150        160        170        180 
LGLEDLRMEQ RVPDALVFTI QTRGTAEPIT VTIVPAYRAL GPSLPNSQPP PEVYVSLIKA 

       190        200        210        220        230        240 
CGGPGNFCPS FSELQRNFVK HRPTKLKSLL RLVKHWYQQY VKARSPRANL PPLYALELLT 

       250        260        270        280        290        300 
IYAWEMGTEE DENFMLDEGF TTVMDLLLEY EVICIYWTKY YTLHNAIIED CVRKQLKKER 

       310        320        330        340        350        360 
PIILDPADPT LNVAEGYRWD IVAQRASQCL KQDCCYDNRE NPISSWNVKR ARDIHLTVEQ 

       370        380        390        400        410        420 
RGYPDFNLIV NPYEPIRKVK EKIRRTRGYS GLQRLSFQVP GSERQLLSSR CSLAKYGIFS 

       430        440        450        460        470        480 
HTHIYLLETI PSEIQVFVKN PDGGSYAYAI NPNSFILGLK QQIEDQQGLP KKQQQLEFQG 

       490        500        510 
QVLQDWLGLG IYGIQDSDTL ILSKKKGEAL FPAS 

« Hide

Isoform p30 [UniParc].

Checksum: AB54142EF4549492
Show »

FASTA25529,084
Isoform 3 (OASL d) [UniParc].

Checksum: 7993256048CEFC6D
Show »

FASTA38443,942

References

« Hide 'large scale' references
[1]"p59OASL, a 2'-5' oligoadenylate synthetase like protein: a novel human gene related to the 2'-5' oligoadenylate synthetase family."
Hartmann R., Olsen H.S., Widder S., Joergensen R., Justesen J.
Nucleic Acids Res. 26:4121-4127(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P56).
[2]"Molecular cloning and characterization of two related and interferon-induced 56-kDa and 30-kDa proteins highly similar to 2'-5' oligoadenylate synthetase."
Rebouillat D., Marie I., Hovanessian A.G.
Eur. J. Biochem. 257:319-330(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS P56 AND P30), FUNCTION, SUBCELLULAR LOCATION.
Tissue: Monocyte.
[3]"Identification of OASL d, a splice variant of human OASL, with antiviral activity."
Guo X., Li X., Xu Y., Sun T., Yang G., Wu Z., Li E.
Int. J. Biochem. Cell Biol. 44:1133-1138(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P56).
Tissue: Mammary gland.
[5]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM P56).
Tissue: Brain.
[7]"Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor."
Lee J.W., Choi H.-S., Gyuris J., Brent R., Moore D.D.
Mol. Endocrinol. 9:243-254(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 260-416 (ISOFORM P56).
[8]"Interaction between the 2'-5' oligoadenylate synthetase-like protein p59 OASL and the transcriptional repressor methyl CpG-binding protein 1."
Andersen J.B., Strandbygaard D.J., Hartmann R., Justesen J.
Eur. J. Biochem. 271:628-636(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH MBD1.
Tissue: Leukocyte.
[9]"The human 2'-5'oligoadenylate synthetase family: unique interferon-inducible enzymes catalyzing 2'-5' instead of 3'-5' phosphodiester bond formation."
Hovanessian A.G., Justesen J.
Biochimie 89:779-788(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW ON FUNCTION.
[10]"The p59 oligoadenylate synthetase-like protein possesses antiviral activity that requires the C-terminal ubiquitin-like domain."
Marques J., Anwar J., Eskildsen-Larsen S., Rebouillat D., Paludan S.R., Sen G., Williams B.R., Hartmann R.
J. Gen. Virol. 89:2767-2772(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[11]"Differential regulation of the OASL and OAS1 genes in response to viral infections."
Melchjorsen J., Kristiansen H., Christiansen R., Rintahaka J., Matikainen S., Paludan S.R., Hartmann R.
J. Interferon Cytokine Res. 29:199-207(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION.
[12]"Evolution of the 2'-5'-oligoadenylate synthetase family in eukaryotes and bacteria."
Kjaer K.H., Poulsen J.B., Reintamm T., Saby E., Martensen P.M., Kelve M., Justesen J.
J. Mol. Evol. 69:612-624(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[13]"2',5'-Oligoadenylate synthetase-like gene highly induced by hepatitis C virus infection in human liver is inhibitory to viral replication in vitro."
Ishibashi M., Wakita T., Esumi M.
Biochem. Biophys. Res. Commun. 392:397-402(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INDUCTION.
[14]"The oligoadenylate synthetase family: an ancient protein family with multiple antiviral activities."
Kristiansen H., Gad H.H., Eskildsen-Larsen S., Despres P., Hartmann R.
J. Interferon Cytokine Res. 31:41-47(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW ON FUNCTION.
[15]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
[16]"Solution structure of C-terminal ubiquitin-like domain of human 2'-5'-oligoadenylate synthetase-like protein (p59 OASL)."
RIKEN structural genomics initiative (RSGI)
Submitted (NOV-2004) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 432-507.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ225089 mRNA. Translation: CAA12396.1.
AF063611 mRNA. Translation: AAD28541.1.
AF063612 mRNA. Translation: AAD28542.1.
JQ792168 mRNA. Translation: AFJ00074.1.
AK314419 mRNA. Translation: BAG37039.1.
AC079602 Genomic DNA. No translation available.
Z93097 Genomic DNA. No translation available.
BC117408 mRNA. Translation: AAI17409.1.
BC117410 mRNA. Translation: AAI17411.1.
L40387 Genomic DNA. Translation: AAC41733.1. Frameshift.
RefSeqNP_001248754.1. NM_001261825.1.
NP_003724.1. NM_003733.3.
NP_937856.1. NM_198213.2.
UniGeneHs.118633.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1WH3NMR-A434-507[»]
ProteinModelPortalQ15646.
SMRQ15646. Positions 6-346, 368-514.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114191. 3 interactions.
IntActQ15646. 1 interaction.
MINTMINT-4993190.
STRING9606.ENSP00000257570.

PTM databases

PhosphoSiteQ15646.

Polymorphism databases

DMDM6226835.

Proteomic databases

PaxDbQ15646.
PRIDEQ15646.

Protocols and materials databases

DNASU8638.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000257570; ENSP00000257570; ENSG00000135114. [Q15646-1]
ENST00000339275; ENSP00000341125; ENSG00000135114. [Q15646-2]
GeneID8638.
KEGGhsa:8638.
UCSCuc001tzj.2. human. [Q15646-1]
uc001tzk.2. human. [Q15646-2]

Organism-specific databases

CTD8638.
GeneCardsGC12M121459.
H-InvDBHIX0201831.
HGNCHGNC:8090. OASL.
HPAHPA001474.
MIM603281. gene.
neXtProtNX_Q15646.
PharmGKBPA31879.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG309765.
HOGENOMHOG000022614.
HOVERGENHBG000994.
InParanoidQ15646.
KOK14608.
OMACFHSFQE.
OrthoDBEOG7WDN1R.
PhylomeDBQ15646.
TreeFamTF329749.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.

Gene expression databases

BgeeQ15646.
CleanExHS_OASL.
GenevestigatorQ15646.

Family and domain databases

Gene3D1.10.1410.20. 1 hit.
InterProIPR006117. 2-5-oligoadenylate_synth_CS.
IPR006116. 2-5-oligoadenylate_synth_N.
IPR018952. 2-5-oligoAdlate_synth_1_dom2/C.
IPR026774. 2-5A_synthase.
IPR000626. Ubiquitin-like.
[Graphical view]
PANTHERPTHR11258. PTHR11258. 1 hit.
PfamPF10421. OAS1_C. 1 hit.
PF00240. ubiquitin. 1 hit.
[Graphical view]
SMARTSM00213. UBQ. 2 hits.
[Graphical view]
PROSITEPS00832. 25A_SYNTH_1. 1 hit.
PS00833. 25A_SYNTH_2. 1 hit.
PS50152. 25A_SYNTH_3. 1 hit.
PS50053. UBIQUITIN_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSOASL. human.
EvolutionaryTraceQ15646.
GeneWikiOASL.
GenomeRNAi8638.
NextBio32383.
PROQ15646.
SOURCESearch...

Entry information

Entry nameOASL_HUMAN
AccessionPrimary (citable) accession number: Q15646
Secondary accession number(s): B2RAZ2 expand/collapse secondary AC list , I1YDD2, O75686, Q17R95, Q9Y6K6, Q9Y6K7
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 30, 2000
Last modified: April 16, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM